GenomeNet

Database: RefSeq
Entry: NC_017278
LinkDB: NC_017278
Original site: NC_017278 
LOCUS       NC_017278            2243772 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Thermus sp. CCB_US3_UF1, complete genome.
ACCESSION   NC_017278
VERSION     NC_017278.1  GI:384438400
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603100
            Assembly: GCF_000236585.1
KEYWORDS    RefSeq.
SOURCE      Thermus sp. CCB_US3_UF1
  ORGANISM  Thermus sp. CCB_US3_UF1
            Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae;
            Thermus.
REFERENCE   1  (bases 1 to 2243772)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Complete genome sequence of thermophilic Thermus sp. CCB_US3_UF1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2243772)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2011) Centre for Chemical Biology (CCB@USM),
            Universiti Sains Malaysia (USM), 1st Floor, Block B No.10,
            Persiaran Bukit Jambul, Bayan Lepas, Pulau Pinang 11900, Malaysia
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Bacteria available from Centre for Chemical Biology (CCB@USM)
            (info@ccbusm.edu.my).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/07/2014 03:00:00
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 2,289
            CDS                          :: 2,211
            Pseudo Genes                 :: 23
            CRISPR Arrays                :: 8
            rRNAs                        :: 6 ( 5S, 16S, 23S )
            tRNAs                        :: 48
            ncRNA                        :: 1
            Frameshifted Genes           :: 20
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2243772
                     /organism="Thermus sp. CCB_US3_UF1"
                     /mol_type="genomic DNA"
                     /strain="CCB_US3_UF1"
                     /db_xref="taxon:1111069"
     gene            complement(join(2241994..2243772,1..12))
                     /locus_tag="TCCBUS3UF1_RS00005"
     CDS             complement(join(2241994..2243772,1..12))
                     /locus_tag="TCCBUS3UF1_RS00005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014516644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein"
                     /protein_id="WP_041433907.1"
                     /db_xref="GI:752794476"
                     /translation="MRYDVVVVGGGHAGLEAAWAAAALGVRVALVTVNPERIGMMPCN
                     PAVGGPGKSQLVAEVVALGGLMGRAADAAAIHTRVLNRSKGPAVQSLRVQVDRDLYAL
                     KAQEILQERPVEVLRGEVAALWLEGGRLVGVRTVDGRGIGAKAVVVAGGTFLGGVVWY
                     GRRSRPAGRQGEPPARFLSQSLRAVGHTLRRFKTGTPPRIRFDSVDFAELEVVPPEVP
                     PGSFTGNPGPHAARLPTWQTRTTEATHRLIRENLHLSPLYAGDIQGIGPRYCPSIEDK
                     VVRFADKESHLLFVEPDGLATSEVYLQGFSSSLPPELQETMVKSLPGFARAVIQRYAY
                     AVEYDSLDPTELTRGLQSRLLPGLFSAGQVNGTSGYEEAAAQGLLAGLNAARYALGLP
                     EVHLPRESGYIGVLVDDLVGRGTDEPYRMMTSRVELRLLCRADNADERLVPLAVAWGL
                     RPEEDRLQVEAKYRRVAAELKRLEALRLEGVSGLGWLRRPGNTYAALAERFPPPEPLT
                     PEEAYQVEVRAKYAGYMERQERLREKLKDLEAFRIPEGLDFPRVPGLSREAVEKLSRL
                     RPRTVAEAARVPGIRDSDLTALLVHLRRQA"
     gene            48..1388
                     /locus_tag="TCCBUS3UF1_RS00010"
                     /old_locus_tag="TCCBUS3UF1_10"
     CDS             48..1388
                     /locus_tag="TCCBUS3UF1_RS00010"
                     /old_locus_tag="TCCBUS3UF1_10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_014514422.1"
                     /db_xref="GI:504327320"
                     /translation="MFPWNSGVALTHEAIWHHVLEHIRRNITEVEFHTWFERIRPLGV
                     REGVLELAVPTSFALDWIRKHYAELIQEALGLLGAQAPRFELKVVPGTAIQEDIFQAT
                     PSPEPAQPRLNPKYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTH
                     LMHAVGHSVAKRFPHLKIEYVSTETFTNELINAIREDRMAEFRERYRSVDLLLVDDIQ
                     FIAGKERTQEEFFHTFNALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQP
                     PDLETRIAILKMNAEQRGLRVSEEVLEYIARQVTSNIRELEGALVRVIAYASLNGVEL
                     TRAVAARALSDIFAPKEVEVDPQEIVAKVAEHFGLKPEELLGSGRRKEVVLPRQIAMF
                     LVREFTRASFPEIGQFFGGRDHTTVIYAIQKVQELSESDREVQRLLRQLREAFL"
     gene            1687..2811
                     /locus_tag="TCCBUS3UF1_RS00015"
                     /old_locus_tag="TCCBUS3UF1_20"
     CDS             1687..2811
                     /locus_tag="TCCBUS3UF1_RS00015"
                     /old_locus_tag="TCCBUS3UF1_20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514423.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_014514423.1"
                     /db_xref="GI:504327321"
                     /translation="MDVTLPKNLLAEQIALLERVIPSRSSNPMFTYLGLAPQAGGLTL
                     FGSNGEVDLEVHLPAQVQGEGRYLVPAQPFFQLVRSLPGDTAILRLGLDLELSSGSFR
                     TRLSLAPSEGYPELIFPEPGVASPDYPLQTRLPAEGFLRALVHVRYAASNEEYRAIFR
                     GVQLEFSPQGVRAVASDGYRLALYDLPLPQPFQRKAVVPARSVDEVIRVLKGMGEGEA
                     VLALGAGTLGLTLGQEGGGRLRLAVRLMEGEFPDYERVIPKEFPLRAGLEVEPFREAL
                     RRVSVLSDRQNHRVDLLFGEGHVLLSAEGDYGKGQEELPVRLEGTPLAVAYNARYLLE
                     ALGPLSGQAALLLSGPTSPSLIRPLGEGEGYQAVVVPLRV"
     gene            2877..4145
                     /gene="eno"
                     /locus_tag="TCCBUS3UF1_RS00020"
                     /old_locus_tag="TCCBUS3UF1_30"
     CDS             2877..4145
                     /gene="eno"
                     /locus_tag="TCCBUS3UF1_RS00020"
                     /old_locus_tag="TCCBUS3UF1_30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514424.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_014514424.1"
                     /db_xref="GI:504327322"
                     /translation="MTTIVSVKAREVLDSRGFPTVEAEVELEGGVRGRAMVPSGASTG
                     THEALELRDGGRRYLGKGVRRAVENINERIAPELIGMEALDQEGVDRAMRELDGTPNK
                     ANLGANAILAVSLATARAAAEALGLPLYRYLGGVQGVVLPVPLMNVINGGKHADNRVD
                     FQEFMLVPAGVESFAEALRVGAEVFHTLKGVLKEKGYSTNVGDEGGFAPDLRSNEEAV
                     ELLLLAIERAGYTPGQEVSLALDPAASELYREGRYHLEGEGKVLTSEEMVAFWASWVE
                     KYPIRSIEDGLSEDDWEGWRLLTKTLGERVQLVGDDLFVTNPERLAQGIERGVANAIL
                     VKVNQIGTLSETLEAIRLAQRSGYRAVISHRSGETEDPFIADLAVAVNAGQIKTGSLS
                     RSDRLAKYNQLLRIEEELGRAARFLGYAAF"
     gene            4132..5556
                     /locus_tag="TCCBUS3UF1_RS00025"
                     /old_locus_tag="TCCBUS3UF1_40"
     CDS             4132..5556
                     /locus_tag="TCCBUS3UF1_RS00025"
                     /old_locus_tag="TCCBUS3UF1_40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="WP_014514425.1"
                     /db_xref="GI:504327323"
                     /translation="MLPFKRTKIVATLGPASSSKEAIRALAEAGADVFRLNFSHGTPE
                     DHRQRVALVREVAQELGRPLAILQDLQGPKIRIGRFREGRVELKAGQPFVLTREPIEG
                     DQGRVSLTYGGLPEDVSPGQLLLLDDGRLRLRVEAVRGDEIHTVVEVGGVLSDHKGIN
                     VPGADLSIPALSEKDIQDVALGAELGVDWVAVSFVRTRDDLLLARHYLARYGSRAKLM
                     AKIEKPSAVHRFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRLILRCIAAGKPVIT
                     ATQMLESMVHNPSPTRAEASDVANAIFDGSDAVMLSAETAAGAYPVEAVAMMARIARV
                     VESSPEFLQKLNVLRPAPTPTTQDAIAQAADDVVEAVGARAIVVFTATGGSARRIART
                     RPQVPILALTPNPEVQRQLALVWGVLPQLAPDPRDTDDMVRIALEKVKASGLAQVGER
                     VVIAAGVPFGVRGTTNLLRVERVS"
     gene            complement(5553..6299)
                     /locus_tag="TCCBUS3UF1_RS00030"
                     /old_locus_tag="TCCBUS3UF1_50"
     CDS             complement(5553..6299)
                     /locus_tag="TCCBUS3UF1_RS00030"
                     /old_locus_tag="TCCBUS3UF1_50"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylaminoadipate kinase"
                     /protein_id="WP_014514426.1"
                     /db_xref="GI:504327324"
                     /translation="MREALLVKVGGSLRGAEELLEELAQYPGPLVLVHGGGPEIGALL
                     ERLGYESRFVEGLRVTPPEQMDAVEMALCLTGKRLAQGLSQRGRKALSLSGRDALCLG
                     GRLLPGLGRVGEVVGVDPRPLLDLLGAGYTPLLAPIALDEEGPLNVNADTAAAAVAGA
                     LGWPAVFLTDVEGVYRHPKDPASRIPQLTPEAVAALKAEGVLQGGMIPKVEAALAALR
                     AGSPWAAIAKGRGGVLEGVLKGEAGTRFYP"
     gene            complement(6292..6780)
                     /locus_tag="TCCBUS3UF1_RS00035"
                     /old_locus_tag="TCCBUS3UF1_60"
     CDS             complement(6292..6780)
                     /locus_tag="TCCBUS3UF1_RS00035"
                     /old_locus_tag="TCCBUS3UF1_60"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433908.1"
                     /db_xref="GI:752794477"
                     /translation="MRSFLSFHVQAPLEAALAFAQGRTGGAGVYLVPDPPWVSLYHEA
                     LEAHEDPGAIQGFLEDLSHLGRALAFLVLGEEDLLFLLAEGGEVRAELRQGPELGRAL
                     RAPQALLPLLERAQAMPPLSAVQALAIAFGLHPDHAALGFLDLLEAEEEEGLPEEVVY
                     LA"
     gene            6801..8420
                     /locus_tag="TCCBUS3UF1_RS00040"
                     /old_locus_tag="TCCBUS3UF1_70"
     CDS             6801..8420
                     /locus_tag="TCCBUS3UF1_RS00040"
                     /old_locus_tag="TCCBUS3UF1_70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514428.1"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the tau chain serves as a
                     scaffold to help in the dimerizaton of the alpha,epsilon
                     and theta core complex; the gamma chain seems to interact
                     with the delta and delta' subunits to transfer the beta
                     subunit on the DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_014514428.1"
                     /db_xref="GI:504327326"
                     /translation="MSALYRRVRPLTFAEVVGQEHVKEPLLRAIGEGRLAQAYLFSGP
                     RGVGKTTTARLLAMAVGCQGEEKPCGACPHCQAVQKGTHPDVVEIDAASNNSVEDVRE
                     LRERILLAPLSAPRKVFILDEAHMLSKSAFNALLKTLEEPPAHVLFIFATTEPERMPP
                     TILSRTQHYRFRRLTESEIAAKLRRILEGLGREAEEEALFLLARLADGAMRDAESLLD
                     RFLLLPGPLTRAQVEAALGLPPQEALFLLARRLAEGQVREALEEARRLYGQGFAPRSL
                     VGGLMEVLREALYAAHGLPGRSLPLSPKELLFALSRLDEALERLAKRSDPLALEVALL
                     QAFSPSPAQAPPGLQAPPPQEAPLPEFHPLAPLPPRPRQEASPQADLSGLWRAFLEDL
                     KPTLRAFVREARPEVQGKTLLLRFPESKAFHHKKAEEQKAHLLPLAQSRFGVEEVAFL
                     LEKKSPGPSLQTAPPPRAEPPTPKPAPLPVEAPRAEEEPLPPEPEGEDPGQSLTRLAR
                     LLGGRLLWVRRPKPSEPEEPLSEDSIGGSGI"
     gene            8428..8709
                     /locus_tag="TCCBUS3UF1_RS00045"
                     /old_locus_tag="TCCBUS3UF1_80"
     CDS             8428..8709
                     /locus_tag="TCCBUS3UF1_RS00045"
                     /old_locus_tag="TCCBUS3UF1_80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514429.1"
                     /db_xref="GI:504327327"
                     /translation="MTRTTELGQDTVENILKRLRRIEGQVRGLQKMVAEGRPCDEVLT
                     QMTATKKAMEAAATLILHEFLNVCATEVSEGKVDPKKPEEIATMLKKFI"
     gene            8715..9194
                     /locus_tag="TCCBUS3UF1_RS00050"
                     /old_locus_tag="TCCBUS3UF1_90"
     CDS             8715..9194
                     /locus_tag="TCCBUS3UF1_RS00050"
                     /old_locus_tag="TCCBUS3UF1_90"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_014514430.1"
                     /db_xref="GI:504327328"
                     /translation="MRKGFASRLGKRLARLFRAFRGEVPEDAFALAFLKGEERALYLA
                     MDPRDRAHAVRVAKRLLRAHPQAPSFAVRAALLHDAGKALRPYRPWERILTGLYAPPV
                     PPYPLRRGLWGAIQIRRHHPLYAAERIQDPEVRALVLEHHRPQSLWGKRLHRADQEE"
     gene            9268..11121
                     /locus_tag="TCCBUS3UF1_RS00055"
                     /old_locus_tag="TCCBUS3UF1_100"
     CDS             9268..11121
                     /locus_tag="TCCBUS3UF1_RS00055"
                     /old_locus_tag="TCCBUS3UF1_100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoacid:ferredoxin oxidoreductase subunit
                     alpha"
                     /protein_id="WP_014514431.1"
                     /db_xref="GI:504327329"
                     /translation="MDELTWRVGGPQGGGIETAATLFARAVAKGGWCVATKREYHSNI
                     MGRHSYLDVRLSRKPVGAFREKVDFLVALDGETLARHLGEVRPGGVLLYDPRVLDLTV
                     HKLPMLDHRVQEALSQRFGKPDPSLKEVLQAYAEGGVQPLPYPFEEVADRIGAELGVA
                     SLQARRTLNTIAVAASLHLLGFPLEPLLEALALQFRGKVLELNQAVAQAVYREEVPRL
                     PFALHLNGPTPGRVYLTGAQAAALGKLAGGLRFQTYYPISPATDESVYLEAHTAFQGA
                     EVAVVQTEDEIAAVTMAIGAALTGAKAATATSGPGFSLMAEGLGFAGMIEAPLVVTLY
                     QRGGPSTGLPTRTEQGDLFFALRGGHGEYPRLVLASGDVLDAFLDAQKALAWAWRYQT
                     VVVHLLDKFLASTAQSLPKEALRVLALDGEKRLEPRREGFGPYERYAPSEDGISPFVP
                     LGTPGGFYWMTSDEHDLEGHITEDPVLREYQMEKRMQKLHTARREIPPEDQYTLFRDG
                     EVLVLGWGTVKGTLLEALDHLPGVGYLHLRLLWPFPEVGPLLEGKRLVTVEHNYTGQL
                     ADLVQQETLKRVHHRVVKYNGRPITLDEAVAALKAVMAGQAAERLVLRGGV"
     gene            11123..12037
                     /locus_tag="TCCBUS3UF1_RS00060"
                     /old_locus_tag="TCCBUS3UF1_110"
     CDS             11123..12037
                     /locus_tag="TCCBUS3UF1_RS00060"
                     /old_locus_tag="TCCBUS3UF1_110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoacid ferredoxin oxidoreductase subunit
                     beta"
                     /protein_id="WP_014514432.1"
                     /db_xref="GI:504327330"
                     /translation="MVELKLADYKAEKNPDWCPGCGDYGILSALQMALFELKRDPSQT
                     VVFSGIGCSAKTPHYLNVYGVHTLHGRVLPVAQGAKLANPHLTVVAVGGDGDGLGIGA
                     GHFVAAGRRNVDMLYILYDNEVYGLTKGQAGPTLGLGEKTKSLPKPNPQGRINPLLLA
                     FAAGYTWIARGYAYDVKGLKELIKEGILHRGLAFLHVLQPCPTYNDLHTKEWFAPRLY
                     KLQEEGYDPQVPEGLSPEELDEKMARFQEKAAEWGERIPIGIFWKAEVPTFEERLRAY
                     LPRYPEVYPALGQREALDLEGLLQEFAL"
     gene            complement(12038..13318)
                     /locus_tag="TCCBUS3UF1_RS00065"
                     /old_locus_tag="TCCBUS3UF1_120"
     CDS             complement(12038..13318)
                     /locus_tag="TCCBUS3UF1_RS00065"
                     /old_locus_tag="TCCBUS3UF1_120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid oxidase"
                     /protein_id="WP_014514433.1"
                     /db_xref="GI:504327331"
                     /translation="MPGEGVLVVGAGILGLSAAHFLAEKGLRVLVLEREAPLACTSDK
                     STECYRVFWPGDEALSALVARSLELLGPFGEVARPQGRGYLYLGEEETLLRMAQEAPL
                     AGPLRVHQEATGYPKGAETGMDLLRPQALGQAFPYLAHLRGVAGLHVRRAGWLSAHGL
                     GMGLLEALRKRRGRLLRGEFCGLEGQGGRPAFARVRLGGVEELLPFAACVLAPGPGLP
                     SLLSLLGLELPLGAEPHFKAWFPDPLRRFPREAPLLIWNEPQEIFSPEEKALLAEEPS
                     LAPLLSPLPPGAHGRPEGEGFLALYNPWPKAEAPGGCAPTPPSWAGEVALRGLFPLLP
                     GLRAYLGSRPRVDGGYYVKTPENRPLLGPVAEGVYLLGAFSGYGVMAALGAGEALARW
                     VVGETPPPWAEALSPKRYQDPGYRPHGAAARAEL"
     gene            13345..13818
                     /locus_tag="TCCBUS3UF1_RS00070"
                     /old_locus_tag="TCCBUS3UF1_130"
     CDS             13345..13818
                     /locus_tag="TCCBUS3UF1_RS00070"
                     /old_locus_tag="TCCBUS3UF1_130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaC"
                     /protein_id="WP_014514434.1"
                     /db_xref="GI:504327332"
                     /translation="MDLTHFKDGRPHMVDVTEKPATFRTATAEAFVELTEEALAALER
                     GGVGKGDPLVVAQLAGILGAKRTADLIPLCHPLPLTGVEVDLALEKEARRVRIQATVR
                     TKAETGVEMEALTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRREG"
     gene            13828..14160
                     /locus_tag="TCCBUS3UF1_RS00075"
                     /old_locus_tag="TCCBUS3UF1_140"
     CDS             13828..14160
                     /locus_tag="TCCBUS3UF1_RS00075"
                     /old_locus_tag="TCCBUS3UF1_140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dinitrogenase iron-molybdenum cofactor
                     biosynthesis protein"
                     /protein_id="WP_014514435.1"
                     /db_xref="GI:504327333"
                     /translation="MRLAIALAKHDEGKVYPGPFGHAPRFAIYELAEDGTFLLVEVRE
                     NPHAALEGGDKHQRMRELLKDVDLRVGARFGHGGSMGAFPMADRLEVGPVSLAEALER
                     VKARRNTA"
     gene            complement(14135..15061)
                     /locus_tag="TCCBUS3UF1_RS00080"
                     /old_locus_tag="TCCBUS3UF1_150"
     CDS             complement(14135..15061)
                     /locus_tag="TCCBUS3UF1_RS00080"
                     /old_locus_tag="TCCBUS3UF1_150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016330091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514436.1"
                     /db_xref="GI:504327334"
                     /translation="MGPGFHRLYAGRLAWRYRLGLALAMALLGLLHPLWALLSPLALL
                     LPARWWEGRALREIARVSLAYPTALAYGEARLWAEAARVRLEPPSFPWGFLLAYLLAL
                     LLALAGTPWRASEGVPTPPIAPTSPTAPTRGAEGPPGSQEPPPGEAPRALEAPSGQGG
                     EGGPGTPGAQGDEGNPGSAEQAPGRERPQGPGGSEGAQGSAGAGQEGVQGPQGASGGE
                     GAQGQGQGDRPGTGGPLPQVDREALPAPTPLGPGQGLLGPGGEGGAPDLPSPWPAGRP
                     PEEVRRGVEVYLERTPLPPEVRELLRRYFGGP"
     gene            complement(15128..15556)
                     /locus_tag="TCCBUS3UF1_RS00085"
                     /old_locus_tag="TCCBUS3UF1_160"
     CDS             complement(15128..15556)
                     /locus_tag="TCCBUS3UF1_RS00085"
                     /old_locus_tag="TCCBUS3UF1_160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsB"
                     /protein_id="WP_014514437.1"
                     /db_xref="GI:504327335"
                     /translation="MKRFLPLALLLGLLALAQSPGAKLYSANCQSCHQATGQGLPGAF
                     PPLTHLDKVVQAKGGREYLVHVVLYGLQGPLTVEGKAYNGVMPPFRQLKDQEVADLLN
                     HVLTAFAKSKAKAFTAEEVKALRAKPLSPQDVLKSRPPVK"
     gene            complement(15585..16655)
                     /locus_tag="TCCBUS3UF1_RS00090"
                     /old_locus_tag="TCCBUS3UF1_170"
     CDS             complement(15585..16655)
                     /locus_tag="TCCBUS3UF1_RS00090"
                     /old_locus_tag="TCCBUS3UF1_170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014514438.1"
                     /db_xref="GI:504327336"
                     /translation="MKPDLHRFPLLVAWEMTRACLLACLHCRASAVPDPLPDELSTEE
                     GLRLLRELATYTPKPILLPTGGDPLARPDLFLLLEEARRLGLKVGITPAVTPRLTREV
                     VARFKELGVHQMALSLDGASPEAHDGFRGVPGTFALALEALSWAQEVGLMTQVNTTVT
                     RRTVGELPGLAQILAEKGVATWEVFFLVPVGRGAMLEQLSPEAYEEVMHLLYDLSRRY
                     PFKVRTTEGPMFRRVALERRRREGGEDGALVGEGRGVHLSDGFGFVFVAANGEVYPSG
                     FLPLAAGNIREKPLLEIYQRSPLFLELRDRTLLKGKCGVCEYRELCGGSRARAWAETG
                     DYLAADPRCAYTPRGPGQMPLA"
     gene            complement(16694..17683)
                     /locus_tag="TCCBUS3UF1_RS00095"
                     /old_locus_tag="TCCBUS3UF1_180"
     CDS             complement(16694..17683)
                     /locus_tag="TCCBUS3UF1_RS00095"
                     /old_locus_tag="TCCBUS3UF1_180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514439.1"
                     /db_xref="GI:504327337"
                     /translation="MRKALALLALALPALAQEVTVYPGFAEVKEAVVLPPSAWVYLAG
                     EKLARIPPGSLRLLGVEEEERVYQGTAVLFRYRGEGKATLRYLYTGLSGEVFYTLEEG
                     RLTAWARLRLEGEALEAQRLTLVSGAVSLEAQPAPGVALRALAEAPQGSPFGLFRYEL
                     PPRRLLPGTTELPFQKAEVRPERLLRLAGPFRTDRFLPLERGYRFQAPFPLAPGPLEA
                     VEGGLFLGQASLPPTPRGEVAEVWLGQDLEARLLRSVRLLSQTDKEATYQVETRLENP
                     YPYPVTLLLSETFPQPFRLDLPGATLLPQGYRLELGLKAKEARTLTYRLTLPR"
     gene            complement(17680..18294)
                     /locus_tag="TCCBUS3UF1_RS00100"
                     /old_locus_tag="TCCBUS3UF1_190"
     CDS             complement(17680..18294)
                     /locus_tag="TCCBUS3UF1_RS00100"
                     /old_locus_tag="TCCBUS3UF1_190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014514440.1"
                     /db_xref="GI:504327338"
                     /translation="MSGPEPLRFAATLYRVPVEGGYFLVDAGLPWEAGRLLRLLPQPP
                     RLLFLTHHHLDHSGGALTLWRRFRLPILAHPQEWPYLTGERPRPPLPIPFLGRRLANL
                     APPLPREALRPAEEGMEVLGWRVVALPGHTLGQVGLLKEGVLLAGDALRGKGLPPRFI
                     NEDHGLARKTVRKILDLGAERILLGHGGPLSREEVAALARRLGV"
     gene            complement(18281..20128)
                     /locus_tag="TCCBUS3UF1_RS00105"
                     /old_locus_tag="TCCBUS3UF1_200"
     CDS             complement(18281..20128)
                     /locus_tag="TCCBUS3UF1_RS00105"
                     /old_locus_tag="TCCBUS3UF1_200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_014514441.1"
                     /db_xref="GI:504327339"
                     /translation="MVLDKVNSPEDLKRLSLEELLTLAEEIRSEIIRVTAQNGGHLAS
                     SLGAVELILALHRVFHSPKDRILFDVGHQAYAHKLVTGRKDRFHTLRQEGGISGFTKV
                     SESEHDAITVGHASTSLANALGMALARDLRGEDHHVVAVIGDGALTGGMALAALNKIG
                     ELGKRMLIVLNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGKEILQHISPRLFGL
                     VDRAKEAAKLLLHQENPFYAWGIRYVGPVDGHDLKGLIHILEHLKELEGPTLLHVVTQ
                     KGKGYKVAEADPIYWHGPPGFNPEKPEKVSKGYSWSQAFGDAVTELAHLEPRLFVITP
                     AMREGSGLVRYSLEHPERYLDVGICEDVAVTTAAGLALKGMKPVVAIYSTFLQRAYDQ
                     AIHDVAIENLPVVFAIDRAGIVGADGATHHGVFDIAYLRTIPNFQIAAPKDALELRAM
                     LRKALEVGGPVAIRYPRDNVERVPEGVWPEIPWGKWEVVKEGREAYILAFGKTLRYAL
                     EAAGDDPRVGVVNARFLKPLDREMLRELAAYKLLTVEDHQRMGGFGSAVLEALNEMGL
                     RPEIRVLGLPDRFLDHGTIPSLHRQAGIDAEGIRRALAEMGLHPAYERA"
     gene            complement(20137..20781)
                     /locus_tag="TCCBUS3UF1_RS00110"
                     /old_locus_tag="TCCBUS3UF1_210"
     CDS             complement(20137..20781)
                     /locus_tag="TCCBUS3UF1_RS00110"
                     /old_locus_tag="TCCBUS3UF1_210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433590.1"
                     /db_xref="GI:752794158"
                     /translation="MRRYLMALALALAACAPQVTQSPEARPQLKEVGFYPSTTGLEWV
                     YVPEGEALSAPPYRVRAEGPAVFEGQEALRFRSFGRGEERVYYRQVGPFGVRLLGFQD
                     PSARVVFTPALLEYPPEALLSPGYRWSGTVQVRVELLTPGGREPLAQGALDYTMEVLE
                     EREVRLPAGVFRVYRIRQTFRDRQGQDAREVWLAPRVGEVRTREGRILVERNFN"
     gene            complement(20792..21190)
                     /locus_tag="TCCBUS3UF1_RS00115"
                     /old_locus_tag="TCCBUS3UF1_220"
     CDS             complement(20792..21190)
                     /locus_tag="TCCBUS3UF1_RS00115"
                     /old_locus_tag="TCCBUS3UF1_220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514443.1"
                     /db_xref="GI:504327341"
                     /translation="MPLFLELLLLALALALLALLLRPEPKGLAWARARLQGLVDWGEV
                     EAALKALEAREKELQEALQAPHLLPETRGELERALEEARETRRRLLALVQSLAAERAL
                     ARGGAEEARRLEERLRALREVLVSLRPGKG"
     gene            complement(21198..21860)
                     /locus_tag="TCCBUS3UF1_RS00120"
                     /old_locus_tag="TCCBUS3UF1_230"
     CDS             complement(21198..21860)
                     /locus_tag="TCCBUS3UF1_RS00120"
                     /old_locus_tag="TCCBUS3UF1_230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phage-shock protein"
                     /protein_id="WP_014514444.1"
                     /db_xref="GI:504327342"
                     /translation="MNLLDRIGRLIRANLNDLLRRAEDPEKILEQALGDMKEALKEAR
                     EQVAAALAEGKRLEREVESHLQEAALWEEKAKEALGAGREDLAKEALRRRKRALDLAE
                     GFKQQLAEQRALSERLLTQLKALEAKIDEAESRKKLLLARKKGVEAAEAVRRLESRLD
                     QHPALEAFEEMEARILALEDRHEALKELDGKDLEKELAALSADKEVEEELTRLKRELG
                     QA"
     gene            21940..22533
                     /locus_tag="TCCBUS3UF1_RS00125"
                     /old_locus_tag="TCCBUS3UF1_240"
     CDS             21940..22533
                     /locus_tag="TCCBUS3UF1_RS00125"
                     /old_locus_tag="TCCBUS3UF1_240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014514445.1"
                     /db_xref="GI:504327343"
                     /translation="MHLLKDPVEARLLQAALELLAERGYRGATTKEVARRAGVSEVTL
                     FRRFGRKEALFRRALSSFVPPGFLERLPGEGVSLEEGLMRLLQAYLGLLEAHRALFLK
                     LLPELLRHPELKEEGPPEGLRAAMERVVGFFRAHQGQGGLREDEPAEELALAFLGPLL
                     ARFLLGEVLGVGMPLDPAAYVRGYLEGRYGPRRGSHA"
     gene            22505..23365
                     /locus_tag="TCCBUS3UF1_RS00130"
                     /old_locus_tag="TCCBUS3UF1_250"
     CDS             22505..23365
                     /locus_tag="TCCBUS3UF1_RS00130"
                     /old_locus_tag="TCCBUS3UF1_250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter"
                     /protein_id="WP_014514446.1"
                     /db_xref="GI:504327344"
                     /translation="MVHAEEVTRSFGGTRALDRVSLSVRPGEVFGLLGPNGAGKTTLV
                     RILSGVLRPDGGKAWVAGLEVAREPHRVKARIGYATQEASVYRDLMVEENLLFRARLY
                     RPKEARALAAEALVRFGLTPYAKALAGHLSGGWRQRLALAQAVVHRPEVLFLDEPTTG
                     LDPLSRRSIWELIHQEAARGAAVLVTTHYMDEAERCHRLGLLFGGRVLAEGTPQELKA
                     QAKARAQFLFAPGASLEEVRGWPGVLEAWPSGEGVRLLLRRQAPRAAGWVEVEPSLED
                     VFVLLTKEAA"
     gene            23362..24483
                     /locus_tag="TCCBUS3UF1_RS00135"
                     /old_locus_tag="TCCBUS3UF1_260"
     CDS             23362..24483
                     /locus_tag="TCCBUS3UF1_RS00135"
                     /old_locus_tag="TCCBUS3UF1_260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014514447.1"
                     /db_xref="GI:504327345"
                     /translation="MNRVLALAEKELLQIRRDRVLPRLIVLLPTLMLLLFGYAINFTL
                     EGIPLAVADASRDRVSQTLVEELQRDGRFRLVFQAASPQEVLEAVDRGQARVGLVVPA
                     GALEKVRRGESLSLEVYVDGTDPNFAFQAQAALRKAIQEVNARILLGRALAGEAVLPP
                     LSPVLHTLYNPENRTAWFMIPGIIGLVLTMFTVLLTALAIVREAESRMMESLLASPLR
                     PHEMVLGKVLPYLLIAFLVALLVLALGHWVFGVPVRGSLALLLLAMFLFVLGSLAAGV
                     LISTLARTQVQAVFGTYAYAFPTIFLSGFVFPIDGMPRFFQALSYLVPARYLIEVLRG
                     VMLKGVGFSVLWPHLLALALFSVLVLFLASARFQRQVAV"
     gene            24480..25229
                     /locus_tag="TCCBUS3UF1_RS00140"
                     /old_locus_tag="TCCBUS3UF1_270"
     CDS             24480..25229
                     /locus_tag="TCCBUS3UF1_RS00140"
                     /old_locus_tag="TCCBUS3UF1_270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514448.1"
                     /db_xref="GI:504327346"
                     /translation="MRRFLALGFLLGLALAQGRLEGGVYASLASMGPTLEAALSLGEG
                     EVYLRAQGGRAGLGYLGGLALGPLGYLAYGVQGELGEGGLGGVLFAEGGAGLLAFQGR
                     LGYRPQGAFPLFPEAGPFGRLSLRYRLVPREVVGFLVEGGEAFRLEATYALRQEATHT
                     LGLGVAGWPYLVLGHKGEVGEEGEVLDLLLRLGGINRLEAGLYLGEASLFLTLSHPWA
                     GSVGAWLGDLGLEAGYRGAPYAWIRYVWRWP"
     gene            25229..25867
                     /locus_tag="TCCBUS3UF1_RS00145"
                     /old_locus_tag="TCCBUS3UF1_280"
     CDS             25229..25867
                     /locus_tag="TCCBUS3UF1_RS00145"
                     /old_locus_tag="TCCBUS3UF1_280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014514449.1"
                     /db_xref="GI:504327347"
                     /translation="MGKRILVLVLCLGLALAQSVAEILERVEKNLQDPWQALVQGQVQ
                     GPSGLEELRARLLAIPKENLFRLEFLKPGSLEGNFTVITEKEVWNYLYLTNQLVVSPK
                     EKAQVQGLGFSPQGLGDLKALSERVSLRLGGEERLAEGVAWRLLGQAKEGQGFAQLEL
                     YILKADPRPVRFLFRDEAGKVLAELRVVEFKKTPLRAQDLKRYPKDAQVVRR"
     gene            complement(25869..26807)
                     /locus_tag="TCCBUS3UF1_RS00150"
                     /old_locus_tag="TCCBUS3UF1_290"
     CDS             complement(25869..26807)
                     /locus_tag="TCCBUS3UF1_RS00150"
                     /old_locus_tag="TCCBUS3UF1_290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514450.1"
                     /db_xref="GI:504327348"
                     /translation="MAQADPMPPRETALEDTLSWTGSLEEFPLSAVLQTLAKTRSTGT
                     LWIQPVAAGLHLREGRLQAVSGLLPLGDILLARGQLEEEDLAEALKRRVRPLGQALLQ
                     QGLGAEALREALSLQVHLGIAFLLHYLPGQAFHFRPTPPLPPPEADLEITPLLLEWLR
                     LHKPLPLSAPVELAPQPGPVHLDEEAWRLVRLVNGRRSLANVLRFSGLHPKRAWEKAE
                     ELLHRGLLRPSALFGLRLIVPARAPRRANYHPPSSLMANLFLKWVNGERTAAQIGEIL
                     GLKPQETALYLVDLFREGLIEVAQGRPEMERLADDF"
     gene            complement(26842..27762)
                     /locus_tag="TCCBUS3UF1_RS00155"
                     /old_locus_tag="TCCBUS3UF1_300"
     CDS             complement(26842..27762)
                     /locus_tag="TCCBUS3UF1_RS00155"
                     /old_locus_tag="TCCBUS3UF1_300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003049067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_041433592.1"
                     /db_xref="GI:752794160"
                     /translation="MRVEGVIGRTPLVRLARVVEPGMAEVWVKLEGQNPGGSIKDRPA
                     WYMIRDAEERGLLRPGSGQVIVEPTSGNTGIGLAMIAASRGYRLILTMPAQMSEERKR
                     VLRAFGAELVLTDPERRMLAAREEALRLKEALGAFMPDQFANPANVRAHYETTGPELY
                     QALEGRIDAFVYGSGTGGTLSGVGRYLKERIPGVKVFAVEPARSNVLSGGKMGQHGFQ
                     GMGPGFIPENLDLSLLDGVIQVWEEDAFPLARRLAREEGLFLGMSSGGIVWAALQVAR
                     ELGPGKRVACISPDGGWKYLSTPLYATLEP"
     gene            27869..28336
                     /locus_tag="TCCBUS3UF1_RS00160"
                     /old_locus_tag="TCCBUS3UF1_310"
     CDS             27869..28336
                     /locus_tag="TCCBUS3UF1_RS00160"
                     /old_locus_tag="TCCBUS3UF1_310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_014514452.1"
                     /db_xref="GI:504327350"
                     /translation="MKVEQDKVVTIRYTLQVEGEVLDQGELSYLHGHGNLIRGLEEEL
                     EGREEGESFQAHVPAEKAYGPHDPDGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMP
                     LTVVEVQGEEVTIDFNHPLAGKDLDFAVEVVRVREATPEELLHGHAHEGGHAH"
     gene            28453..28659
                     /locus_tag="TCCBUS3UF1_RS00165"
                     /old_locus_tag="TCCBUS3UF1_320"
     CDS             28453..28659
                     /locus_tag="TCCBUS3UF1_RS00165"
                     /old_locus_tag="TCCBUS3UF1_320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cold-shock protein"
                     /protein_id="WP_014514453.1"
                     /db_xref="GI:504327351"
                     /translation="MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFSAIEAEGFRTLNEG
                     ERVEFEVEPGRGGKGPQAKKVRRL"
     gene            28716..29465
                     /locus_tag="TCCBUS3UF1_RS00170"
                     /old_locus_tag="TCCBUS3UF1_330"
     CDS             28716..29465
                     /locus_tag="TCCBUS3UF1_RS00170"
                     /old_locus_tag="TCCBUS3UF1_330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_041433909.1"
                     /db_xref="GI:752794478"
                     /translation="MRILVSNDDGIFSPGIKALGLAMRALGEVYVVAPDVEQSAVGHG
                     ITVRRPLRFKHTQSAGFGEIPAYRVDGTPADCVVLGVHLLGRPDLLVSGINIGVNLGL
                     DLTHSGTVAAALEGASLGIPSIAFSLDTSGEEMNFALAAEWAVRIARRVAERGLPKGV
                     LLNVNFPAGTPKGIQVTRLSTHRFEDTVVERIDPEGKPYYWIAGTPVGEEEEGTDLWA
                     VRRGYISLTPVSLDFTAAHFLGELAEWAQGL"
     gene            complement(29462..30232)
                     /locus_tag="TCCBUS3UF1_RS00175"
                     /old_locus_tag="TCCBUS3UF1_340"
     CDS             complement(29462..30232)
                     /locus_tag="TCCBUS3UF1_RS00175"
                     /old_locus_tag="TCCBUS3UF1_340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514455.1"
                     /db_xref="GI:504327353"
                     /translation="MRPVFFLSDFGLEDPYVGVVKAVLAQRAPGVGVVDLGHGLPPQD
                     LRRGAYALFEALPYLPEGAVVLAVVDPGVGTERRAIAAEGRWWYVGPDNGLFTLAWLL
                     DPPRRAFTLERVRPPTPHGGFPGWSPGGYTFHGRDRFAPAAAHLALGLPPEALGLEVP
                     VADLVRLPLALTPGPEGEVLTFDRFGNAITTLLQAPLGGWVEVGGWRIPVRRTFGEVG
                     EGEAVAYRGSGGLLEVAVNRGRAREALGLREGMPVRLL"
     gene            complement(30234..31682)
                     /locus_tag="TCCBUS3UF1_RS00180"
                     /old_locus_tag="TCCBUS3UF1_350"
     CDS             complement(30234..31682)
                     /locus_tag="TCCBUS3UF1_RS00180"
                     /old_locus_tag="TCCBUS3UF1_350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="abortive phage infection protein"
                     /protein_id="WP_041433594.1"
                     /db_xref="GI:752794162"
                     /translation="MRLIWGLLVLWGLSAFAQGAEEYYARCQRLYVQGALESAQATCE
                     LALVSNPEHRPSLRLLARIALERGDLAQARGYLERLGEDPEALGLRARLLLGEGKPGE
                     VLGLPLPQDPEGRFLRASALEGLGRLEEALAEATGLPPTPEARLLLARLHLALGHPER
                     ALAALGSSREERVEQGHLLLLLGNPEEAARLLEALLPELAGQPSLQRKALATLVLAYL
                     GQGDLARGRAALAQLAQLENLPGRFLERTWPWFLALLAFLVLVLLGESRIEPLRTLEV
                     VEEPKPGPGRLYLLVLAALLGAFLVALLLGKALFGNLLALFTPYQQGQVLPTFYLAYG
                     LFLFLGVFLGERRRLPGLLGPWGSWVEGFWVGPTLALALLAYGALRSLLGLSTLPLDL
                     LTFLGFAFMEPLFRGLAPLAFRERYGEMGRSLTALFFAVAVPGPSLLLLLLGAGLLWA
                     KERAGSVLGVALGWVVAGVLLALLPPGWLRRF"
     gene            31776..32441
                     /locus_tag="TCCBUS3UF1_RS00185"
                     /old_locus_tag="TCCBUS3UF1_360"
     CDS             31776..32441
                     /locus_tag="TCCBUS3UF1_RS00185"
                     /old_locus_tag="TCCBUS3UF1_360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514457.1"
                     /db_xref="GI:504327355"
                     /translation="MALSLAQAPQVAALVDAGRFQEAYEAGLRLATPEALALAAKGAS
                     FHAMYLAKPEEKRAWFERAEKAASQAIAKAPDYAEGYFERARALGRLAQYKGILEALA
                     EGLAPRIRSDLEKTLKLDPNHAGAMVALALWHFELVQKGWLVAATQGADGAKVEPLMK
                     KAIELEPDGIIHRVEYAKVLAAWNKKEEARKQLETALSLPAKTAADRYDQERARQELA
                     RLK"
     gene            complement(32444..33040)
                     /locus_tag="TCCBUS3UF1_RS00190"
                     /old_locus_tag="TCCBUS3UF1_370"
     CDS             complement(32444..33040)
                     /locus_tag="TCCBUS3UF1_RS00190"
                     /old_locus_tag="TCCBUS3UF1_370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014514458.1"
                     /db_xref="GI:504327356"
                     /translation="MVELLVWLGTLVFAATGALKGVEKGFDLLGVLVLATVTAVGGGS
                     IRDVLVGTLPPTALRNEALLWSVVLTGLLVFRFHPRVQALERPIYYLDTLGLGLFAAL
                     GAERGLEAGLGPFGVALAGTLSGVGGGVLRDVLSGEVPGILYRAGDLYASAALVGALV
                     AYALHGAHPEWALFAGALATVLLRVFGRRLGLRLPTPR"
     gene            complement(33033..33491)
                     /locus_tag="TCCBUS3UF1_RS00195"
                     /old_locus_tag="TCCBUS3UF1_380"
     CDS             complement(33033..33491)
                     /locus_tag="TCCBUS3UF1_RS00195"
                     /old_locus_tag="TCCBUS3UF1_380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_014514459.1"
                     /db_xref="GI:504327357"
                     /translation="MRLGYGEDSHRLLEGRPLYLCGLWLPSPVGALAHSDGDAALHAL
                     TDALLSAYGLGDIGLLFPDTDPRWQGVRSEVFLKEALRRVEERGGRLVQASLVLVLDR
                     PKLSPHRQALVDNLARLLGLPQDRVGLSFKTSEGLAEGHVQARAVVLLDG"
     gene            33508..34059
                     /locus_tag="TCCBUS3UF1_RS00200"
                     /old_locus_tag="TCCBUS3UF1_390"
     CDS             33508..34059
                     /locus_tag="TCCBUS3UF1_RS00200"
                     /old_locus_tag="TCCBUS3UF1_390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="WP_014514460.1"
                     /db_xref="GI:504327358"
                     /translation="MPSFAEALALMEAWTESESLRRHMRAVEVAMRAYARRYGEDEEL
                     WAMAGVLHDMDYEKYPGEHPYRGVEALRQLGYPEEVLEAILAHASYTGVPRRTRMAKA
                     LFAVDELTGLITAAVYVRPDRSILGLELPSLKKKFKDKAFAKGVNREEILKGAEDLGV
                     PLDEHLAFVLEAMRAEAGLLGLG"
     gene            34096..34416
                     /locus_tag="TCCBUS3UF1_RS00205"
                     /old_locus_tag="TCCBUS3UF1_400"
     CDS             34096..34416
                     /locus_tag="TCCBUS3UF1_RS00205"
                     /old_locus_tag="TCCBUS3UF1_400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433597.1"
                     /db_xref="GI:752794165"
                     /translation="MELPDLTPYLGQMTFGGLAGYAVGFALKKVGRLLAFSLGLLFVA
                     LQLLAQAGYVQVDWTRIQKEVEPLLQGPGLKNLWEGLLRTLTYNLPFGASFMGGFLLG
                     LRAG"
     gene            complement(34403..34963)
                     /locus_tag="TCCBUS3UF1_RS00210"
                     /old_locus_tag="TCCBUS3UF1_410"
     CDS             complement(34403..34963)
                     /locus_tag="TCCBUS3UF1_RS00210"
                     /old_locus_tag="TCCBUS3UF1_410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_014514462.1"
                     /db_xref="GI:504327360"
                     /translation="MTLGELREEVWNALARHGLALHPTPPHGHHPNFLGGRRAAERLL
                     ATPEFLGARLLLVGMDAVLKPLREEALRRGKALLLPHPDRPGEFLLLKDLDPRRLKRV
                     REAYRFGVKAPLEGQPIDLVLIGAVAVDEEGGWVGKGYGFPQAWLRVAAPFATLAHPL
                     MVYPRLPVTPERRVDLIATPERLIRP"
     gene            35019..38687
                     /locus_tag="TCCBUS3UF1_RS00215"
                     /old_locus_tag="TCCBUS3UF1_420"
     CDS             35019..38687
                     /locus_tag="TCCBUS3UF1_RS00215"
                     /old_locus_tag="TCCBUS3UF1_420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_014514463.1"
                     /db_xref="GI:504327361"
                     /translation="MASRLKFAHLHQHTQYSLLDGAAKLTDLLKWVKEVSPEEPALAI
                     TDHGNLFGAIEFYKKATAMGVKPILGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKD
                     FRGYQNLVRLASRAYLEGFYEKPRIDREILREHAEGLIALSGCLGAEIPQFILQDRLD
                     LAEARLQEYLSIFGDRFFLELQNHGLPEQQKVNAVLKEFARKYGLGMVATNDGHYVRK
                     EDARAHEVLLAVQSKTTLDDPERWRFPCDEFYVKTPEEMRAAFPEAEWGDEPFDNTVV
                     IARMCQVDLPIGDRMVYRIPRFPLPEGRTEAQYLRELTFLGLLRRYPDRITEGFYREV
                     FRRLGKLPPHGDGVALAQALAQVEEGAWEAFLSGLPPLEGVGEWTAEAILHRALYELS
                     VIERMGFPGYFLIVQDYINWARQNGISVGPGRGSAAGSLVAYAVGITNIDPLRFGLLF
                     ERFLNPERVSMPDIDTDFSDRERDRVIEYVRRRYGADRVAQIGTFGSLASKAALKDVA
                     RVYGIPHKKAEELAKLIPVQFGKPKPLAEAIQVVPELRAEMEKDPKVREVLEVAMRLE
                     GLNRHASVHAAGVVIAQEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRT
                     LTFLDEAKRILKESRGVELDYDRIPLDDPKTFDLLSRGETKGVFQLESGGMTSTVRGL
                     KPRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVAYPEFPHAERYLRPILEETYGI
                     PVYQEQIMQIASAVAGYSLGEADLLRRAMGKKKLEEMQRHRERFVRGAKERGIPEEEA
                     HRLFDMLEAFANYGFNKSHAAAYSLLAYQTAYVKAHYPVEYMAALLSVERHDSDKVAE
                     YIRDARSLGIPVLPPDINRSGFDFKVVGGEILFGLSAVKNVGEGAASAILQERERGGP
                     YRSLGDFLKRLDEKVVNKRTLESLVKAGAFDAFGDRARLLASLEPLLRWAAESRERAR
                     SGMMGLFAEVEEPPLAEASPLDEITRLRYEKEALGIYVSGHPVLRYPGLREVASCALE
                     DLPHFAHDLPPRARVLLAGMVEEVVRKPTKSGGMMARFVLSDETGALEAVAFGRAYEG
                     VSPKLKEDTPLLVLAEVEREEGGVRVMAQAVWTYEEVAEAPKALEVEADHALLDEKGV
                     TLLKSLLDEHPGPYPFYVRVQGPFGEALFALKEVRASEEALRALEAEGFRAYLVPDRE
                     VFLQGNGGNGSKEEAVPF"
     gene            complement(38734..40365)
                     /gene="groEL"
                     /locus_tag="TCCBUS3UF1_RS00220"
                     /old_locus_tag="TCCBUS3UF1_430"
     CDS             complement(38734..40365)
                     /gene="groEL"
                     /locus_tag="TCCBUS3UF1_RS00220"
                     /old_locus_tag="TCCBUS3UF1_430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550604.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_014514464.1"
                     /db_xref="GI:504327362"
                     /translation="MAKILVFDEAARRALERGVNAVADAVKVTLGPRGRNVVLEKKFG
                     SPTITKDGVTVAKEIELENHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREG
                     LKNVAAGANPLALKRGIEKAVEAAVEKIRSLAIPVEDRKAIEEVATISANDPDVGKLI
                     ADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFITSPDTMEAVLEDAFI
                     LIVEKKVSNVRELLPVLEQVAQTGKPLLLIAEDVEGEALATLVVNKLRGTLNVAAVKA
                     PGFGDRRKEMLKDIAAVTGGTVISEELGFKLENATLSMLGRAERVRITKDETTIVGGK
                     GKKEDIEARINAIKKELETTDSEYAKEKLQERLAKLAGGVAVIRVGAATETELKEKKH
                     RFEDALSATRAAVEEGIVPGGGVTLLRAISAVDELLKKLEGDEATGAKIVRRALEEPA
                     RQIAENAGYEGSVVVQRILAETQNLRLGFNAATGEYVDMVEAGIVDPAKVTRSALQNA
                     ASIGALILTTEAVVAEKPEKKESTPAPASSGDMDF"
     gene            complement(40389..40694)
                     /locus_tag="TCCBUS3UF1_RS00225"
                     /old_locus_tag="TCCBUS3UF1_440"
     CDS             complement(40389..40694)
                     /locus_tag="TCCBUS3UF1_RS00225"
                     /old_locus_tag="TCCBUS3UF1_440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003049015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_014514465.1"
                     /db_xref="GI:504327363"
                     /translation="MAAEVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKG
                     KVIAVGSGRILENGQKVPLEVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVLS"
     gene            complement(40770..41858)
                     /locus_tag="TCCBUS3UF1_RS00230"
                     /old_locus_tag="TCCBUS3UF1_450"
     CDS             complement(40770..41858)
                     /locus_tag="TCCBUS3UF1_RS00230"
                     /old_locus_tag="TCCBUS3UF1_450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514466.1"
                     /db_xref="GI:504327364"
                     /translation="MEGFLALLLLLALGWAPRWLRVRACLQGLPPGFPGQGGMGEVVA
                     ELFAPLPVLFRLESLPSGPLGLPAQALVGVAWGRTRLHLPLPYRYRRRGEHPVRLTLR
                     VWSALGIGEHTLSLEAGQAVVYPSLRPLPPFRLAPSFFLEGGPAPFGLPDPLEAHSLR
                     PYRPGDPLRLLARKASLRHGEPWVREAEKRLQGGLFLHLDTQSLHPSYPDHAASLAAW
                     LLLEAERRGERYGLSAGEVLPLGRGRGHLERALTLLARLKPTPGPALPPPAPPGSTYL
                     LVSQVAEEAFLEAALRGSARARQGVLLLLPEGYFLYPGERGRPAFGKTPGLERALRAR
                     ALLAARGLALRVVRGYEIPALHIPPQPP"
     gene            complement(41861..42775)
                     /locus_tag="TCCBUS3UF1_RS00235"
                     /old_locus_tag="TCCBUS3UF1_460"
     CDS             complement(41861..42775)
                     /locus_tag="TCCBUS3UF1_RS00235"
                     /old_locus_tag="TCCBUS3UF1_460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase"
                     /protein_id="WP_014514467.1"
                     /db_xref="GI:504327365"
                     /translation="MFYPRIQQALEGRVFLPEETLKLALATLLSGGHLLLEDVPGTGK
                     TTFAKALARALGLRFGRIQMTPDLLPQDLTGVYFYREGEFLWQPGPLFAQVLLVDELN
                     RATPRTQSALLEAMGEGQVTLEGKTHPLPEPFFVLATQNPVEEEGTYPLPVAQRDRFA
                     ARLSLGYPDERALLQALRERDPLEGLKAVTGAEEVLALRQQVRRVRMEEELLDYLLSL
                     SAWLRGREEVRLGPSPRALLQVERLAQALALLEERPFAIPEDVKRAFLAAIPHRLLLR
                     LEAELSGARPEGLVQEALATIPAPVERV"
     gene            complement(42745..44058)
                     /locus_tag="TCCBUS3UF1_RS00240"
                     /old_locus_tag="TCCBUS3UF1_470"
     CDS             complement(42745..44058)
                     /locus_tag="TCCBUS3UF1_RS00240"
                     /old_locus_tag="TCCBUS3UF1_470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433910.1"
                     /db_xref="GI:752794479"
                     /translation="MPRWPFPWLSFFLAAVLLWAALPRGGLALALGVGLIPLTRILYP
                     QGFLWFAPLPGLLHALYAPFPLWLADWAATSASLLLLGLFLAAQGRPLASLFLLPPAL
                     DLGPWGLFLLGLLHGVNLLEGALSQGREGRVALALPPRALLLPLLLGLGMAGLAYLPF
                     PASSLPLPHLSPFGPAEALGGGMEPGESAVYQTPEGGFPAWVGFLNRALGYALPLALA
                     LLLFSLWPLAGRGERLPYRGGHLLPLLMALLAFALFLLYLGTLGGGEGREAGTPPASL
                     WAPGEGPRPEAIPGPRRLGEVGVALAGFSALLTLAFFSLLLLAVWRRSRGEGEVRAGA
                     RTAPRGQALGETLPEDRVRRAYLKALRALGAQGWPRQAWEGPLEYGERVARSFPEVRA
                     SLFALTRLYLPVRYGGGAGEGAAEQAEGILESILKLCSIRASSRP"
     gene            complement(44270..45043)
                     /locus_tag="TCCBUS3UF1_RS00245"
                     /old_locus_tag="TCCBUS3UF1_490"
     CDS             complement(44270..45043)
                     /locus_tag="TCCBUS3UF1_RS00245"
                     /old_locus_tag="TCCBUS3UF1_490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_014514470.1"
                     /db_xref="GI:504327368"
                     /translation="MRIQSPANPKVKALAALKERRERERAGLFLVEGRREVARALGAG
                     LELYTLLLGPKALPEDRLLAGPAPVLELSQEAMERVSLRENPPPLIGVFRLPQGRPLP
                     PLPEAPLVLVLLGVEKPGNLGAILRSAEAAGADLVLVAEGVDLYSPQVIRNSTGAVFS
                     LPVLPLSEGEADRFLEERGLFRVAATPRGEKTLWEEDYRQGVAFLLGAEDQGLPPAWL
                     ERAQARVRIPMRGRADSLNVSVSAALLLYEALRQRLGVG"
     gene            complement(45021..47270)
                     /locus_tag="TCCBUS3UF1_RS00250"
                     /old_locus_tag="TCCBUS3UF1_500"
     CDS             complement(45021..47270)
                     /locus_tag="TCCBUS3UF1_RS00250"
                     /old_locus_tag="TCCBUS3UF1_500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxyhexanoate--CoA ligase"
                     /protein_id="WP_014514471.1"
                     /db_xref="GI:504327369"
                     /translation="MGYVPAPTPQYGLEEGPVLLKDGRTALLRRAGPKDLALFVAFLK
                     RLSPESLRMRFFSPISPEKAAELLLSAKPEEEKVTLIVLAGDPPRIVATGEYVRVKGE
                     DTAEVAFLVDDAYQGKGLGTLLLERLALIAAKRGVRRFQAFTLAENRQMLGVFMESGF
                     EVRAHREGGEVEVEFEILLEEKAAERFEWREKVSTIASLHPFFFPRGVAVVGASRDPE
                     SIGYRVLENLIFGRFQGPVYPVNEAIGQEGGTVGPLLAYPSVESIPGPVDLAVIAVPK
                     ERVLGALEACGRRGVRGAIVLTTGFSPQEAKALADRARRFGMRLLGPGSLGLVHTHPE
                     ARLAAGLAPLPKPGPLAISSQSGTLGRAVMAYAEGMGLGIASFVSLGAKADLSSNDLL
                     QFWEEDERTGVILLYLEGFGNPRRFSRLARRIGKRKPILAVHPSRDPLVRALFAQAGV
                     IRANDLEEAFDVAALLSLGRLPENPRVRLISNASGPSNLALEALQEGGLAVEHVDLGS
                     TARAEDFAHALKEAMASEAGSVFLLFVPMGFASEEEFLGLVERAEGEKLLLACAMGSP
                     GVRARVLGKAALYRFPESAAIALARAWAYRVWREEPLRFPDFPDLRLEEARKLLEGKK
                     HLGLEEAKALLQAFGLPLDGEEGGLTLRLKAEPHPLFGPVLTLLLPTPLGDQVLGQRL
                     SPLTEGDAKELLAPLAGKVEPGPYQEILLRLSRLLEELPQVEGLALELQGPKVAGLEV
                     RLHADPKPR"
     gene            47308..48576
                     /locus_tag="TCCBUS3UF1_RS00255"
                     /old_locus_tag="TCCBUS3UF1_510"
     CDS             47308..48576
                     /locus_tag="TCCBUS3UF1_RS00255"
                     /old_locus_tag="TCCBUS3UF1_510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_014514472.1"
                     /db_xref="GI:504327370"
                     /translation="MLRLDTRFLPDFPQALKAHEGILLAAREALLSRRKDPGAMLGWL
                     DLPEDTETLRRIRRFREENPWVEDYVLLGIGGSALGPKALEAAFNGGRVRFHYVDHVE
                     PEPVLRLLRTLDPRKTLVNAISKSGATAETLAALLVFLNWLKGHLGEGWRRHLVLTTD
                     PKRGALRALAEREGLAAFPIPEGVGGRFSVLSPVGLLPLAFADADLDALLMGARQANA
                     NALAPLGESLPLQTALLHHLHRHLPIAVFMVYSERLKHLPAWFVQLHDESLGKRDREG
                     RPVGTTAVPALGPQDQHAQVQLFREGPLDKLLTLVVPERPTEDLPLPPAEGLEGEAGY
                     LFGKGLFTLLSAEAEATYRALAEAGQKVYTLYLPEVSPYAVGWLLQHLMWQTALLGEL
                     WGVNAFDQPGVELGKRLTFALLGRPGYGEG"
     gene            48630..50219
                     /locus_tag="TCCBUS3UF1_RS00260"
                     /old_locus_tag="TCCBUS3UF1_520"
     CDS             48630..50219
                     /locus_tag="TCCBUS3UF1_RS00260"
                     /old_locus_tag="TCCBUS3UF1_520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_014514473.1"
                     /db_xref="GI:504327371"
                     /translation="MDRLSYLGLHPQKQVFWNTVSPVLVEHTLARGEGFLAHKGPLVV
                     DTTPYTGRSPKDKFVVREPEVEGEIWWGEVNQPFAPEAFQALYGRVVAYLAERDLYVQ
                     DLYAGADKRYRLGVRVVTESPWHALFARNMFILPRRFPEDDEAERFTPGFTVVHAPYF
                     LADPERDGTRSEAFVGISFARRLVLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHAS
                     ANVGQDGDVALFFGLSGTGKTTLSTDPLRPLIGDDEHGWSEEGVFNFEGGCYAKVIRL
                     SEEHEPLIYRASNQFEAILENVVVNPESRRVEWDDDSKTENTRASYPIAHLDNVVESG
                     MAGHPRAIFFLSADAYGVLPPIARLSPEQAMYYFLSGYTARVAGTERGVTEPKATFSA
                     CFGAPFLPMHPGVYARMLGEKIARHAPRVYLVNTGWTGGPYGVGRRFPLPLTRTLLQA
                     ALSGALEGVPYRQDPVFGFEVPLEVPGVPKELLDPRGTWADPEAYDRQARKLAHLFQE
                     NFQKYADGVGEAVRLAGPRAD"
     gene            50381..52207
                     /locus_tag="TCCBUS3UF1_RS00265"
                     /old_locus_tag="TCCBUS3UF1_530"
     CDS             50381..52207
                     /locus_tag="TCCBUS3UF1_RS00265"
                     /old_locus_tag="TCCBUS3UF1_530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_014514474.1"
                     /db_xref="GI:504327372"
                     /translation="MSQAWFSRYAWGVLGWNVLVALWGAYVRATGSGAGCGSHWPTCN
                     GEIIPRSPQVETLIEFTHRATSGLAFLSVLGLFLLALRLYPKGHPVRLGAGLAFLFMV
                     TESLVGASLVLFGWVADNVTPERAVVQMVHLANTYFLLAALALAAWWASGGAPLRLRG
                     QGAVAWALLLGFLALLFLGMSGAVTALGDLLFPVRNTLEALERSLTPGEHFLVRLRVL
                     HPLIAVSVGLYVVFAGFLVAHLRPSPHTRSLAQGLAYLYGIQLLAGLVNVWLKAPVWM
                     QLLHLLLAYAVWLLFLLLAAAALARGARRVELGEGSAEAGRLHQGTGGATWKDYLALT
                     KPRVISLLLLTTLLAMFIAAQGWPGTGLFLAVALGGYMMAGAANAINMVVDRDIDARM
                     RRTAQRPTVTQRISSRDALRFAFALAFGAFLLLWWGANLLAATLALMGLIWYVLVYTL
                     YLKRRTWQNIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALALMI
                     QDDYKAVGVPMLPVVLGERVTVVQIALYAVLTAMISLMPLLLGELGLLYLFFSLALNA
                     LLLVKSLALYRQPERRTAVSLYKYSMLYLALLFVAMAVDRVL"
     gene            52219..53232
                     /locus_tag="TCCBUS3UF1_RS00270"
                     /old_locus_tag="TCCBUS3UF1_540"
     CDS             52219..53232
                     /locus_tag="TCCBUS3UF1_RS00270"
                     /old_locus_tag="TCCBUS3UF1_540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_014514475.1"
                     /db_xref="GI:504327373"
                     /translation="MKRGVAALSLIGLALAQEAHRVAITHPFSPVNRETNFLLVWVLL
                     FSVLIFGVVAGALAYIAWKFRARPGQEGEPPQIHGNDRLEVVWTVIPIVIIFILFGLT
                     ARSLILVNKPTPGAMKVEVTGYQFWWDFHYPEAGFRNSNELILPAGVPVELEVTSKDV
                     IHSFWVPGLVGKQDAIPGQKTRIRFVAEKPGNYYGFCAELCGPSHARMLFRVLVVPQE
                     AFDRFVQAAKAYTPPVADARGQEVFQQNCAACHGVQGKMPPAVIGPELAFTGNRVSLG
                     AGIVDHTPENLKAWIKDPASMKPGVKMPGFPQLSEGDLEALVRYLEGLKVEGVDFKAL
                     PKF"
     gene            53247..55622
                     /locus_tag="TCCBUS3UF1_RS00275"
                     /old_locus_tag="TCCBUS3UF1_550"
     CDS             53247..55622
                     /locus_tag="TCCBUS3UF1_RS00275"
                     /old_locus_tag="TCCBUS3UF1_550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit III"
                     /protein_id="WP_014514476.1"
                     /db_xref="GI:504327374"
                     /translation="MAIATKPKTNAWAVLWDLLTTVDHKKIGLMYTATAFFAFGLAGV
                     FSLLIRAQLAVPNNQLLTGEQYNQVLTLHGATMLFFFIIQAGLTGFGNFVVPLMLGAR
                     DVALPRINAFSYWAFLGAILLALMSFFFPGGAPSVGWTFYYPFSVQSGSGVNFYMAAI
                     LLLGFSSLLGNANFIATIYNLRAQGMSLWKMPMYVWSVFAASVLNLFSLAGLTAATLL
                     VLLDRKIGLTWFNPDIGGDPVLFQQFFWFYSHPTVYVMLLPYLGILAEVASTFARKPL
                     FGYKQMVWAQMGIVVLGTMVWAHHMFTVGESTVFQIAFAFFTALIAVPTGVKLFNLLG
                     TLWGGHLQMKTPLYWVLGFIFNFLLGGITGVMLSMTPLDYQFHDSYFVVAHFHNVLMA
                     GSAFGAFAGLYYWWPKMTGRMYDERLGKLHFWLFLVGYLVTFLPQYALGFLGMPRRYY
                     TYNADLAGWPELNLISTIGAFILGLGGLVWLYAMWKSLRSGEKAPENPWGGYTLEWLT
                     ASPPKAHNFDVALPKDFPSERPLYDWAKKGVELKPEDPSHIHLPNSSFWPFYAAATLF
                     AFFVAVAALPVPNVWMWLFLALFAYGLVRWALEDEYSHPVEHHTLTGKSNAWMGMAWF
                     IVSEVGLFAILIAGYLYLRLTGAATPPEERPALWLALLNTFFLVSSSFTVHFAHHDLR
                     RGRFNPFRFGLLITIILGVLFFLFQAYEFWAFYGHSSWQENLWTAAFFTIVGLHGLHV
                     VIGGFGLILAYLQALRGKITLHQHGTLEAASMYWHLVDAVWLFIVVLFYIW"
     gene            55677..56378
                     /locus_tag="TCCBUS3UF1_RS00280"
                     /old_locus_tag="TCCBUS3UF1_560"
     CDS             55677..56378
                     /locus_tag="TCCBUS3UF1_RS00280"
                     /old_locus_tag="TCCBUS3UF1_560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514477.1"
                     /db_xref="GI:504327375"
                     /translation="MRLLAVDFDYFFPLPQDPGHPEAFLYAWAHFETPYYREAAWEER
                     ALAFLLRGLPLPQAQGWEGFWERFTFAPGARLYYADSNALAFHPQVREGVEEVVLYDA
                     HHDAGYRPLGEEPACDDWMVHYARQGARLRVFYPPWRDPALEPEPQVPLAREVDPGGR
                     VEGPFHRVFLCRSGAWVPPWADAAFFAFLAAASLPKVPLEPVAPRAWDLEGLRRRVAE
                     EALGLWIMDALRRSP"
     gene            56403..56478
                     /locus_tag="TCCBUS3UF1_RS00285"
                     /old_locus_tag="TCCBUS3UF1_t10"
     tRNA            56403..56478
                     /locus_tag="TCCBUS3UF1_RS00285"
                     /old_locus_tag="TCCBUS3UF1_t10"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:56436..56438,aa:Lys,seq:ttt)
     gene            56485..56559
                     /locus_tag="TCCBUS3UF1_RS00290"
                     /old_locus_tag="TCCBUS3UF1_t20"
     tRNA            56485..56559
                     /locus_tag="TCCBUS3UF1_RS00290"
                     /old_locus_tag="TCCBUS3UF1_t20"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:56518..56520,aa:Glu,seq:ctc)
     gene            56561..56637
                     /locus_tag="TCCBUS3UF1_RS00295"
                     /old_locus_tag="TCCBUS3UF1_t30"
     tRNA            56561..56637
                     /locus_tag="TCCBUS3UF1_RS00295"
                     /old_locus_tag="TCCBUS3UF1_t30"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:56595..56597,aa:Val,seq:tac)
     gene            complement(57411..58091)
                     /locus_tag="TCCBUS3UF1_RS00300"
     CDS             complement(57411..58091)
                     /locus_tag="TCCBUS3UF1_RS00300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006454511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433911.1"
                     /db_xref="GI:752794480"
                     /translation="MAPDPRDRPLYSLREAARYLGLSESTLRSWIMGRTYPKAGGQER
                     SLPLIETPGNGSQLSFFNLVEANVLAALRQIHRIPMQRIRRMIDYAKEALGKPRPLLL
                     DLEAGLGDVFLRQGKELLALTRAGQLALQEVLESYLSRVDRDEQGIPLRFHPAVGTQL
                     RSERVVLDPRVAFGAPTVRGVKTSVIALRFNTGEGLEEIAKDYGLTEEEVTEALVFEG
                     MGVDAWAA"
     gene            59998..61494
                     /locus_tag="TCCBUS3UF1_RS00305"
                     /old_locus_tag="TCCBUS3UF1_590"
     CDS             59998..61494
                     /locus_tag="TCCBUS3UF1_RS00305"
                     /old_locus_tag="TCCBUS3UF1_590"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514480.1"
                     /db_xref="GI:504327378"
                     /translation="MTPLAQYAVTLYASSLFAQKDDFKRLVEEIFTTNYKNPDEAFEH
                     LKDFWFGNKSLVNLFTLFVSRSDYNRIEYEGAPGTEDPEEKAFLDEEDKCKYELVYPY
                     FGDLQKTLDQFSMARPSIVRQVAQKVRTSLNQQRGGASFYISLMQESFDLLLPAAVRR
                     KYLARLRPVLNVLSSNPRRITAIPAGLLSATQEIDELSRELSQELGLKESYEDEHAEG
                     SAPLLPLYEGKDDTGLFSELATALRRQNLTILSTTAKMISSQVISLARQALDFMASSY
                     KGDPEAFTRAVHNVVDHAFYSALGLNGLFPVYVYDYRVTAIDEHERVVPIFFGFLERE
                     LLVGESTLAGAYLALVHSGIARAKDGKSLPLPQMIQGLAKQFAKSFTAKRVAEKVFKE
                     SGMGDSTRDLFEVDEPEAVPVNLTPRQVFAQGLANMLSEKLAPPEVQRSGYRTFYSIQ
                     NFILFRPKFANAVVKVASENPGFMLDQATQDVQRGFRTGFNTYRGRSV"
     gene            complement(62020..63192)
                     /locus_tag="TCCBUS3UF1_RS00310"
                     /old_locus_tag="TCCBUS3UF1_600"
     CDS             complement(62020..63192)
                     /locus_tag="TCCBUS3UF1_RS00310"
                     /old_locus_tag="TCCBUS3UF1_600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_014514481.1"
                     /db_xref="GI:504327379"
                     /translation="MARGKGGGTTYYHKAAQKWVAELRWVDEATGKLKKLCRYARTRR
                     EAEELLAKMVAERAQGLLPEPSQVTVVQFAQRYLQGLEGEGLRPNSLRLARQELVYAL
                     PSLKDPSAHDPLGRMRLQEVRPLHVQRVVDQLRQGYAPRTVRKVLNRLRALFQRACEL
                     ELLPRNPAGAIRLRLPQGERAARALEPQEVLRLLEVADGARSREMALLLRLLLETGLR
                     RGEALALQWRDVDLERGELRVWRSWTKVNGKGDFTQPKTRTARRVVPLPQSLLLRLRA
                     WKEELAQRLPQEVLEEAFLFGGNKPFDPDAFNHYLRRLAQRAGLGKVRVHDLRHTWAS
                     LALSRGIPLEVVSERLGHASPHVTLGIYRHLLEEERRGYVVDLETLLGLPAVRPQA"
     gene            complement(63222..63863)
                     /locus_tag="TCCBUS3UF1_RS00315"
     CDS             complement(63222..63863)
                     /locus_tag="TCCBUS3UF1_RS00315"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433599.1"
                     /db_xref="GI:752794167"
                     /translation="MFIQEVQHLLQGDEEKSKRLYGIRRTYQRARTRREVCWHDFLEG
                     VLGGGLLQEVQSFLETNPDRLGAWARDLGLSSSTVRLALLISAEVLEKASLFGVARIG
                     YNATAKRYRVSKRTVSEALGLLKRAGVIQRVEVGFFHPDASGNKVSKGSAYLPLPELL
                     QVRKEQGLLEAVLGALSKAVVARERLAGGNRLRPLALSVNGPGLESDRGVPKL"
     gene            65547..66785
                     /locus_tag="TCCBUS3UF1_RS00320"
                     /old_locus_tag="TCCBUS3UF1_620"
     CDS             65547..66785
                     /locus_tag="TCCBUS3UF1_RS00320"
                     /old_locus_tag="TCCBUS3UF1_620"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514483.1"
                     /db_xref="GI:504327381"
                     /translation="MIPLVHSELKIALTVLPVPVLQDVVWAERPEDIPPWDWTRGYSP
                     VQPLSRFGEDYDLDTPEEEVDRDHPLPSWLKLTKFYPRLVRKWASSDIWEPSPESNLP
                     PKASVSPLEAFQRVYRALQQDQDPLQPDSLTRKTIGEMARKAGILSSFEPDWRLSGEG
                     VWGRFSGANSLLRDDSLWAWVEAAYFFQTVRLALKLREESNLPPKPILQRVIQELGFP
                     LEVLEENGQAGVELRVRPAGDPLEGAKRRGLDIALEYLGRGRSLRVSGLENVLREEAT
                     RHVVLEPVSKFETHTPIRAPRIPLALLKKRSEQVRKQSQLDESWKEWAQELREIWEEW
                     VQSEQEGQNRRAQSAAHYFGFMSLIDLGLLQLLRRDYVACEWCGKVFSPRRRDTRYCS
                     DVCRMKAWRNQRASSKHKVE"
     gene            67602..68693
                     /locus_tag="TCCBUS3UF1_RS00325"
                     /old_locus_tag="TCCBUS3UF1_640"
     CDS             67602..68693
                     /locus_tag="TCCBUS3UF1_RS00325"
                     /old_locus_tag="TCCBUS3UF1_640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514485.1"
                     /db_xref="GI:504327383"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     gene            complement(68710..74256)
                     /locus_tag="TCCBUS3UF1_RS00330"
                     /old_locus_tag="TCCBUS3UF1_650"
     CDS             complement(68710..74256)
                     /locus_tag="TCCBUS3UF1_RS00330"
                     /old_locus_tag="TCCBUS3UF1_650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514486.1"
                     /db_xref="GI:504327384"
                     /translation="MGLALRPEDLRPERWFSQVLPRVVQGESLDWSAVPDAHPQDLEG
                     LLQPLFHLNLSPEELSRRLGLASMAEALRSWVASRMGLPLVRLAERGSVRDPFRQLEA
                     IQNSFRGYAESFVNPRNPAIADLLRQGIEEEDLLWREPFVAQKRRYRLGKSLEALIQE
                     GLLPPSIRPLLRKNPEDLQDPTPFHPYLHQEEALRAALAGESFVVATGTGSGKSLAFG
                     MPIFAYALTAKRPGIKAVIVYPMNALANSQYRDFALRLHGSGLRIALYNGETPYTKQD
                     GQALRERLLQERFVSDAEVLSREEIRQDPPDILMTNYVQLELLLTRGEDRTLFPPEHR
                     GVLRYLVLDEVHTYAGLRGADVAFLIRRLKQHTGTTETLQVIGTSATVDRGVEAIRRF
                     AENLFGTSVARVIGEHLEEPPPLDLSHLPEELREALSARPDGETRVRRALVFLEKALE
                     EPHTLSELAKKLSHEEGISQDQARAEVALALRVGAATGYLVPRIHAFYAQAPDLTATL
                     DLEGLSLKGEKHLHGKPAYPVVFCRNCGQEYLIAREEKGQFLPGPSFLELFRGEIRYL
                     RPGAWVPDREPLPESWLDESGEVKRDRRRLLPQNRVLDPYTGTPAEEGVPVAILPFPF
                     QFCPTCQVSYTRQGNEIRKLAAFGLVGRSTATDLLLLSTLGTFPREEQKIIVFTDNRQ
                     DAEFQAGHFQDLFRKVLFRQTVMEILAQGPAYLSELGGQVYQAWARSDPRAEMRPLYE
                     EHAPEGVAFRDLLSLVAVLEAGRNTQPNLKNLEAAGLIRYRYRHLEELLQDRGIWEGL
                     SVPEEVLRDYLTGLLDLMRRRGAIFHELLNPISFRFRVEEKLFAFVHEVFAEPMGGSI
                     LLEVRASQAPRFGQTLRLYGDRRRPSLFEQWTMGALNLPWEEAAARLRRVVRALKDRR
                     VLVAWELPSWGRNKVSGLALNPSAILLEKTGGDYLLCPRSGYTGPLYALRISPEYPSQ
                     ALEERRVHPFYETLYEKRRFPLPLEARAHSAQVSGEERRRLEERFRNPEDPLSVLVAT
                     PTLEMGIDIGALSSVFLRNIPPSPANYAQRSGRAGRKGQPALIQAFAGAMGHDQYFYR
                     FPERMVRGSVQAPRFLLDNPRLVKAHLRALVLEILAQWGFSLPGKVGEAVDYEDHTHL
                     YPLRAGFRAALEQGISTHQGAILQAVGEAFRREMASFPWFTQEVVRSTVEGFVAELDA
                     ELNSWREEYHDAQARYTEFMTRLQHMGPRHPNREEIQAEATRADKQRRYLVDLDLRGY
                     LAARGFLPNYAFGRVTTWAELITPGGEVERLERPSFIALTEFAPGNSVYFGARRYRLD
                     RLAVLPKEEAFRTAKRCTCGHVEAQGDRCRACGKDLSATLPNVRLLAPPILTGLPRRR
                     ITSEEEDRVRMGYEVEWDWRPKAPRALQGGSFRLLYEHNAEVVAMNKGLRAWLLDEEE
                     ENPLQEGFVYCQRCRRFLLTGKELEEHPWREDREGRCPVGGKPEDLKRGIVLEARAES
                     DVLALEVPAPLGIGDGERLSFYKSLLAAFRKAALVVLELAEDELFGFLQPISNPQVPY
                     RVVLVEGQEGGLGALAALAEWPSREESHPLQELARTALRLMHHGEEKACERACYDCLM
                     DYSNQVDHALLDRRLVQDFFTELQSTVFEDLPAPSRLQELQARCQSELERRWLQACHE
                     RGLPLPDEVQYTYALGDTYTRFDFFYARGLGIYVDGPPHLDPRRQEQDREIRRRLTLL
                     GVPFLVFREGEDWEKGFEELGLHLGRRGGGLSWEEALALVLPGYRPLLEALRKAGFPP
                     PDEVGEDLVVEGRVVGQSVARWGEKHLVPEGLEGLGLVVRPYTTPDEVLGYLRGEGLA
                     SSKEHP"
     gene            complement(74309..76306)
                     /locus_tag="TCCBUS3UF1_RS00335"
                     /old_locus_tag="TCCBUS3UF1_660"
     CDS             complement(74309..76306)
                     /locus_tag="TCCBUS3UF1_RS00335"
                     /old_locus_tag="TCCBUS3UF1_660"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514487.1"
                     /db_xref="GI:504327385"
                     /translation="MNPSTKSTLYVNLFPLKRSPQEGRIFRFAHRDPQSFLKYLQAIG
                     WIAQKRGDEVWIFALERPEVRAPFVGEAEPTSLQERAMAFNSHLNRLLSQKGFYRTGS
                     RWIDPEEWTRIEGVFLSGPFQGKAFPVRQHQAYKVEVVNLLGTFYALVDLSKQLLSDA
                     PLEALSVELVTYLEAQAPKHPLHALDLHTGKRTFWETADPRGHLLLHPVHLEELGVVG
                     EQGQMRRTSQEAFERSQFNFAHLLEKITLFSEVLVPEPLALSEEVLGRIEGLGLRMAK
                     GLAAEPKEVRFKGFLYAPSKISLRPILPDTPEVAFTQKVTKKPSFHVETKRRGKPPQR
                     SGHLEHKVTVGISPRHLLLYHLVEPHRLKNSREGLEILQRFGHAKGHAKDGYSLVQAL
                     KQFGTSIQVAQPSLRYDPTTGEIQGSPNPGSSGENEVNFILAPPEVGRYALGRLLKQL
                     KKYFPKAANQVVNPDTLGSPTKVLSLAYDLLVGKFRTTVPYALKDLGQHVLGLRATQE
                     DGFLWRLIGPEGFVLGKGKGFPPEEILPRAFVVHFMGNDRQLEEVMDWTHEPVVRLEL
                     SDLRFSQKNLPLGTFFRATPEVAYLLAHPGYPGWPTALRVEVIQGNLTLEEALKQVYW
                     LTKPTGGLYHPGKLPLSVEEKVPWDRLQPPREMGQTYSLER"
     gene            complement(76311..80309)
                     /locus_tag="TCCBUS3UF1_RS00340"
                     /old_locus_tag="TCCBUS3UF1_670"
     CDS             complement(76311..80309)
                     /locus_tag="TCCBUS3UF1_RS00340"
                     /old_locus_tag="TCCBUS3UF1_670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514488.1"
                     /db_xref="GI:504327386"
                     /translation="MFHAIRLSGGIFTEEFLQTLGHPEALKELSLTPEELRNRFYLLL
                     NLYERHKPLYELRDTSRARESWLLPLFRALGFQPVYNRSHLVVGEQAFPISHRGWDGE
                     EAPPLHLVAGELDLRPNRREKSPQGLVQGYLNAHPHQDWGVVAAPWEVRLLRKYYHVS
                     LPGYVAFNLVELFEAPREQALREFQILLLLLSPSRFQKGKDGKTPLERYYETARQTGI
                     RARDALRKGVVEALEILGNAFLNESLRQELNDPERLAAYHAELLRLVYRILFLLYAES
                     RGLIPTGGELSWVYEREYSISALRERAARDNPYGEDRNTDLWEKLLLTFHLVYRGDAR
                     LGVPALNGELFAPENLRILTGGVSNPGERARFPELPRPTNSQLLRAIRHLTHLEREGA
                     LERINYRDLEVEEIGHVYEGILALTPRLVEGRYSLESHLLDKKLSGSYYTPRELVQLV
                     VQEALAPVVEERLKAAGDDPERQEEAILSIKVVDPAMGSGAFLISALEYLAEKLLEVR
                     GQSKGDPEALYAARHLVATRCLYGVDLNPMAVELAKLSLWVASADRSKPLSFLDHHLK
                     VGNSLVGAPQDFLEKGIPKEAYDREDIPKEVRKSLRFGPGGGTLLFAPPSPPFLDFEE
                     ESAEQVEEKRRRYQAWRESEEVRKMELFADYWTAAFFLRPAPGVRLPDAEGLNWLAQQ
                     SRASLEQLGQSSYLNPPTLAAIQVAKRRHRFFHWWLEFPEVFRAGGFDVVLGNPPWEV
                     MEPKEEEFFAERAPHIAALPGKKRKETIEKLSQTDPDLFEKWKEHIRSISTTVQFARN
                     SNRFPLTSKGDANTYRYFAELAYRLRSPRGRVGLIVPTGIATDDSNKEFFAHLVEKGE
                     VSTLLDFENRERLFPGIDSRIKFAVLALRPPSPEPARLAFFLTQPDQAQDPVRQFRLA
                     PRDFALLNPNTRTCPVFRTRQDAELTRAIYEKVPVLWREEPEENPWNVRFRQGLFNMT
                     SDSHLFHTRADLEAQGFHLEGNRFLRGKEIYLPLYEAKLIWHYDHRFATYDGEDTRET
                     TLGEHQDPAYLPLPRYWVRAEEVEGRLEGRGQRGKEAWRWGRGWLLGFRDVTNATNER
                     TVIFSFIPRIAVGHTVPLIQSTYSAVLQLALLSSFNNLVLDFLARQKVGGTHLTFHLL
                     KQFPVLPPSTYGPQDLLFIVPRVLELTYTAWDLAPLAQEVWQEASPELRQALLAQHQA
                     NGGHPDAPPPWVQGPYPFPPFRFDEGRRALLRAELDAYYARLYGLNRKQLRYILDPQD
                     LTPKELADILSDIEEVADPLDEREYRKRRERSSFPGETFRVLRDKEEKRYGEYRTRRL
                     VLEAWTKLHTKG"
     gene            complement(80321..83077)
                     /locus_tag="TCCBUS3UF1_RS00345"
                     /old_locus_tag="TCCBUS3UF1_680"
     CDS             complement(80321..83077)
                     /locus_tag="TCCBUS3UF1_RS00345"
                     /old_locus_tag="TCCBUS3UF1_680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514489.1"
                     /db_xref="GI:504327387"
                     /translation="MNVDMLQPGALFRARGRDFRLERRQGDVLVARTVDSEEETLFYL
                     PLEGEALELTTLGLPPERPGDPALHDLLLQALDLATLHADAPFLALQRSRVVPANYQL
                     VPLLMALRQPKVRLLIADDVGLGKTVEAGLIIKELLLRNKARRVLILAPAHLLGQWQE
                     ALRRFFHLDFAVLSGPNLKRLARTLPPGANPWAHFDRIIASVDYAKQGDVRQLVLLQD
                     FDLLLVDEAHMAARPPTEKGKQMERYRLVRELARRVPHLLLLTATPHNGYTESFYSLL
                     EHLDALGLGLFKNGTLDREVAKKHVVQRRRKDVEEWFRKEGKKSPFPERETKEEAVNP
                     NRAELELFEAVRRYQAEVYDPDPAKVPVLGRWLAMHLMRRATSSPRALERSLERRKGL
                     LENLLTEGQGITGEEEAALFDTTPDRLLPEEAEVGLELSLADRARAQAEKGYLETLLR
                     YLKGWRKDSKLERLRDLLTQPFLFGKGRTLLFTRYRDTLEYLVEKLGPNLPYPVFAVH
                     GEMSEEDRDEVLKAFAQESPALLIATDVFSEGLNLQHYAAQLIHYDLPWNPNRLEQRN
                     GRIDRFGQPEPRVRIRTFYYEQSFDVAVFHLLLEKAERIRRELGVVPAFFGEEAYLRE
                     RLEALWKQDWRQERRLQASLFAEVEDRELEGARRAVQEGFYGHSEFSLPDVEKRLQQA
                     LERAGNPKALEGFVLDGLRYLGWRVWGEDPYTAERDAGEAVPGLPARFGPFSFDPEAP
                     LGVEVLDLSHPLVEHLVSYLRYRAYRDLDGARTALLALRAPLGTPPVAFYHFRARFLG
                     PGGEVLETLYRRALRLLDGAEVPPKEAEALWRARLKAAPALSREQAQLLAADALRTPL
                     EALGRRGAEEALARLKAEREALKRDLERAYGTLPEAFRELDRLELLGHELLAITLLAP
                     AALR"
     STS             82120..82525
                     /standard_name="GDB:371657"
                     /db_xref="UniSTS:156878"
     gene            complement(83122..83358)
                     /locus_tag="TCCBUS3UF1_RS00350"
     CDS             complement(83122..83358)
                     /locus_tag="TCCBUS3UF1_RS00350"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433601.1"
                     /db_xref="GI:752794169"
                     /translation="MVKLVQRFLKESEDQLEPGNRYKIITYTPARALEMHLIRPLLTP
                     SELARAEHGFFFEATWGNPTPKAEADLFPLKKRD"
     gene            complement(83942..84211)
                     /locus_tag="TCCBUS3UF1_RS00355"
                     /old_locus_tag="TCCBUS3UF1_700"
     CDS             complement(83942..84211)
                     /locus_tag="TCCBUS3UF1_RS00355"
                     /old_locus_tag="TCCBUS3UF1_700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514491.1"
                     /db_xref="GI:504327389"
                     /translation="MPIRYNPYTGRYEYAEKDQEPVQNEYEGGYEFGRQRETDYTPFT
                     RRYRKRGEGLVDRWNPYTGRYEAVPEGWEPRQNPYTGEYELGPEE"
     gene            complement(84228..84686)
                     /locus_tag="TCCBUS3UF1_RS00360"
                     /old_locus_tag="TCCBUS3UF1_710"
     CDS             complement(84228..84686)
                     /locus_tag="TCCBUS3UF1_RS00360"
                     /old_locus_tag="TCCBUS3UF1_710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013013511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514492.1"
                     /db_xref="GI:504327390"
                     /translation="MVQPVEPLTAERIGRALKAMGLKVLVNEDGEFLVLFKKDPSANP
                     MALVNVAPQGSANQVLAVIALVKGHPPMEPEELLAKANEWNGTRRWPRALVRGGELLL
                     DYHVDLEEGVTEAQLRNFLATAFSGIGQFLLWIEGGDDLEDLFRTLGLLG"
     gene            complement(84690..86180)
                     /locus_tag="TCCBUS3UF1_RS00365"
                     /old_locus_tag="TCCBUS3UF1_720"
     CDS             complement(84690..86180)
                     /locus_tag="TCCBUS3UF1_RS00365"
                     /old_locus_tag="TCCBUS3UF1_720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514493.1"
                     /db_xref="GI:504327391"
                     /translation="MPLNPGPRVHPTHQGGRGFPASPQGELLLLVAGSLFSGDLFYEG
                     AEEREARFTALAAEVTQQDPEFVALLATYARQVLGLRSGPSALVAHLFWWGPVEVAEG
                     AAQRVWLRGDEHLETLAYTRAQGWRIRKALKRAVAQRLNAMSPQALLKYRWEGRGFRQ
                     RDALILCHPKAPDREHALVYEWLVRGREAQPEARALVETLLAERPTWERILSRKGSTP
                     EAWREALPHLSGLALVRNLNNLHRHGLLEDPGVQAWLAQRLGDPRVARWGLFPYQWLQ
                     ALLQGEELGYPQAVLSALEGALEASLPSLPFQGESLVLVDVSGSMYQPLSARSQATYA
                     LAAASLGALLYRATGGQLYGFDRHTIPLPYGPDAPLGQMVRHLLEAGGGGTYLGEALR
                     RTLPAFPGPRVVILTDEQVADDAYTPLRRWLGEDPSRVAHVVNVAGYGPLAFPEGGVS
                     RVAGFSGRLLELLAVLEAQDPKAHLRARVSEASLAEEEEEGEGQGR"
     gene            86610..87830
                     /locus_tag="TCCBUS3UF1_RS00370"
                     /old_locus_tag="TCCBUS3UF1_730"
     CDS             86610..87830
                     /locus_tag="TCCBUS3UF1_RS00370"
                     /old_locus_tag="TCCBUS3UF1_730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514494.1"
                     /db_xref="GI:504327392"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     repeat_region   87978..88188
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=87978..88006
                     /rpt_unit_seq="gtagtccccacgcacgtggggatggaccg"
     gene            complement(88550..90403)
                     /locus_tag="TCCBUS3UF1_RS00375"
                     /old_locus_tag="TCCBUS3UF1_750"
     CDS             complement(88550..90403)
                     /locus_tag="TCCBUS3UF1_RS00375"
                     /old_locus_tag="TCCBUS3UF1_750"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O66417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433603.1"
                     /db_xref="GI:752794171"
                     /translation="MPSTPLFSEPLRERLGIVFSLDEGRALECSPMELLLGYTKLRAI
                     SFSASLKGLAELLAPLEEVELLLGLEEGHAAASALAALWEEAQSLLVLMGTKRRLEVR
                     FLPNSHAKLYLLEGPKGVRTILGSLNLSQSAWSGVQGEIAAFSDRLEVYQAFLSWYEG
                     ERERARPLLGERERKRLEGKSLLLMPTALPPEEVRRAVAEAKGIVVVNLLPHKPLVDR
                     TEREKEAELRALKELTWEMRKAEDLVRLRGKETYLQSLVERALREVPVLEYAPDGPRY
                     RGLLAKDLSPDPQGVEATLRALSALLEGARRGSPSLAEAVGEALVYGFASSYLPLLRE
                     EAGRQGRSPTRFPIVALLVGRAGAGKTTILRAIAATWGISFRHYRQVEETGRSKGATV
                     EAHLYLEERAPLPIDEVPPRHLTEENRLAQVVKGVGDDPGVRRALILTSNLEHFRSEE
                     QILRRAWFIPFEHLPQGMGSADLEDHLKAIRPDLFLRFLQEAFPTSDELASLLQGNDP
                     LAPARRFLRGMGLSVPEGPKGDYRAHLLARWRNLYHTQREIFREIQAPDIATGRPIPC
                     FVVDKEKAGFLVPLQAFDNGFSGNGQAFLLKKREFLEAIGEGRPWWRRVWG"
     gene            complement(91295..91981)
                     /locus_tag="TCCBUS3UF1_RS00380"
                     /old_locus_tag="TCCBUS3UF1_770"
     CDS             complement(91295..91981)
                     /locus_tag="TCCBUS3UF1_RS00380"
                     /old_locus_tag="TCCBUS3UF1_770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014514498.1"
                     /db_xref="GI:504327396"
                     /translation="MSLRLEGFRAGYGGIPVLHGLDLEVREGEVVALLGRNGAGKTTT
                     LKGIMGLVRSQGGRVVYRDQDLARMPPFLRAQLGLGYVPDDRRIFPELTVRENLLIAH
                     RPGPWTLDRVYGLLPRLQEIENRRGGLLSGGEQQMLTLARTLMTNPRFLLLDEPTEGL
                     APLIVEEIARLLLELKREGMPILLAEQNLRFTGRVADRAYVLETGEIRLSGPMGELMH
                     REEVAALLSL"
     gene            complement(91978..92724)
                     /locus_tag="TCCBUS3UF1_RS00385"
                     /old_locus_tag="TCCBUS3UF1_780"
     CDS             complement(91978..92724)
                     /locus_tag="TCCBUS3UF1_RS00385"
                     /old_locus_tag="TCCBUS3UF1_780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_041433604.1"
                     /db_xref="GI:752794172"
                     /translation="MGLLEVEGVYKSFGGFLALASVSLSVAEGTFHALVGPNGAGKTT
                     LFNVITGRIRPDAGRVRFRGEEITGWPTSRVARKGIAISFQRAQPFSSFTVLEAVVLA
                     RLGYEGRTFTLQPLKAFPGAWEQAREALVKVGLGGYAHRPVSELPLGDLKRLDVAIAL
                     VARPKLLLLDEPLAGLSRAERKQMVEFIRGLLRQEGITLLFTEHDTEAVLALADRITV
                     LHQGQVLAEGTPEEIQKDQKVRQAFLGGGA"
     gene            complement(92705..93637)
                     /locus_tag="TCCBUS3UF1_RS00390"
                     /old_locus_tag="TCCBUS3UF1_790"
     CDS             complement(92705..93637)
                     /locus_tag="TCCBUS3UF1_RS00390"
                     /old_locus_tag="TCCBUS3UF1_790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Inner-membrane translocator"
                     /protein_id="WP_014514500.1"
                     /db_xref="GI:504327398"
                     /translation="MRLGLLVLCLALLGPFLGEYGLKLLSEALILGLYAMAFNLLFHQ
                     AGLLSFGQAAFFGVGAYAMALLMARSGWSFLATLPLAFLLGGAAAFLVGFLSLRLTRI
                     YFTMLTLAFAQLLYAVAHKWYAFTGGDNGITDLRPAGPWGESLPFYYLTLGLFGLLVG
                     LLASLERSPFGYALRALRDNRARAEAVGLDGFRHLLLAFALAGAISGVAGALQGALQR
                     SVFPDYLFWTRSAEAIISTILGGSGVFLGPAVGAAAFLFLRVLVQAQTEYWPFFLGLL
                     LLLMVLFFPRGLAGVWARLGRGISLGVERGAPRG"
     gene            complement(93634..94515)
                     /locus_tag="TCCBUS3UF1_RS00395"
                     /old_locus_tag="TCCBUS3UF1_800"
     CDS             complement(93634..94515)
                     /locus_tag="TCCBUS3UF1_RS00395"
                     /old_locus_tag="TCCBUS3UF1_800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514501.1"
                     /db_xref="GI:504327399"
                     /translation="MDLSFLLLQLLTGLAYASTLFLLSVGLSLIFGAMGIVNFAHGSF
                     YMLGAYLLFAFTRGQAEGFWAGLFLVLAAGLVVGALVERLLIRPIYPRPEEYQILLTY
                     ALLLILEDLVRLAFGAGYRSFPLPPLFSSPLFLLGAPFPSYYLFLLALAGLSALGLWA
                     FLYRTRLGTWVRAATQDREMLEALGVNVPLLYTAIFALGIALAALGGAALVPLQAATP
                     GMAVDAVINAFIVVVIGGLGSVWGALLGAVLIGLLQAFGILLLPEMAMVFPFALMALV
                     LLLRPWGLLGRPPAVRT"
     gene            complement(94519..95715)
                     /locus_tag="TCCBUS3UF1_RS00400"
                     /old_locus_tag="TCCBUS3UF1_810"
     CDS             complement(94519..95715)
                     /locus_tag="TCCBUS3UF1_RS00400"
                     /old_locus_tag="TCCBUS3UF1_810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular ligand-binding receptor"
                     /protein_id="WP_014514502.1"
                     /db_xref="GI:504327400"
                     /translation="MKAWRWILAFGLLAGLVLAQGQQPIKIGALFILSGNFAGYGKSG
                     SQGAQLAVEEINARGGVLGRPLQLLVVDDQGNPEVGVREARRLVLQEKVDFLFGIDSS
                     SVALAVAPLTDEYKIPLVVTHAATPTLTEQCRPYVFRTSNNARMDAWAAAALAATLPV
                     KRWANIGPDYEFGRVSWQDFIARLRQLRPDVEVVSEQWPRFGSTDYASFITALMRARP
                     EGVFSTLWAGDMVIFARQAKAFGFFNQVRYFVNPVGAALEVLAPLGKETPEGLLVSAR
                     YWFLYPNAERNRAFVEAYRKRFGEYPSYNAQEAYAGMQMLALAIQKARSTQAEAIRKA
                     FEADGGLVYEAPEGRKRMRPEDHQVFESLVWGYTKHSPEYPFAILERMRIVPASDTVY
                     PTQCKR"
     gene            complement(95726..96457)
                     /locus_tag="TCCBUS3UF1_RS00405"
                     /old_locus_tag="TCCBUS3UF1_820"
     CDS             complement(95726..96457)
                     /locus_tag="TCCBUS3UF1_RS00405"
                     /old_locus_tag="TCCBUS3UF1_820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041433606.1"
                     /db_xref="GI:752794174"
                     /translation="MPRLEGRPVLVIGATRGIGLAVAQELARRGARLGLTGRDPERVR
                     AVATELGAWGKAVDVRRREDLVEAVAGFARDVGLYGLVYNAGTSPAFTRAERLSLEVW
                     DEVLAVNLTGAFVAAQAFAQRLVGEGSVVLVGSVLGFRGGGRLAAYTASKAGLWGLTR
                     ALALDWAERGIRVNLVAPGWTETEMTQGLREHPHLGPALLREIPLGRMARPEEVARMV
                     AFLLEPENAYLTGGFYAVDGGVGAR"
     gene            complement(96444..97736)
                     /locus_tag="TCCBUS3UF1_RS00410"
                     /old_locus_tag="TCCBUS3UF1_830"
     CDS             complement(96444..97736)
                     /locus_tag="TCCBUS3UF1_RS00410"
                     /old_locus_tag="TCCBUS3UF1_830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme A ligase"
                     /protein_id="WP_014514504.1"
                     /db_xref="GI:504327402"
                     /translation="MRAFWEPEVETLPRPQLESLQLERLRQQVERLWRTSAFFREKWA
                     GVNLELRHLEDLSRLPLVTKAELRAEQQAHPPLGRYTGVEAQSWREYHPSSGTTGFPV
                     GTVWSEGDVENITQVTARVLYGYGLRPGDILLNGFSYGLWVAGLAVHYAARAMGLFVL
                     PVGAGQTERHLELMERFRPRALTATPSFGLYLGEALRARGLESPLRIGAFGGEAGTEN
                     PSTRRRLEEALSLQAYDFYGLAEMGPTFAGECQAKAGLHFAEDHYLVEVVDPESQEPL
                     PEGEVGVLVLTHLTREATPLVRYYTGDLARLTKEPCPCGRTHLRAVGGILGRVDDLVV
                     YRGAKFYPGQVEEVVRRFPELAGEYRIEVWEAGGLVQGVTVVVEMAHPGVGEGLVEAL
                     RQSLKAALGVTPEVRLEAPGTLERTAFKAKRVVRHAQA"
     gene            97839..>98249
                     /locus_tag="TCCBUS3UF1_RS00415"
     CDS             97839..>98249
                     /locus_tag="TCCBUS3UF1_RS00415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514505.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041433912.1"
                     /db_xref="GI:752794481"
                     /translation="MAQSTIPSLYTLSDLARESGVSRRILQHYAHLGLLEPGALTQGG
                     RKLYTGFALYLIQDIQDLNQLGFTLEEIRKIMALKKVIFHPDGTYREDWRREEIPLTQ
                     EELWAMWAKTGEVLSSMERQERMIRRFHRFLTKHF"
     gene            98269..99429
                     /locus_tag="TCCBUS3UF1_RS00420"
                     /old_locus_tag="TCCBUS3UF1_850"
     CDS             98269..99429
                     /locus_tag="TCCBUS3UF1_RS00420"
                     /old_locus_tag="TCCBUS3UF1_850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_041433607.1"
                     /db_xref="GI:752794175"
                     /translation="MDFGLDRETEALKERVRAFLEEAVIPREGEAARNLDSLEAIAKE
                     LQGEAKRRGLFLPHMPKALGGLGLTWTQLAVVLEEAGRSLLGPKALNASAPDEGNMHL
                     LEKVGSEAQKRRYLHPLLEGEIRSAFAMTEPMGAGADPSLLKATARRKGRGFVLEGRK
                     WFITGAEGAAFFIVLARAEEGPTLFLVDRENPGLKLVRTIPTMDHWSIGGHGELVLEG
                     CEVGEEAVLGEVGQGFAYAELRLDPARLTHCMRWLGVGVRATELAQAYALQRDSFGKK
                     LAEHQGVQFMIADSHMELHAARLMVWHAAWKLDRGERIRHEASMAKVFVAEAVGRAVD
                     RAVQITGGLGISEDIPLSIFYREVRPFRIYDGPSEVHRASIGKRALYKGLRP"
     gene            99426..100406
                     /locus_tag="TCCBUS3UF1_RS00425"
                     /old_locus_tag="TCCBUS3UF1_860"
     CDS             99426..100406
                     /locus_tag="TCCBUS3UF1_RS00425"
                     /old_locus_tag="TCCBUS3UF1_860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase"
                     /protein_id="WP_014514507.1"
                     /db_xref="GI:504327405"
                     /translation="MREALEAAFRELFGPGELVALRRIPGGASKEAWALDYRAGGRVY
                     PLFLRRAGGGVIQRRTLALATEFRLLELAHAHGVKVARPLWYFPDLEGREAFLMERLE
                     GESIGTRVVRRPEYQRARETLPRAMAEELARIHRIPLEELPPLPGPGGKPAHLWILEE
                     LYGDLDALGEAHPALEWGLRWLQNHPPRPLPPVLVHGDFRVGNLMVDGEGLVAVLDWE
                     FAHLGDPREDLAWPLVRAWRFGEDQRRLGGLGEVGPFLERYNALTGGEIAEEELFWWE
                     VLGNVRWGLGALNQARRHLKGEERSVELAVLGRLAAEMEYEVLYLLEKHG"
     gene            100399..100749
                     /locus_tag="TCCBUS3UF1_RS00430"
                     /old_locus_tag="TCCBUS3UF1_870"
     CDS             100399..100749
                     /locus_tag="TCCBUS3UF1_RS00430"
                     /old_locus_tag="TCCBUS3UF1_870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514508.1"
                     /db_xref="GI:504327406"
                     /translation="MDRPNLDELLEAVAEFLKGEVLPTLEDPRLHFQALVALNALGIA
                     RREVALGKALEAEDLGELGRLLGREGDREGLLRELAQRIRQGEAPEGTFSFLKAHVAR
                     KLRIASPKHLERYP"
     gene            100746..101393
                     /locus_tag="TCCBUS3UF1_RS00435"
                     /old_locus_tag="TCCBUS3UF1_880"
     CDS             100746..101393
                     /locus_tag="TCCBUS3UF1_RS00435"
                     /old_locus_tag="TCCBUS3UF1_880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="WP_014514509.1"
                     /db_xref="GI:504327407"
                     /translation="MRRRLLLLRHGEVDYFPGGRPIPPEGAGLTPRGRAQAEAVGQLL
                     REVPLDLAVHTGLPRTEETLRIVLGGREVPVEAWPEFQEIRPGRLRDLPDPERAFREA
                     FHPQDLSERFLGGEGYGEFLDRVLPAYGRLLARPWDTLLLVAHGGVIRALLSYALTGQ
                     RGFLPLEVHPCGLSVLDLGDRPLLRLHNLTPYELLPQTRLSTMEALWRAYLGEGG"
     gene            complement(101390..102373)
                     /locus_tag="TCCBUS3UF1_RS00440"
                     /old_locus_tag="TCCBUS3UF1_890"
     CDS             complement(101390..102373)
                     /locus_tag="TCCBUS3UF1_RS00440"
                     /old_locus_tag="TCCBUS3UF1_890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter"
                     /protein_id="WP_014514510.1"
                     /db_xref="GI:504327408"
                     /translation="MRRTVWLWLFLGLALAQKPQVLIGTGGVGGVYFYYGTAVAELLN
                     KGGAVQAQAMQSGGSMENLMLLRDRTDPARGVYYCGTALPDAALLAYQGEERFQGKPA
                     PVRILFTMYPNYFHVVTTEDSGIRVLQDLKGKRVSTEVAGGIIEYEARILMSAALPGF
                     DPRTHFAKWERTRVAESAQMLAEGTLDAFFWSGGLPTGSILELSGSLARRGKRLFLVP
                     LVPQSTAVQMLQRRFPGVVDTGVVPKGVYNTRYDTPTLTFWNVFVCPASLPEEVAYTM
                     VKTVFENLPTLHAAVAPARDTTLENAVRSRGGRIPYHEGAVRYFRERGVWR"
     gene            102517..103668
                     /locus_tag="TCCBUS3UF1_RS00445"
                     /old_locus_tag="TCCBUS3UF1_900"
     CDS             102517..103668
                     /locus_tag="TCCBUS3UF1_RS00445"
                     /old_locus_tag="TCCBUS3UF1_900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP-type transport system periplasmic
                     component-like protein"
                     /protein_id="WP_014514511.1"
                     /db_xref="GI:504327409"
                     /translation="MVRWGVGFLALLALGAWAQEGFRWPRQILFASTEVGTAGYSLLV
                     AWSAEFTAATGVQLRVSPGATPTLTGWLLDGRVEFASAPLTVLVEALDGEAGYRPGPL
                     RVVYPAILTPWGLMTRGDSPYRRIQDIGPGVRLAWPPFSYFHRILDGLLACRGLTREQ
                     ARLVPVANYSANSRVIAEGGADIAFTSPVSDVNLEVEGNPRGIRWLPVPTAQEDRLCL
                     QRWQRAYPLLALVRPADVGAQSARGVRMFVIPSVYYSRADVSEDLVYHLVKWLDENHT
                     LYRDKHAMARFQTLDSLRFLVESMGVPLHPGTVRYLKEKGLWTAEMERKQGAAVRLVD
                     QYATLYERAASLAKSRRIPTDPANEAWQRFWREFLAQNKVPRFSEAWRP"
     gene            103676..105589
                     /locus_tag="TCCBUS3UF1_RS00450"
                     /old_locus_tag="TCCBUS3UF1_910"
     CDS             103676..105589
                     /locus_tag="TCCBUS3UF1_RS00450"
                     /old_locus_tag="TCCBUS3UF1_910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter permease"
                     /protein_id="WP_014514512.1"
                     /db_xref="GI:504327410"
                     /translation="MEGRWRHLPPWAQAWVALASLLGLGLVLYYLLGSPLTGKALLDF
                     SYYWLLVALFLPLTYLLFPARAGEERPRGYDYALGLGTLGTGLFLAWHGPSMVVRPWT
                     NPEAPWQIALALFLLVAVLEGARRAGGLGFALVALLLAAYPLIAPSLPGLFWGPPLPW
                     TEVLGYAIYSTQGLLGLPMRTVGELLVGFLILAAFLVATGAGEVFLKVASALFGWTRG
                     GAAKVSVVASAFFGSLSGSILSNVAGTGSLTIPAMIRSGFGRTYAAGVEACASTGGVL
                     MPPVMGAVAFVMASLLGIPYGQVVAAAVIPSALYYLSLFAHVDLYAAKHGLKGLHRTE
                     LPPLGPSLREGLPFLLVLALLVFALLYLRLERLAPFYALGVLLLFLLLQGKLTWASLH
                     RGLVAAGALIGQTLALILPVGLILAGLLGTGVAPALTGALVQMGQANLYLVLFLGVAI
                     AFLLGMAGVMVAAYILLAVTLAPALARLGEFVPLAVHLFIAYWSMLSAITPPVAVAAF
                     LAARLAGAPPMAVALEAVKLGLAIYFLPFFFLFEPALILQGEWSSILYHTALAALGLL
                     LLVGGLEGQLWGLGPLPLWARALYVVGGILVAIPETLSSLLAIPVLLGSGLWLWGRGK
                     GKRTPPRGFEERR"
     gene            105594..107158
                     /locus_tag="TCCBUS3UF1_RS00455"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            107217..107798
                     /locus_tag="TCCBUS3UF1_RS00460"
                     /old_locus_tag="TCCBUS3UF1_940"
     CDS             107217..107798
                     /locus_tag="TCCBUS3UF1_RS00460"
                     /old_locus_tag="TCCBUS3UF1_940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_014514515.1"
                     /db_xref="GI:504327413"
                     /translation="MVVPTKDRILEEAAKLFTEKGYEATSVQDIAQAVGLSKAALYHH
                     FAGKEEVLYAISLQALEGLVREGEKALALPDPAQALLRFMEGHARFFEENYPFFVTML
                     QGIKSLSPERRARTVALRDRHEANLRAILRRGVAMGVFRPLDVALTGRAIFSLLNWMI
                     RWFRPGGPLRAEEVARGYFDLILRGIKHGDPGA"
     gene            107779..108915
                     /locus_tag="TCCBUS3UF1_RS00465"
                     /old_locus_tag="TCCBUS3UF1_950"
     CDS             107779..108915
                     /locus_tag="TCCBUS3UF1_RS00465"
                     /old_locus_tag="TCCBUS3UF1_950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008631974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014514516.1"
                     /db_xref="GI:504327414"
                     /translation="MEIPEHKEIRTLARRFLEEAGPELKAYEEKEAFPWPLVERMGAL
                     GFLGVFVPEELGGAGLDFFAYLALLEEMGGYASLRSILSVQQSLVLTPLLAYGTEAQK
                     RRYVPRLARGEVLGAFGLTEPGAGSDAASLSTRAHWDGEAYVLEGQKTFISHGNVAQV
                     FLIFAKTDPEAGAKGITSFLVEREDGVKTAPLKGKLGLRAADTGVVFLDGVRVPKERI
                     LGREGEGFRIALATLDTGRISLAAGAVGLMQRALDLSLAYVRERRQFGKPLAGFQLIQ
                     AHLAEMKLDLEASRLLTYQAAWKKVRGERYTLEASLAKLYASEAANRVAYRAIQVHGG
                     YGFFEEYEVARLYRDARILTLYEGTSEVQKLLIGAHLTGMRAFA"
     gene            108926..110173
                     /locus_tag="TCCBUS3UF1_RS00470"
                     /old_locus_tag="TCCBUS3UF1_960"
     CDS             108926..110173
                     /locus_tag="TCCBUS3UF1_RS00470"
                     /old_locus_tag="TCCBUS3UF1_960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_014514517.1"
                     /db_xref="GI:504327415"
                     /translation="MRWVRFWVLGFLLLGLAWAQVREGVDLGALGAFKARLEAEVAQG
                     RLPGAVFLVARNGQVVFHEAVGYLDPQARTPMPREAIFRIYSMTKPLTSVLALRLVEE
                     GRLFLTDPIALYLPEFREVRVGVERTGPEGRPTLELVAAQRPITVYDLLRHTSGITYG
                     IFFDSLVKQEYRRVGADAVDQTAEEFVRKLAQLPLQFQPGTVWEYSNSTDLLGHLLER
                     LTGRSLAELMEEKLFRPLGMADAGFSVPEAKASRIAEPFLQDPFTRQPTPPALEVRRP
                     PRRFSGGAGAVATALDYYRFLQALLNGGELGGQRILSRKGVELLTQDHLGPLYLPSLG
                     RGAAYLPGPGYGFGLGVAVRLADGGSPLPGSAGDYNWGGLFGTSFFVDPKERLIGIWM
                     MQNPGGRAYYAQLFRHAVYASLR"
     gene            110173..110943
                     /locus_tag="TCCBUS3UF1_RS00475"
                     /old_locus_tag="TCCBUS3UF1_970"
     CDS             110173..110943
                     /locus_tag="TCCBUS3UF1_RS00475"
                     /old_locus_tag="TCCBUS3UF1_970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="WP_014514518.1"
                     /db_xref="GI:504327416"
                     /translation="MGRLEGKVILVTGAAHGIGRAALERFAAEGAHLVAVDREEEALL
                     EAVAALEAEALAVPADLADPQGVEGAFAEALEEFGRLDGVAHFAGVAHAALSWKLSLA
                     DWERVLGVNLTGSFLVARKAGEVMQGGSLVLTGSVAALGALGLAHYAASKAALLGLVR
                     TLALELAPKGIRVNLLVPGLIETRMTAGLPEWSRAQEVEASPLKRPGRPEEVAQAALF
                     LLSEESGFITGQALFVDGGRSVLGPPGLPPGFGPKEVG"
     gene            110943..111386
                     /locus_tag="TCCBUS3UF1_RS00480"
                     /old_locus_tag="TCCBUS3UF1_980"
     CDS             110943..111386
                     /locus_tag="TCCBUS3UF1_RS00480"
                     /old_locus_tag="TCCBUS3UF1_980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_041433609.1"
                     /db_xref="GI:752794177"
                     /translation="MPMYFEDFEVGQRFTTAGRTVTEADVVNFAGVSGDYNPIHTDAE
                     FAKDTPFGQRIAHGLLALAMLTGLRQRTGVTDGTLIAWLEIRNYRFLKPVLIGDTIRG
                     ETEIVEKRETSKPDRGILVQRVRVLNQRGEVVQEGEFVTMVRRRP"
     gene            111383..111736
                     /locus_tag="TCCBUS3UF1_RS00485"
                     /old_locus_tag="TCCBUS3UF1_990"
     CDS             111383..111736
                     /locus_tag="TCCBUS3UF1_RS00485"
                     /old_locus_tag="TCCBUS3UF1_990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018112030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014514520.1"
                     /db_xref="GI:504327418"
                     /translation="MSPFARWFQAEVGRREGGEAELLLAVREEFLQGQGLVHGGILAA
                     LLDSALGQAVESLGVRVVTAELSVNYLRPVREGVLLARGRVLHAGRRLFHAVGEVFSE
                     GERVAFAKGTFYRVG"
     gene            111766..113370
                     /locus_tag="TCCBUS3UF1_RS00490"
                     /old_locus_tag="TCCBUS3UF1_1000"
     CDS             111766..113370
                     /locus_tag="TCCBUS3UF1_RS00490"
                     /old_locus_tag="TCCBUS3UF1_1000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_014514521.1"
                     /db_xref="GI:504327419"
                     /translation="MFPSTMMDEELNLWDFLERAAELFPRKEVVSRLPTGEVHRTDYA
                     GIHRRARRLMGGLKALGVGVGDRVATLAFNGFRHLEAYFAVPGMGAVLHTANPRLAPK
                     EIAYILNHAEDKVLLFDPHLLPLVEALRPELKTVAHFVVLDREAPEGYLAYEALLGEE
                     VDPVRVPERAACGMAYTTGTTGLPKGVVYSHRALVLHSLSASLADGTALSERDVVLPV
                     VPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALAD
                     HLEATGHRLKTLKRLVVGGSAAPKSLIARLERMGIEVRQGYGLTETSPVVVQNFTKSH
                     LEGLSEEEKLSLKAKTGLPIPLVRLRVADEGGKPVPKDGKTLGEVQLRGPWITRGYYG
                     NEAASQQALTPDGWFRTGDVAVWDEEGYLEIKDRLKDLIKSGGEWISSVDLENALMGH
                     PGVKEAAVVAIPHPRWQERPLAVVVPRGERPKEEELREHLLRAGFARWQLPDAFVFVE
                     EIPRTSAGKFLKRALRERYKDLFGGG"
     gene            113370..114131
                     /locus_tag="TCCBUS3UF1_RS00495"
                     /old_locus_tag="TCCBUS3UF1_1010"
     CDS             113370..114131
                     /locus_tag="TCCBUS3UF1_RS00495"
                     /old_locus_tag="TCCBUS3UF1_1010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011229260.1"
                     /note="Involved in the nonphosphorylative, ketogenic
                     oxidation of glucose and oxidizes gluconate to
                     5-ketogluconate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 2-dehydrogenase"
                     /protein_id="WP_014514522.1"
                     /db_xref="GI:504327420"
                     /translation="MFLERFRLDGKAALVTGGSRGLGLEAALALKEAGARVAVMARRA
                     AFFEEARKHLGEEALYLEGDVRDEARLEAIVAEVEARLGPLTVLVNAAGISWGAPSLE
                     MPVEKVREVLEVNLVGAFLASRAAARPMRERGYGKIIHIASVAGLKGEPPEVLDAVGY
                     SASKGGLIALTRDLAVKWGRWGIRVNALAPGFFPTRMTEKVLPKAEAYLRASLPLGRP
                     GQPGELGGAVLFLASPASDYVTGAVLPVDGGATAL"
     gene            complement(114128..114643)
                     /locus_tag="TCCBUS3UF1_RS00500"
                     /old_locus_tag="TCCBUS3UF1_1020"
     CDS             complement(114128..114643)
                     /locus_tag="TCCBUS3UF1_RS00500"
                     /old_locus_tag="TCCBUS3UF1_1020"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="Multi-sensor hybrid histidine kinase"
                     /protein_id="WP_014514523.1"
                     /db_xref="GI:504327421"
                     /translation="MPTRALILAQGNQGIKIYKEADGYPEEVVPLLLAVTDLFREERG
                     FWDPERFMAQVLIGLGLKDRLSRGPGKGMAPPSPVFGYALTTGWRWVDYIYFVRDDYT
                     LEIYQPGEGWGEGIGLDEGEAWQKGCQRVAFACLEDKECRKFYKAWKTLLATPLRSGE
                     GEERQRKTLLH"
     gene            complement(114731..115474)
                     /gene="livF"
                     /locus_tag="TCCBUS3UF1_RS00505"
                     /old_locus_tag="TCCBUS3UF1_1030"
     CDS             complement(114731..115474)
                     /gene="livF"
                     /locus_tag="TCCBUS3UF1_RS00505"
                     /old_locus_tag="TCCBUS3UF1_1030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003048808.1"
                     /note="with LivGHMJ and LivGHMK is part of the
                     high-affinity branched-chain amino acid transport system;
                     LivFGHMK is specific for the transport of leucine, while
                     LivFGHMJ is a transporter for leucine, isoleucine, and
                     valine; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014514524.1"
                     /db_xref="GI:504327422"
                     /translation="MLEVRGLSLLYGKAQILFGVDLEVREGELVCLVGPNGAGKTSFL
                     RAISGLVRLEARLHRGTKAGEIRLEGEVRFQGRRIDGLLPHQIARLGLVLCPERRRPF
                     RELTVEENLLAGGLLLPKGEVGRQLAFVYELFPRLRERRKQRAGDLSGGEQQMLAIGR
                     ALMARPKLLAVDEPSTGLAPKVRALVFEQIARVRREGVTVLLVEQEAARALALADRAY
                     LLSNGCLVRHGPAQSFLEDPQFQRAYLGL"
     gene            complement(115461..116231)
                     /locus_tag="TCCBUS3UF1_RS00510"
                     /old_locus_tag="TCCBUS3UF1_1040"
     CDS             complement(115461..116231)
                     /locus_tag="TCCBUS3UF1_RS00510"
                     /old_locus_tag="TCCBUS3UF1_1040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014514525.1"
                     /db_xref="GI:504327423"
                     /translation="MALLEARGLSKRFGGLQALYRVDLRVGEREIVGLIGPNGAGKTT
                     LLRLLLGIHRPDEGRVFFKGKDITPLPTWERVRLGLAATFQNPRPLKRLPVMANVLVA
                     AYGPRGGRMGDWVKRAEVRALDALEFVGIADKAKEPAAVLSQGELKRLEIARALATEP
                     ELLVLDEPFAGLTPAETELLAKSLSRLRKGGRFGRLHSEGCAMVIIEHKLSELFKIAD
                     RVVVLNFGEVLAEGPPGAVAQDPKVIEAYLGEGVHAGG"
     gene            complement(116218..117879)
                     /locus_tag="TCCBUS3UF1_RS00515"
                     /old_locus_tag="TCCBUS3UF1_1050"
     CDS             complement(116218..117879)
                     /locus_tag="TCCBUS3UF1_RS00515"
                     /old_locus_tag="TCCBUS3UF1_1050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase"
                     /protein_id="WP_014514526.1"
                     /db_xref="GI:504327424"
                     /translation="MTETLYWERPWLRFYPPGTPEAVEPPEGHVGQRVEEAFRARGGE
                     VALFYYGRAYRYGELLEGIQRFASGLKALGLSPGDRVGLYLANSPQFALAYLGILWAG
                     GVVVPVSPLYTSHELRHQLQDSGARFLVVQDALWENASRAGVALEATIVVPLKEALPP
                     WQRLLVRSLPLPQGPGVYPWRDLFRAPPLPAPEPRQGEDLAALPYTGGTTGLPKGVEI
                     THGNILAAHRMIQSLNPFSRRSTILAFLPFYHIYGQVVLLLGGLLSGARLVVFSTPDP
                     DWILEAMVRYRATHFFGVPSLYEVLRDHPKAHWVDWGRLEVVVSGADTLHEATAEAFR
                     TRTGREIAEGYGMTETTSVSHINPRDRVKRGSFGIPLPGIRALVVDPDTLEPVPVGEV
                     GELALAGPNVTRGYWRREEENARSFFARGGLRFFRTGDLVRMDEEGYFHFYDRAKDMI
                     KYKGRPVFPREIEEALRAHPLVKAAGVVGVPDPKVGAYPKAYVVLEAEARGKVTEEDL
                     MAFLRERLAPYKLPREIEFRGELPKTDVGKVSRRELREEVQGGAP"
     gene            complement(117876..118949)
                     /locus_tag="TCCBUS3UF1_RS00520"
                     /old_locus_tag="TCCBUS3UF1_1070"
     CDS             complement(117876..118949)
                     /locus_tag="TCCBUS3UF1_RS00520"
                     /old_locus_tag="TCCBUS3UF1_1070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514527.1"
                     /db_xref="GI:504327425"
                     /translation="MTGPLRLWSLPWALLYLRHEVLALPGRTLALAFALFLLLFPLFS
                     QDPYWLRVLTLTAIFALYAASWDLLSGYTGQVSLGHAFFFGISGYASAILGRELGLPP
                     GLTIPLGALLATLAGVLVGLPSLRVRGPYLSLVTLAFPIIALGLIFLFPRFTGGELGL
                     SGLPRLGGSRLEEYYLVVLLFLASILVLWKLSGSRVGLLFHAIREDEMAVRMVGVNTV
                     RLKLLAFAVSAFFAGLAGGLHAHYLRVAGPDSLSLFNSIQPVIWTVFGGIATIYGPVA
                     GTFLLFPLLEVLRLAEELRTLAFALLVLLVMRFLPQGVVRGVLDRLEEECPRCKIRNA
                     FTRKRCRACGVELHLGRPKEVAR"
     gene            complement(118946..119809)
                     /locus_tag="TCCBUS3UF1_RS00525"
                     /old_locus_tag="TCCBUS3UF1_1060"
     CDS             complement(118946..119809)
                     /locus_tag="TCCBUS3UF1_RS00525"
                     /old_locus_tag="TCCBUS3UF1_1060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018112038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514528.1"
                     /db_xref="GI:504327426"
                     /translation="MLAAILVNGLVLSGIYGMLALGFALTYGVARILNLAHTAFYMAA
                     AYALFFFLGLLGFAPAALLSALLVLGLALLAYWLLLEPLKEYEATVLIVTIVLALLLQ
                     EGILLLFGGHFRSVPALLPGFLEVLGVRVAQQALLALFFAGLVLLLAWALLKGTRLGL
                     GIRAAAQDQEAAELLGISLSRAGYWAVGLGALLAALAGLAVAPMATLEPHMWNAPLLV
                     VLAAVVLGGLGSLPGALLGAVILAFAEVLVVNLLPGGAFLRTAVALLILVLVLVLRPE
                     GLFGAAFAEER"
     gene            complement(119810..121105)
                     /locus_tag="TCCBUS3UF1_RS00530"
                     /old_locus_tag="TCCBUS3UF1_1080"
     CDS             complement(119810..121105)
                     /locus_tag="TCCBUS3UF1_RS00530"
                     /old_locus_tag="TCCBUS3UF1_1080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041433913.1"
                     /db_xref="GI:752794482"
                     /translation="MAHHRWLALLALALALAGPAAAQTLRIGILGPMAFVQGEHTWHG
                     ATLAAEELNRAGGIAVGNQRYRIELVRVDTNEMTSVTDAATAVERAITAQRVDFLVGG
                     FRSEAVLAMTEVAADYRKVYLITGAALDGILAGRVDRNYDRFKYLFRVSPTKSSDLAR
                     TSLLLLGEVIQAVRRDLRVERPKVAILAERAAWADPLVETASRLIAAPAPQGYASEVV
                     GTWRPSATATDVTPELTAIQRAGAQVIFTVLSGPVGVPFGRDWGRLKIPAAPVGINVE
                     AQQETWLKATDNLGAYVATLNTLAPSVAITPKTIPFIANFQARFRQFPIYTASGAYAA
                     LYILADALQRAGTTAADAVVRALEATDYVGPSGRLVFDRTHDVTWGPGYTTGLGVQWI
                     EGRMQAFWPRQWRVGNQVVSYAGVRPYQLPPWVVEAWRR"
     gene            121238..121855
                     /locus_tag="TCCBUS3UF1_RS00535"
                     /old_locus_tag="TCCBUS3UF1_1090"
     CDS             121238..121855
                     /locus_tag="TCCBUS3UF1_RS00535"
                     /old_locus_tag="TCCBUS3UF1_1090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-oxoglutarate aldolase"
                     /protein_id="WP_014514530.1"
                     /db_xref="GI:504327428"
                     /translation="MLDPVEALARFRLLPLLTLRGGEDLEALGQALLEEGLPLLEVTL
                     RTPEGLQALPRLAAQGLVVGAGTVRSQDQAAKALAAGAAFLVSPALVEEVAHLAQERQ
                     VPYFPGVLTPGEVERALGLGLRDLKFFPAKAFHAPQVLRAYAEVFPEARFIPTGGLRE
                     EDLPQYAPLPNLLACGGSWLLEGSPAEVRRRLRAAKALLTPQAPG"
     gene            complement(121833..122609)
                     /locus_tag="TCCBUS3UF1_RS00540"
                     /old_locus_tag="TCCBUS3UF1_1100"
     CDS             complement(121833..122609)
                     /locus_tag="TCCBUS3UF1_RS00540"
                     /old_locus_tag="TCCBUS3UF1_1100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014514531.1"
                     /db_xref="GI:504327429"
                     /translation="MARLPRHETETAEASGTQTLLRGLQLLEKVAEGVHDLQGLAQAL
                     GLSRSTAYRILASLARAGYLRHEPRKGYWLGPKLIRLGFKAYGQLHLPTLARPHLEAL
                     RDATQETVHLGILEGQEVVYIDKVPGRRELQLASQIGARFPAQSTALGKALLAWSPPE
                     RWRQAFVPGLRRTAKTLGDWPAFAAELEATRARGYAVDLEENEPGVRCVAAPILNGQG
                     EPVAAVSVSTAALYLDEARIPEVARLVQEAARRISRELGG"
     gene            122707..123669
                     /locus_tag="TCCBUS3UF1_RS00545"
                     /old_locus_tag="TCCBUS3UF1_1110"
     CDS             122707..123669
                     /locus_tag="TCCBUS3UF1_RS00545"
                     /old_locus_tag="TCCBUS3UF1_1110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514532.1"
                     /db_xref="GI:504327430"
                     /translation="MKRWWAVVSALALGVGLAQTYTLRYNHVLGPNHPYHAGLQAWAE
                     RVAQRTNGDLRILVFHSAQLGIEEDIIEQLRQGVPLGQNTDGARLGNYVRELGVFNGP
                     YFVDDYAAVERLARLPVVQGWVERLAQQYGIRVLCFNWVQGYRHFMTNRPVRRPEDLR
                     GLRIRTPPAPVWQESVRALGATPVALPFGEIYSALQQRAIDGVELVYANVPDMSLWEV
                     LRYINETKHFLLINFQIVGEAWYQRLPANYRQILREECARAGRETSQRIAAEEERIKQ
                     LAQQRGMTIVSDVDLAAFRRAAEAAYQRLGLRTVRDALYQALKR"
     gene            123707..124168
                     /locus_tag="TCCBUS3UF1_RS00550"
                     /old_locus_tag="TCCBUS3UF1_1120"
     CDS             123707..124168
                     /locus_tag="TCCBUS3UF1_RS00550"
                     /old_locus_tag="TCCBUS3UF1_1120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014514533.1"
                     /db_xref="GI:504327431"
                     /translation="MKGLLNTLHRVEEALAKGFLLTSTLVVFLGGVGRFLGHPLDWSM
                     DLATFCFAWAVFLGGDLALKAERHVAVENLVRLLPPGGRRWILALVWGAVALFLLVLL
                     VYSLQAAYQTRFRSFQGIPGFSYSWVTLSVALGSLLMFLTALGKLRAAFSR"
     gene            124172..125446
                     /locus_tag="TCCBUS3UF1_RS00555"
                     /old_locus_tag="TCCBUS3UF1_1130"
     CDS             124172..125446
                     /locus_tag="TCCBUS3UF1_RS00555"
                     /old_locus_tag="TCCBUS3UF1_1130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_014514534.1"
                     /db_xref="GI:504327432"
                     /translation="MLLSFAVFLLLLLLGMPVVFAIGIGGLVFFLTQPGLQLTMPVQL
                     ALAETQNFSLLAIPTFILASNLMNELGVTRRLLQFAYVLTGFLRGGLAQVSVLMGFLM
                     GGVSGSAIADATMQARLLGPEMVRKGYPRGFIAALQGFSGLLAVAIPPSIGLILYGSI
                     GQVSIGQLFAGGIGVGVLMALSYMLTVAFLARRQGYAPEASAPPKAREVWQALRQSFW
                     AVLFPFLLLASLRFGVFVPSEVGAAAVVYALFVGLVYRELSLERLGRALSHSVRDVGM
                     VALLISMAAVLGYGMKWEMVPQQVSGFLLEAIQNPQVALLLILITLLLLGTVLDSTVM
                     IILLTPILVPAAKALGIDLVYFGVLMVLTCAVGLLTPPVGLSMYSVCSVMGCGIGEYV
                     REGWPLFLATLWVLLLAYLFPGVVLFLPRLLF"
     gene            125459..126163
                     /locus_tag="TCCBUS3UF1_RS00560"
                     /old_locus_tag="TCCBUS3UF1_1140"
     CDS             125459..126163
                     /locus_tag="TCCBUS3UF1_RS00560"
                     /old_locus_tag="TCCBUS3UF1_1140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014514535.1"
                     /db_xref="GI:504327433"
                     /translation="MRLKGKRALVIAAGQGIGRAIALAFRDEGAEVLGATLHPEKLEG
                     VVPAVRLDARDKGALQALIGGMAHLDVLVNAQGVVPVGGVLEATDEAWEEAFRLNAQS
                     VFWAMQAALPKMAAQGGGSIINIASVAAFKAVPQRFVYSATKAAVVAMTRAAALEFAP
                     QGVRVNAICPGTVDTPSLRERAGGEEGLKAFAERQLLKRLGRPEEIAALAVYLASDEG
                     AFATGGAFVVDGGMSL"
     gene            126160..127200
                     /locus_tag="TCCBUS3UF1_RS00565"
                     /old_locus_tag="TCCBUS3UF1_1150"
     CDS             126160..127200
                     /locus_tag="TCCBUS3UF1_RS00565"
                     /old_locus_tag="TCCBUS3UF1_1150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014514536.1"
                     /db_xref="GI:504327434"
                     /translation="MRLNAQALDRFAQGVLRAAGADEASAAATAQVLLDADLKGIHSH
                     GLVRLPIYVRRLEAGLANPRPVPRPLREEGPLVLLDGDQGLGPRVGLLAVELARERAR
                     AHGVGGVGVQRSTHFGAAGFYAEALAREGLLGLVLSNVEPDVVPYGGRRATLGTNPLA
                     FAAPAPQGVLLVDLATSQVAMGKVFLARARGEAIPPDWGVDEEGRPTRDPHRVRALLP
                     LGGPKGYALALMVEVLAGVLTGAGIAHGVGRMYDEWDRPQNVGHFFLALDPERLVGQE
                     AFRERMGLLWQAIKATPPAPGFPEVLLPGEREARLRAERLATGVPLEEATVRSLKELG
                     ARYGLALEVEGA"
     gene            127193..128128
                     /locus_tag="TCCBUS3UF1_RS00570"
                     /old_locus_tag="TCCBUS3UF1_1160"
     CDS             127193..128128
                     /locus_tag="TCCBUS3UF1_RS00570"
                     /old_locus_tag="TCCBUS3UF1_1160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate kinase"
                     /protein_id="WP_014514537.1"
                     /db_xref="GI:504327435"
                     /translation="MPEVVAAGEAMALLLAPQPGYLRHQTYLELRIGGAEANTAIALA
                     RLGFSVAFATWLGRDELGEVVLSRLRAEGVEVWANRVEAPTGLYLRERLPGGRGRVHY
                     RRAGSAASRMGPGAFDPGGLEGAKVFHLTGITPALSESARAFALWALREAKERGVRVS
                     LDVNHRRKLWSAEAARGFLEEALPLVDLLFLSEEDARLWSTEPQDLLPALAARGPKEV
                     VLKRGRKGALALVGGSPVAAEAFPVEELDPVGAGDAFNAGYLAGLLWGKPPEERLRLG
                     CALGALAVTVMGDYEGAPSPEELLAFLGQEHTMDR"
     gene            128139..128867
                     /locus_tag="TCCBUS3UF1_RS00575"
                     /old_locus_tag="TCCBUS3UF1_1170"
     CDS             128139..128867
                     /locus_tag="TCCBUS3UF1_RS00575"
                     /old_locus_tag="TCCBUS3UF1_1170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="WP_041433612.1"
                     /db_xref="GI:752794180"
                     /translation="MRVALVTGGSRGIGLALVQELLAKGFKVGVASRHPETAVADLTR
                     QGLAAFAVPIDLEHEPPEKAVAQAVAQGGLHVLVHAAGINVRKPALELGYEEWRRVLY
                     LHLDVAFLLAKAAAPHMAQAGWGRILFLGSATTFTSGGPVPIPAYTTAKTALLGLTRA
                     LAKEWAPLGIRVNLLCPGYVKTEFTAPVWGNPELYNPITARIPLGRWASPEEIAKVGA
                     FLCTDEAGYLTGQAVVVDGGFLAY"
     gene            complement(128861..129229)
                     /locus_tag="TCCBUS3UF1_RS00580"
                     /old_locus_tag="TCCBUS3UF1_1180"
     CDS             complement(128861..129229)
                     /locus_tag="TCCBUS3UF1_RS00580"
                     /old_locus_tag="TCCBUS3UF1_1180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018467877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514539.1"
                     /db_xref="GI:504327437"
                     /translation="MVLFVQVLRVPAYYLLPSILAISFVGVYAVNHNPFDLLLMTAFG
                     FLGYLLRKLEVPLPPILLGLVLGYLMEINLRRALILGAGDPGYLFGSPTALAFWGLSA
                     LVLLLSLVWAKGRPGGGEGQ"
     gene            complement(129258..130349)
                     /locus_tag="TCCBUS3UF1_RS00585"
                     /old_locus_tag="TCCBUS3UF1_1190"
     CDS             complement(129258..130349)
                     /locus_tag="TCCBUS3UF1_RS00585"
                     /old_locus_tag="TCCBUS3UF1_1190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514485.1"
                     /db_xref="GI:504327383"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     gene            complement(130743..131708)
                     /locus_tag="TCCBUS3UF1_RS00590"
                     /old_locus_tag="TCCBUS3UF1_1200"
     CDS             complement(130743..131708)
                     /locus_tag="TCCBUS3UF1_RS00590"
                     /old_locus_tag="TCCBUS3UF1_1200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514540.1"
                     /db_xref="GI:504327438"
                     /translation="MKRGAWQVYEEVLRAAQGLGLEGEEGEVVQGLLALPREAFRTFA
                     QGLGLKPKYLRHDLLPVAFLPEPLREALRAGLPLWHAHRLNRLLRAGRLALEDLQGRP
                     PEALKALPREEGGVDLGAPVWLYPEDPRPEALAPGVARALVALYSLPGELVVDPMAGY
                     GTVVEEALGLGRRAWGGDTCPKGPRVERADIRDLPRRFQGEAALLVLHPPTFASWLKE
                     EGEKAPPEERYAAYVEYLQGLLDYALPALRPGGRLVLVVRPRHALSPREWAMGRDFFL
                     SPFERALAEVSPRLRPFHYHLAVRRDGGEAWHLFVAEVGDGGLGG"
     gene            131829..133199
                     /locus_tag="TCCBUS3UF1_RS00595"
                     /old_locus_tag="TCCBUS3UF1_1210"
     CDS             131829..133199
                     /locus_tag="TCCBUS3UF1_RS00595"
                     /old_locus_tag="TCCBUS3UF1_1210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514541.1"
                     /db_xref="GI:504327439"
                     /translation="MAAHRTSSKEALARPKHFDEANVARLGLISIQERIPEGYSSWEE
                     EFEFLGKPVKLACYASEKVGGVPHGLDNEVSLALIALYFNAGSPEDGTFTATPYQILK
                     LMGLDTSGYYYQALKESLMRLTTATYVLSEAWRADGRWQSVTFRYIEKLEYTSSAEGK
                     LDRASVLRITLAKEIVRSLKQNYVKPIDIEFMASLKRPLSRALYRLLDAQRFSPENPS
                     PLPRFEVNLMEWAAACKIVHKRPDKVRRTLEPAHEELIARRYLQSVEYIGRGQQQTIV
                     YVFGEEAGGVADMEAVDLLMAEGLSFTSAYSLARRYSLAHIKDRLERFRSILASGYKP
                     KNRLGFLVDVIRDEEGKYRRALPPAQGRRAQAHREEEEARRIEEEAEREWQRMPKEAQ
                     VRRALQVAQLVLRSRISVGELEELARLMEAGQLEPRAVVEELKAAASGGRLEEWLQTF
                     RQGLAE"
     gene            133753..138729
                     /locus_tag="TCCBUS3UF1_RS00600"
                     /old_locus_tag="TCCBUS3UF1_1220"
     CDS             133753..138729
                     /locus_tag="TCCBUS3UF1_RS00600"
                     /old_locus_tag="TCCBUS3UF1_1220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_014514542.1"
                     /db_xref="GI:504327440"
                     /translation="MEQALAADRVWVALDLEATSSRPEEAEILEVAAVDTLGRTFRRY
                     LVTQNPLGPDHEAFRLTGIPYGEYQANKVLPGQALVELLEFLGARPLVGHNLLRYDLP
                     LLGRYLKDLDLSLPARSVLDTLRLAHLLFPVPPPGLEGYRLGDLYRFFTGHELQGAHR
                     ALEDARANLQVLDHLMAWGKEHLATHPGLVRAWRELGLREAALFPEVPGLVKDLLARA
                     ADVREFFVEAEGKPLPSLDNLGPDLLPTRREAQQRMFHLVAAALDQGIPLLLQAPTGT
                     GKTKGYLYPALGREGVTWVATHTKVLQAQVLDELREVAQRGYRVRAALVKSARDALCP
                     DRLLEAFLEERKAGSEEARLAVGVLLHYAALGFHDLEALPAYWHFQEGFRAVRARVGT
                     NPIRCREACPFFAYCAFQRMEAKRKRATLLVTNQAYLLQHFLEAGTGPTLEATPSLVV
                     DEAHHLEEVATEALTEQVDGEGLRHLLERLADQDRGRGLLLNEEYLRPLGEEARAKAK
                     ELAAEGVPRAAGVLEAYGNRLEAFLKQWGRGSPEYGLYLPLDRTWPRHEAYPLLRREE
                     QALIRVLAYLLEKVQELRDLAPRSLLALELDSILREFRIYLDLLREREEALEKGGDDS
                     SLYVSRLDPVTGTWAHLKEPVEVAPQLERGLWPKFRGVVLTSATLRVPTEKDPEGFSF
                     LQRILGLPEKAKKEALPPSLPYEKATLLVPHHLPEARESTLPRFQRLLHQELRLILQA
                     VPRTLTLFTSLRRLEEARRALEDLPHLRAPLTRREREDTLRLARANPEAPLAALGSRS
                     FMEGVDIPHLKLVNLERIPFPYPSPLVRKRMERAYEYGLDGWEDYYLPKAVLAFVQAF
                     GRLVRDDRKRAGRGAFVLWDKKLLHASYQEPFYRALPEGVGRLFPGTREAFYRALGEA
                     LDLPLPVPAEEFPEAPWAQVQAILRNPLLSNLEKGRRVAKEVYRLVLAEDRWAKQAEA
                     IQAALEGHHLLALLPTGFGKSLAFQIPAWLQEGLTLVVSPLVALMKDQADRLAELGLP
                     ALALHGLMSGGEQRGVLDEVRQGRVHLLYVAPERINRSSELQKLLKEFRAAGRLARVV
                     FDEAHCLLEWGFDFRPDYLRALEWLKGLALPMSFFTATLTPEERVRLKQVAGLREVVE
                     VLPDTFHRENLRFVVRQARGEVDKFAHLAQALLWVQKEGGSAIVYATSRAETERLAWA
                     LGKLFPGLGVEAYHAGLGPHIRREVQERFTQGVSRVVVATTAFGMGVDKADVRLVAHW
                     RPPLSLEEYIQQAGRAGRDGKEAYAFLLYTVGDWNFLRWMAGLSRRSSWEVYAEALLK
                     RLETGAFRGYKKDLLQSLRQQLGESVAEEVGVGEEEDEPEGIEGPAPLGSEELDLLLA
                     GLERAGVLRFQYLPGRASLLLFPEELDRLRRREPGLSSLLERAVFRGSPRQGEVFLDM
                     SRLPLEQAEELDNGLYRAYREGWLRLYHYREPLLLVERSPTAQGQNLDAWRQDREKAV
                     RLAQERLDAVREYATRSRCRAGVLLAHINGERRRCGTCDTCSGDLGPWEGLETFQSEE
                     LLRAYKPLDTLLAFFRWVEEHYLQNPYLGRQATLMALRGKDRTKDGLLSPRYRDNALF
                     GHLSFLKPKQLERAFEEALRLGYLEKKAVWQGRDLFGLTEAGRKRLRR"
     gene            138732..139601
                     /locus_tag="TCCBUS3UF1_RS00605"
                     /old_locus_tag="TCCBUS3UF1_1230"
     CDS             138732..139601
                     /locus_tag="TCCBUS3UF1_RS00605"
                     /old_locus_tag="TCCBUS3UF1_1230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014630419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514543.1"
                     /db_xref="GI:504327441"
                     /translation="MKEKGERTPPTFRVPSLGELPERSGGCRPEDLPRPVFTPTPEGD
                     LPLLGEGSQQEDSENPKEERQVWRLKQRLQKKHAELEDLRRRLARLEREWQVALRAKG
                     KAEMEASRLRKDYAALEEELAQLRKQWEEAQAQLNLLLPLREENKTLREEVVRLGEKV
                     ASLQKEAKRGEAWARAQAFQEALPAPFPLEVFSRVLFLDYGALGTTPEERLLALAEGY
                     KALLAGHDHPALQASTRELIQGDPEGIALVGLERLLLDLANSPLPRWLRTHAWLLEAR
                     LRGGGLHSPREEG"
     gene            139598..140110
                     /locus_tag="TCCBUS3UF1_RS00610"
                     /old_locus_tag="TCCBUS3UF1_1240"
     CDS             139598..140110
                     /locus_tag="TCCBUS3UF1_RS00610"
                     /old_locus_tag="TCCBUS3UF1_1240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014511169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514544.1"
                     /db_xref="GI:504327442"
                     /translation="MTPEERQTLEARFREDLAWYERELEACWKRLAEERTAWQETKRG
                     LLEEISRCSHRIRALEAKGREREKEVEALKRRLEALNRPALGEGWLAALREELGHWDQ
                     MLVEKVGAVRAGNLEEALEELLGMRLEALRRHLQGQQPDFKALYTALVLEWALWAWLE
                     GEWQTLGDTP"
     gene            140083..141612
                     /locus_tag="TCCBUS3UF1_RS00615"
                     /old_locus_tag="TCCBUS3UF1_1250"
     CDS             140083..141612
                     /locus_tag="TCCBUS3UF1_RS00615"
                     /old_locus_tag="TCCBUS3UF1_1250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antiterminator BglG"
                     /protein_id="WP_014514545.1"
                     /db_xref="GI:504327443"
                     /translation="MADPWRHAVNLYRAVEEGLRLGDLRRAPVRYEDYLGVKETVRKL
                     WLGEWRPGLHKPTKDGVVPAYLLLGFLAGYFFYRNLPENDLAFWPDFLKALGVDQQEP
                     TPAQRDLLWRVLSGVPLVQRHLRFHADGSRDFVGTLDALFGFRALRLRDLLAHLRRYR
                     EEGVLAGELGAYGEILSTLKEALDRLVQEGLAEEELDDLEGLVARLESLGFFPPDPHP
                     LRFLFHRSQEALRSLYREWRGEKNEATRYSKVRVELLQGKGLVERVVPQMRPEPLLEG
                     MKVYGQVRFRDGTFQGFTWTPRLDEKGLPIPEEKRLVHQEGEVVFRLHHRAWGVRFLD
                     SSGNPVPFWRYPEPFRVESFHFDPAKNPLAFSLESGGAPVEDPRGISLDQALLEDILL
                     VEVLVSGKREHGEWRLLGRLPVRFHPLLTPRLTEEALELGLSPPGELEVELLPSQAPP
                     QRARGSVRIPRGRLPFRVRVRAFGQVWEYQVPPRGWPAAFYRAGMAFGNPGPLRPEGP
                     V"
     gene            complement(141670..141993)
                     /locus_tag="TCCBUS3UF1_RS00620"
                     /old_locus_tag="TCCBUS3UF1_1260"
     CDS             complement(141670..141993)
                     /locus_tag="TCCBUS3UF1_RS00620"
                     /old_locus_tag="TCCBUS3UF1_1260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433614.1"
                     /db_xref="GI:752794182"
                     /translation="MILTTTGTVEGKRVEAYLGVVFGEAIVGANIFRDLFASIRDIVG
                     GRSGAYEAELRRAREMALSELAEAARQLGANAVIGIDVDYEVLGQGNSMLMVTASGTA
                     VRLAP"
     gene            complement(142056..>144281)
                     /locus_tag="TCCBUS3UF1_RS00625"
                     /old_locus_tag="TCCBUS3UF1_1270"
     CDS             complement(142056..>144281)
                     /locus_tag="TCCBUS3UF1_RS00625"
                     /old_locus_tag="TCCBUS3UF1_1270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110668.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_041433914.1"
                     /db_xref="GI:752794483"
                     /translation="ELFDRFAPALILMDEWVAYLRNLHGEDLPAGTFDQNLTFAQALT
                     EAAKRSRRTLLVASLPASDAEVGGERGREALFRLQNVFGRLESVWQPATQDESYEIVR
                     RRLFLPLSEEGYRARDAVVQAFMRLYREHKGEFPPETLEPDYERRLKLAYPIHPELFD
                     RLYGDWSTLEGFQRTRGVLRFMAAVVYALWSRGDTSLMILPGGLPLDPGGPRYELTRH
                     LSRFLEGFDGVLDADVDGVNARALVLDNERLALGRQQMARRTARAVFMATAPGAAAPV
                     GRPRGVEGVRVRLGVVQPGESPALVADALRALADHLTYFHAEGDRYWFETRPSLNRLA
                     QERATRLDPEEARREIAGRLKGWARGRTPFAALHAAPESTADVPDEPALRLVLLPPTA
                     PYAKGGSEGERRAREILETRRQAPRLYRNTLLFLAAEASLVPDLEEATRRYLAWKGIW
                     EDREALNLGQADLRQVEARLKEAGDTLEARLKEAYRILLSFTQPDSQNPHLEPTAIRL
                     LGSGDPAERAAAKAKHEALVYTEWHPRFLLETLERYRFFTSREPQGVLPLRWLWEALC
                     TYPYLPKLQGEEVLLESVKRGVEEGLFGYATHLQEGKPKGVFLGERVTPSLQGFLLRR
                     EVAEATQGEEAKVAVDGPTPPGGGALPPTPEKTPVAAPKPRPKRFYLRKELAPHSLVQ
                     EAELLAKEIVLHLAKEPGVRLKLHLEVQAEAEGGFSEDLARVLRENSATLKADHSLEE
                     A"
     gene            144867..146087
                     /locus_tag="TCCBUS3UF1_RS00630"
                     /old_locus_tag="TCCBUS3UF1_1280"
     CDS             144867..146087
                     /locus_tag="TCCBUS3UF1_RS00630"
                     /old_locus_tag="TCCBUS3UF1_1280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514494.1"
                     /db_xref="GI:504327392"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     gene            complement(146394..147461)
                     /locus_tag="TCCBUS3UF1_RS00635"
                     /old_locus_tag="TCCBUS3UF1_1290"
     CDS             complement(146394..147461)
                     /locus_tag="TCCBUS3UF1_RS00635"
                     /old_locus_tag="TCCBUS3UF1_1290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514548.1"
                     /db_xref="GI:504327446"
                     /translation="MLARPRRFGLYAWDMALSNREIVGRGLDLLRAGLAPFVEREYQR
                     VYGEAWAEEALEVLKDRASLQDPDGQALLKLMDFRWNEVFDEKLGRWGRTLVKELLEV
                     RNRFAHQNPFSLEDAHRALDTITRLLEMVAAEERAETNRMARELLRRRFEEEARREAE
                     KAAKLPQAPTPSGLKPWREVVTPHADVASGRFTEAEFAADLAEVLQGEASPEYGDPLE
                     FFRRTHFTGGLRQLLLNALRRLSGEGGDPVVELQTAFGGGKTHSMLALYHLFGGRVDP
                     HEVPGLEEVLKEAGLARVPTARRAVLVGTALDPARPRPKPEGLLVHTLWGRWPTSSGG
                     WRGTGWWRRGTGGAWPWDRTP"
     gene            complement(<147555..147911)
                     /locus_tag="TCCBUS3UF1_RS00640"
     CDS             complement(<147555..147911)
                     /locus_tag="TCCBUS3UF1_RS00640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514549.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin HicB"
                     /protein_id="WP_041433915.1"
                     /db_xref="GI:752794484"
                     /translation="MRRQTWKENKPLEYYLNLRYPVLLVPEPEGGFTALLPDLEGCVS
                     VGETEEEALANLEEARQLWIETAYEHGDEIPLPSSAKEYSGRILVRMPKSLHRRLDEE
                     ARAEGVSLNQFIVSLLS"
     gene            complement(147908..148177)
                     /locus_tag="TCCBUS3UF1_RS00645"
                     /old_locus_tag="TCCBUS3UF1_1310"
     CDS             complement(147908..148177)
                     /locus_tag="TCCBUS3UF1_RS00645"
                     /old_locus_tag="TCCBUS3UF1_1310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514550.1"
                     /db_xref="GI:504327448"
                     /translation="MGKKRKLLEKLFALPPEMRYEDVEKVLVAFGFECVRSKGSHQQF
                     RHPGGRMLTVPKRKGQTVTRTYLKQVIAALECVTGKTLEELIEEE"
     gene            complement(148238..>150820)
                     /locus_tag="TCCBUS3UF1_RS00650"
                     /old_locus_tag="TCCBUS3UF1_1320"
     CDS             complement(148238..>150820)
                     /locus_tag="TCCBUS3UF1_RS00650"
                     /old_locus_tag="TCCBUS3UF1_1320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514551.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_041433916.1"
                     /db_xref="GI:752794485"
                     /translation="DHVKDPQEALDPRKGVVAEAQYEIAKSLAQSLGKTPPASTNDRE
                     TIAALLEEAPPVLDPFAGGGTIPLEAQRLGLRAYASDLNPVAVLINKALVEIPPRFLG
                     LLPVNPEYRAKAREGEALPGAKGLAWDVRHYGAWVREEARRRIGHLYPELNGETVIAW
                     LWAHTVTCPSPGCRAETPLVRSFWLSKKRGREAFVVPEVRSGQVFFRVERGGEPPVEG
                     TVNRKGARCLVCGTPFSLEHVRQEGRAGRLGAKLMALMTEGKGGRNYHAPNEEHEAIA
                     HQALPTWKPLTQLVHDPRNIWCVQYGLATHADLFTPRQLLALATFADLVDEARERVYQ
                     DALQAGMPDDDTPLAEGGRGARAYAEAVGVYLALAVGRLVDYHPALCSWHTSRENIRN
                     TFTRQALPMVWDLAEANPFSQSSGSWDNMLEWVATALEALPAHPPGQARQLNAQESVN
                     GVPTPPLISTDPPYYDNISYAILSDFFYVWLRKTLEPTYPDLFRTLLTPKAEELVADP
                     YRHGSKEAAKRHFEEGMRQVFRNLRQKAHPDYPLTLYYAFKQQEEEADEEGNGAPTLA
                     STGWETFLQGLVDAGFQITATWPMRTELANRPQGQGSNALASSIVLVCRPRPQDAPLA
                     TRQEFLRALRQELPEALRKLTQGSIPPVDLAQSAIGPGMAVFSRYRQVVEPSGRALSV
                     REALVLINSVLDEFLAEEEAELDSATRFAIAWYEQYGYGEGPFGDAETLAKAKNVAVA
                     ALEEGGILRAKAGKVRLLKPEEYPEGWDPQTDRRLSAWEVAHQLIRALKQAGESAAAT
                     LLSQVPPDLAEGARALAYRLYGIAERKGRTEEAQDFNLLAGSYGHLHVEAARRRGAVQ
                     GELF"
     gene            complement(151226..151453)
                     /locus_tag="TCCBUS3UF1_RS00655"
                     /old_locus_tag="TCCBUS3UF1_1330"
     CDS             complement(151226..151453)
                     /locus_tag="TCCBUS3UF1_RS00655"
                     /old_locus_tag="TCCBUS3UF1_1330"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="Helicase domain protein"
                     /protein_id="WP_014514552.1"
                     /db_xref="GI:504327450"
                     /translation="MNLQQAHLLINYDLPWNPARLEQRFGRIHRIGQTEVYLVAENTR
                     EGEVYRRLLAKLEEASRALGGKVFDVLGQLF"
     gene            151627..151857
                     /locus_tag="TCCBUS3UF1_RS00660"
                     /old_locus_tag="TCCBUS3UF1_1350"
     CDS             151627..151857
                     /locus_tag="TCCBUS3UF1_RS00660"
                     /old_locus_tag="TCCBUS3UF1_1350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_041433616.1"
                     /db_xref="GI:752794184"
                     /translation="MVVGMRVSKAYFKAHALELLRQVEATGEPLILTHRGKPVLEVRP
                     YREENPLEELRGTLLRYEGPTEPTEGVWEALR"
     gene            complement(152541..153419)
                     /locus_tag="TCCBUS3UF1_RS00665"
                     /old_locus_tag="TCCBUS3UF1_1370"
     CDS             complement(152541..153419)
                     /locus_tag="TCCBUS3UF1_RS00665"
                     /old_locus_tag="TCCBUS3UF1_1370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_014514556.1"
                     /db_xref="GI:504327454"
                     /translation="MSAIRAYLKGLVEEAKRPATSTLPLAELVPRPQPRRRFDEASLA
                     TLADSIRAHGVLEPLLVRPVGEGRYEIIAGERRYRAARMAGLSEVPVVVLEADEKTAQ
                     ALALMENLQREDLNPYEETLGVLDLLALELGREREEVVGLLHRMRDERKGKVPHNVMG
                     SPEAGKVEEVFRLLGRMTWESFVQNRLPLLRLPPDLREALEEGSIPYTAALELKKVKD
                     EGVRKGLLAEARAGLPLRELRVRVRQALKRPAPPPPWHKEVAARLARLDLESLPEAKR
                     QEVEKHLKALRQLLAE"
     gene            complement(153416..154378)
                     /locus_tag="TCCBUS3UF1_RS00670"
                     /old_locus_tag="TCCBUS3UF1_1380"
     CDS             complement(153416..154378)
                     /locus_tag="TCCBUS3UF1_RS00670"
                     /old_locus_tag="TCCBUS3UF1_1380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_014514557.1"
                     /db_xref="GI:504327455"
                     /translation="MKRERLVPLPEWARREGISESLARKWIREGRLEAVRLGHYWYVP
                     EVVEGPEGRGQAYTLFTHAGGAGKTSLARDLGFELASRGYRVLLVDADPQANLTAWLG
                     VEPGSVADEETLLRVIRHDTLPQPRPVGRNLFLIPASVNLAVGELELDRKPLGALALR
                     TALERREGYDLVLVDSLPSLGSLAVMAALAGDGLLVPVETGAKGVQALQAVVQVAKEY
                     REALRKVAPEAVAGRAHIIRAFIPTKYDARTQGDNRVLQLIGELEEVAPVAPKVAYRP
                     GPHRKATEEGVPIHAAGDKEAVEEIARLADFLLERVFRLEGVPA"
     gene            154488..154964
                     /locus_tag="TCCBUS3UF1_RS00675"
                     /old_locus_tag="TCCBUS3UF1_1390"
     CDS             154488..154964
                     /locus_tag="TCCBUS3UF1_RS00675"
                     /old_locus_tag="TCCBUS3UF1_1390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014630509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514558.1"
                     /db_xref="GI:504327456"
                     /translation="MIIPRRLEPILEARLREVPVVVLTGPRQAGKTTLALRVGERWGA
                     LYLDLESERDRAKLAEPELYLEGFWGRLVILDEVHRMPGLFPVLRSLVDRARRGHRAD
                     LYLLLGSVSPEVSRQAGESLAGRAGYKRGCGGLQSPPLSRVGCSSPPRGPVGHTAW"
     gene            155386..155844
                     /locus_tag="TCCBUS3UF1_RS00680"
     CDS             155386..155844
                     /locus_tag="TCCBUS3UF1_RS00680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012649542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433618.1"
                     /db_xref="GI:752794186"
                     /translation="MRRLPPYEANVGKRLVKTPKLYLRDSGLVHALLGLPHREALLGH
                     PVVGASWEGFVVENLLRVLPWGAEAFFYRTRAGAEVDLVVRFPSGTLWAVEAKRSLTP
                     RPTRGFFEALGDLNPERAFVVYPGEEAFPVAPGVEALPLRALMARLGGAP"
     gene            155940..157652
                     /locus_tag="TCCBUS3UF1_RS00685"
                     /old_locus_tag="TCCBUS3UF1_1410"
     CDS             155940..157652
                     /locus_tag="TCCBUS3UF1_RS00685"
                     /old_locus_tag="TCCBUS3UF1_1410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014514559.1"
                     /db_xref="GI:504327457"
                     /translation="MLRTLGGLWWEGQPFRRTKPLLLLAYLALEGPKPRRHLAELFWP
                     GAQDGLNSLSVALNQLRPLGVVEGGEVLSARVESDVGALLAALRAGDLEGVRRLYRGA
                     FLEGLDLPLGEELEEWVWARREALALEVYRLFARRARAHFALGLAEEGRALLGEALAL
                     GGVRHAVEVAEEPPPHPQPLPREVRRAYWAFHLLPGKAPEVCPLEPEALERLHEEGLL
                     SPGGYPLLPLGLEALPPEAQEVALELARRLPLREALPLYRLARFFWTEEDRRRAGQAL
                     LAEARRWLSENPLQGLELLQGLPRDPQVQLLRARALERLGRYGEALEELEGLEEEDPE
                     AAAVRGGILFRLGRVGEALAEAERAAGGSPWAQGEAWNLRGLLAFSQGRFAEAAALFA
                     RAAVRFLAAGETARQVDALNNRAVALVEGGSPEAEGVLAEALRAAGEAPLLRARVLLN
                     LGVVRERQGRPEEAEALYRASLEAAERAGSLEALGRAWNNLGALFHRQGRLGEAEAAY
                     RQALALAKEGREWVLTAAVLANLAELQGDPASLEEAIALLQEARYTVLAERYRARLEA
                     FRGR"
     gene            157845..159176
                     /locus_tag="TCCBUS3UF1_RS00690"
                     /old_locus_tag="TCCBUS3UF1_1430"
     CDS             157845..159176
                     /locus_tag="TCCBUS3UF1_RS00690"
                     /old_locus_tag="TCCBUS3UF1_1430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_014514561.1"
                     /db_xref="GI:504327459"
                     /translation="MTQRAKGLWLVWVLLGAWLAGCGPSEPSLTLYPSRAVPGEEVEA
                     RLSGMGGLEARVYVGEVEAEVTAREVRAVRFRVPALPGGPKPVRVVSGSQEAQGTLGL
                     LGRVDPSRVLLRLPLGREPRLPKGFTLLRQDSLSACGFALAELGYSGEALGRALEELE
                     AQDPAYKADPESLWSLGGVSGGEAVGAPLAHRRGRTGKGVRVAVLDTGVDAAIPQLPG
                     YDFVEDDPVPQDAFPGGHGTGAAGLVKEVAPDAQIVPVRVCDGNGVCRASRVVRGVCW
                     VVANRQGPTVLSLSLGGDTPVEALRLALEAALAQGLPVAAAAGNQGNQGSPAHYPAAL
                     DLPGLVAVGALEEVQGEWKPAAYSTRGTYVDLAAPGTDLDCVLPGGGRGSCTGTSFAT
                     PLVAGAMALWLEAQPGLTPAQVQGHLMQSAKALPQPTQAVGAGMLDLGQAP"
     gene            159304..160407
                     /locus_tag="TCCBUS3UF1_RS00695"
                     /old_locus_tag="TCCBUS3UF1_1440"
     CDS             159304..160407
                     /locus_tag="TCCBUS3UF1_RS00695"
                     /old_locus_tag="TCCBUS3UF1_1440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013013078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514562.1"
                     /db_xref="GI:504327460"
                     /translation="MRKLFVGVWIGAFAGLLLAGCNLGGGTDPLNEALAAEDAVYGAV
                     LAWVEGVEASAQGLTPQGDGGRPLTLVKDSDGLTVLAQATGWTPPQDPGGLLGQPLGI
                     TIKCSSDGRRCAYAPMELVGDGEGGYRMVWRGRTGEGTPIEEATPATAEPGGPGTDPT
                     AKPRWSYNKIGLGGFWADSLIQYPFRLHLAAPGPEGLAGWAGPTPPQNPTASLEEALR
                     QAFSLPKPFSLSWPPALLLREDLVLAFAPYQNPAFSTARSPADLVGQPLGVAYWRGGK
                     GAKLTKADAARLLSLSLTQEPGGGYGLEAQDLRNPGQVLRFRVGEVGWCDGCFGQDPR
                     PRYLGIEDRLQGPPLVHLQVGGLLLRGIEKKDR"
     gene            complement(160455..162365)
                     /locus_tag="TCCBUS3UF1_RS00700"
                     /old_locus_tag="TCCBUS3UF1_1450"
     CDS             complement(160455..162365)
                     /locus_tag="TCCBUS3UF1_RS00700"
                     /old_locus_tag="TCCBUS3UF1_1450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase"
                     /protein_id="WP_014514563.1"
                     /db_xref="GI:504327461"
                     /translation="MGRARALAVWGTGSGVGKSFLAAALLRHFRRLGLKAAPFKAQNM
                     SNHARVVAGGEMASAQWLQALAAGAEPDPRMNPILVKPFGEGGSQVVVLGRVDPRLSH
                     LPWKERKAHLLAPVREALEGLLGEYDLLVLEGAGSPVERNLWPDLPNLQVAVWAGARA
                     LLVADVDQGGSLAAFFGTWALLGEHRERLLGFVFNKFRGDLSLLEPAYALLEGWTGVP
                     VLGTLPLLPLELPEEDGFRHRPKEGEGPKVALLRYPHAANLDEFWALGELVRLVHART
                     PEEAEGADLLILPGSRLPARDLPWLRAFLPLLRRHLEAGRPVLAVCGGAEMLSEALVD
                     EEGVEAQGVFPGLGLLPFRVRMEREKTVRRTRVRFGGLQGFWGRLNGLEATGYEIHHG
                     QGLPLLHQEGPLLATWLHGLLEDPGVQRALFGREARGLEEALEGAADALEAHLDLPAL
                     HRALGLVGGVHPAPRPQAPDPPPAPGLVLFLGGARSGKSRQAQRLAGPFATLIATAEA
                     RDGEMAERIARHRAERPPTWETLEEPLDLVGALARAQHPVVVVDCLTLWVSNLLERGL
                     DPLAEAGRFLKAAQESGKRVILVSNEVGMGIVPANPLARRYRDLLGEVNRLAAEAAQE
                     AYLLVAGRLLPL"
     gene            complement(162352..162735)
                     /locus_tag="TCCBUS3UF1_RS00705"
                     /old_locus_tag="TCCBUS3UF1_1460"
     CDS             complement(162352..162735)
                     /locus_tag="TCCBUS3UF1_RS00705"
                     /old_locus_tag="TCCBUS3UF1_1460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_041433917.1"
                     /db_xref="GI:752794486"
                     /translation="MRWLAQAQDDWEAGEALLGAGKFAQAAFLAQQAGEKALKALWIA
                     LGLDPWGHSLARLIRDLPEGMGGALQPLLPQALALDKLYIPTRYPDALPGLTPKEAYT
                     QEEAQKALMDAQAILKAVEVALGKG"
     gene            complement(162743..163069)
                     /locus_tag="TCCBUS3UF1_RS00710"
                     /old_locus_tag="TCCBUS3UF1_1470"
     CDS             complement(162743..163069)
                     /locus_tag="TCCBUS3UF1_RS00710"
                     /old_locus_tag="TCCBUS3UF1_1470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_014514565.1"
                     /db_xref="GI:504327463"
                     /translation="MEADLEAYLAQATERLREALDLEALYLFGSHARGTADRRSDLDL
                     LVVARTPLPPLARLELVLQLLADAPLPVEALVLTPEELAERRELPFLKGVLREAKPLY
                     ERGKAA"
     gene            complement(163079..163408)
                     /locus_tag="TCCBUS3UF1_RS00715"
     CDS             complement(163079..163408)
                     /locus_tag="TCCBUS3UF1_RS00715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014511282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_041433620.1"
                     /db_xref="GI:752794188"
                     /translation="MPSVQVFYPPWNRETLLERLRKGLEALAQEVPLEAAYLFGSWAR
                     GRAVAGSDVDLLLLYRGPRREDLHRLARRAFPGLPLELHAYTLEEAQALGPVLARMLQ
                     GAVPLMG"
     gene            complement(163347..163765)
                     /locus_tag="TCCBUS3UF1_RS00720"
                     /note="DNA-binding protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(163770..164621)
                     /locus_tag="TCCBUS3UF1_RS00725"
                     /old_locus_tag="TCCBUS3UF1_1490"
     CDS             complement(163770..164621)
                     /locus_tag="TCCBUS3UF1_RS00725"
                     /old_locus_tag="TCCBUS3UF1_1490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin biosynthesis protein CobD"
                     /protein_id="WP_014514567.1"
                     /db_xref="GI:504327465"
                     /translation="MSLLLALLLDALLGEPPARGHPVVLMGRYLAWAWPRVRGFWSGA
                     LYWGLGALLFTLPALLLDLLLRPLGLGWLLLGLLLKPLFSLRMLLLEVLEVERALGKG
                     LEAGRRQVARLVSRPTGGLSEEEVREAALESLAENLSDSLLAPLLYYALLGLAGAALY
                     RYANTADAMWGYPEHGERGAFAARADDLLNLLPARLAGFLLCPPRLWPRLLQEARKTP
                     SPNAGFPMGAMALRLGVRLRKPGVYALNPTAPSPTPAHLRRGVWLAGAWGYGLGLALG
                     ILLEVVG"
     gene            complement(164618..165136)
                     /locus_tag="TCCBUS3UF1_RS00730"
                     /old_locus_tag="TCCBUS3UF1_1500"
     CDS             complement(164618..165136)
                     /locus_tag="TCCBUS3UF1_RS00730"
                     /old_locus_tag="TCCBUS3UF1_1500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ribazole-5'-phosphate phosphatase"
                     /protein_id="WP_014514568.1"
                     /db_xref="GI:504327466"
                     /translation="MELWLVRHGETLWNREGRLLGWTDLPLTPLGEAQARALQGLLPP
                     LPAYSSDLSRALRTALLAGFSPTPTPSLREIHFGSLEGALWDALDPGLKEAMLRFQGF
                     HPPEGESLDRFQERVLAFLGGLRAPAVLFTHGGVIRAALRALGEDGLIPLGSAVVLEW
                     PKRVLDRILPSP"
     gene            165179..166186
                     /locus_tag="TCCBUS3UF1_RS00735"
                     /old_locus_tag="TCCBUS3UF1_1510"
     CDS             165179..166186
                     /locus_tag="TCCBUS3UF1_RS00735"
                     /old_locus_tag="TCCBUS3UF1_1510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="WP_014514569.1"
                     /db_xref="GI:504327467"
                     /translation="MEGIREAAQRRMERLTKPPRSLGRLEEVALRLAAIQGRVRPELG
                     PGGVVVAAADHGVAEEGVSAYPQEVTRQMVLNFLRGGAAINQFAQVAGCEVYVLDVGV
                     KGELPDHPRLLKAKVREGSRNLAREAALTLEEAERALEAGREAARRAIAEGATLLAAG
                     DMGIGNTTTAAALTAALLGLPPEAVVGRGTGVGEEGLRRKREAVARALGRLGPGMGPL
                     EVAAQVGGLELLAIAGVYLEGYARGLPLVLDGFPVTSGALLAWRLAPGIRDHLFAGHL
                     SREPGHRHALEALDLKPLLDLDLALGEGTGAVLAMPLLRAAARILHMATFEEAGVSDR
                     L"
     gene            166191..166889
                     /locus_tag="TCCBUS3UF1_RS00740"
                     /old_locus_tag="TCCBUS3UF1_1520"
     CDS             166191..166889
                     /locus_tag="TCCBUS3UF1_RS00740"
                     /old_locus_tag="TCCBUS3UF1_1520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMP-binding protein"
                     /protein_id="WP_014514570.1"
                     /db_xref="GI:504327468"
                     /translation="MLLAFRLALALLTLLPVAPHGAKEEDFRRSTAFFPLVGYLLGLP
                     LALLAPLPLPEGLWGALALGLLLGLTGFLHLDGLLDAADALLGTRTREERLRILKDPH
                     LGAFAFGVGGVYLLFLWQALALVRDPLFLLLFPGFARFLPLPLLHRYPLLGPGMAGLI
                     RGGPLLLPALLALPFPLLYPLPALLALLAAWGVARLALLRLGGLNGDVLGAGIALAEL
                     SALLSYALWRSLSG"
     gene            166868..167431
                     /locus_tag="TCCBUS3UF1_RS00745"
                     /old_locus_tag="TCCBUS3UF1_1530"
     CDS             166868..167431
                     /locus_tag="TCCBUS3UF1_RS00745"
                     /old_locus_tag="TCCBUS3UF1_1530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cob(I)alamin adenolsyltransferase/cobinamide
                     ATP-dependent adenolsyltransferase"
                     /protein_id="WP_041433623.1"
                     /db_xref="GI:752794191"
                     /translation="MEEPKRVKPYRKPEGERRGLLLVYTGEGKGKSTAAFGLALRAHG
                     RGLRVRIFQFLKHQGARFGEHRAFALLGVPVEGLGDGFTWRSRDLEATAGLAREGWAR
                     AKGVLLSGEADLVVLDEATYPLRYGWIPLEEFLEALKARPRHVHLVVTGRGAPEALVA
                     LADTVTEMRKVKHAFDQGVPAQRGMEH"
     gene            complement(167496..169415)
                     /locus_tag="TCCBUS3UF1_RS00750"
                     /old_locus_tag="TCCBUS3UF1_1540"
     CDS             complement(167496..169415)
                     /locus_tag="TCCBUS3UF1_RS00750"
                     /old_locus_tag="TCCBUS3UF1_1540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514572.1"
                     /db_xref="GI:504327470"
                     /translation="MSRKGIALVIALATLVVVSGIGTLLFVRTLGEIRHSGQDQGIVQ
                     TLMLARGAANVGGTFLSTTGRDRLNTIVRNTASNTACWAYGGNANCQSGQTPDPVAVA
                     QALGTVASQLQSQVDGSLCPNGTPRNLAPSGLNANVTLRLHFTATACGQGLPPGTQLP
                     AGRFVDGSPRTAGASNTAQTYALPFVMVAQAEMGPYRRNVVLQGEYRFTVGRASFARW
                     ALFTHIHTLPDGTDVWFTERTLFDGPVHTNSHLRLYRRPWFGGEVTSAGCTNPGDSSC
                     SGQTRAGAYFYGVNGGNLVLATNMQPSASAPSYTNTFGTHAPEFTAGVDWNAPFIPLP
                     QNNQDQRSAAQSGGLYFQRTITNLRLERKCIENLTGLEVTCALPLPVGVSKFQYITVT
                     YCANNNCNQTATEIYRYGPDLKLYQRVTQGNTTTWQPVRRNNNDVYFNGVIFSDGEIQ
                     NLSGPSRTNANDPNTAGPALAEFAQITVAANNTIQITGDLKYENPPCSGTPTRNPNGT
                     VNPASCDNLSAENVLGIFSQNGDVLIDQGAPRDLHIHGTLMSARGVVQVENYNSIANK
                     GNVYLIGGIIERFYGAFGTFNPQTGQNNTGYGRAFTYDRRFLQGLAPPFFPTTGVDQV
                     MGVSVFSYGQREQVY"
     gene            complement(169427..170335)
                     /locus_tag="TCCBUS3UF1_RS00755"
                     /old_locus_tag="TCCBUS3UF1_1550"
     CDS             complement(169427..170335)
                     /locus_tag="TCCBUS3UF1_RS00755"
                     /old_locus_tag="TCCBUS3UF1_1550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514573.1"
                     /db_xref="GI:504327471"
                     /translation="MRAKGLGNRGLSLVEVLLALTIFGIVMAIAYGSVVQFMQTRSDL
                     DATVSAQAKLRRIVEVFTQDLRSAVFGGLASTPYPTGRNSISFALIDGGAGYPVLPHD
                     SGNNNSFKQAAEVKILALATQASQIGINRGDYVLMVNRNGDGVILPVTGVNAVGGQAN
                     RWHVVHAGCGNTIDYTPNTLLFRVRTVGLTYDPATKQLSYREGSGNPLPMAFDLTGFR
                     IDYVYEAGSQDVLVNPGPYNYGAPSASPPYQFTAAGKTYTLKRLSLTLSAGFASRGRT
                     FERTYTSQVELSSNTQYQVKRIIPCQ"
     gene            complement(170352..170840)
                     /locus_tag="TCCBUS3UF1_RS00760"
                     /old_locus_tag="TCCBUS3UF1_1560"
     CDS             complement(170352..170840)
                     /locus_tag="TCCBUS3UF1_RS00760"
                     /old_locus_tag="TCCBUS3UF1_1560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein"
                     /protein_id="WP_014514574.1"
                     /db_xref="GI:504327472"
                     /translation="MKRGGFFRKGLTLVEVLIAITVLSLVLLALNALLVSSLRHTSIS
                     GARTQAVQILNYVGRRIVGGETLLLPGSTPLNYGYGSLRQNFPDLPQEVRFANPDLYR
                     VAISNLGTPTWASSLGVGVNEYRILVCWRQGGREHCAEGRTFSAPPSTASPSTPPLEG
                     IN"
     gene            complement(170837..171274)
                     /locus_tag="TCCBUS3UF1_RS00765"
     CDS             complement(170837..171274)
                     /locus_tag="TCCBUS3UF1_RS00765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011174485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilin"
                     /protein_id="WP_041433625.1"
                     /db_xref="GI:752794193"
                     /translation="MKTKGFTVTELLVVLVILAVIFTIAAFNGRRTLLGQEQTAFLRT
                     VQGLFWQGATEAASRGAELSLVRQGNRLQLRLGSQTLRTVDIPQGVNLSLPQGTVVRF
                     SPPGKLLDAQGQNLSSPLSFTISIGQRTYAYTVSLIGEVKGAP"
     gene            171819..>172646
                     /locus_tag="TCCBUS3UF1_RS00770"
                     /old_locus_tag="TCCBUS3UF1_1580"
     CDS             171819..>172646
                     /locus_tag="TCCBUS3UF1_RS00770"
                     /old_locus_tag="TCCBUS3UF1_1580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018466649.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433918.1"
                     /db_xref="GI:752794487"
                     /translation="MGIPALEQAGRRVALPTHKLLALLAYLALEGPTARTKLAGLLWS
                     EQDEAGARANLRRELNRLRHTPVAAVLRTEGGWLALEPLETDVEAFRASVEHGDLQAA
                     LSLYQGPLLEGLDLPGATGFADWLEGRREGLAQLWREALHRQAQRLEAAHDLRGALAS
                     RLTLLREDELQEFHHREAMRLQALLGEREAALARFARLKELLRCELHLEPLPETLELV
                     RQIQEGTLNPVRLPPVREVIGVVSRVPFVGREQEWAQMEAAWRAQQAIYVSGPGRVRI
                     "
     gene            172662..173882
                     /locus_tag="TCCBUS3UF1_RS00775"
                     /old_locus_tag="TCCBUS3UF1_1590"
     CDS             172662..173882
                     /locus_tag="TCCBUS3UF1_RS00775"
                     /old_locus_tag="TCCBUS3UF1_1590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514494.1"
                     /db_xref="GI:504327392"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     gene            173925..176567
                     /locus_tag="TCCBUS3UF1_RS00780"
                     /old_locus_tag="TCCBUS3UF1_1600"
     CDS             173925..176567
                     /locus_tag="TCCBUS3UF1_RS00780"
                     /old_locus_tag="TCCBUS3UF1_1600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514577.1"
                     /db_xref="GI:504327475"
                     /translation="MEFAQRQGPMFFLRADPSDGGIPYAFYTRGLRESLGQFPALELP
                     LWARREVSRLLPELGEGSLAPASGLEGKVRLLEAITEVIRALGRQGVRSVVADDLHFV
                     RDAASLEAATYAMARLLPEGMLRPLVAFRPEELDPAFLRAIREQVEGGKAILLELKPL
                     SETDLLRLVRALSGSSGATRFTQRLYQATGGNPLFVLETLKALFESGALQVGPEGWHT
                     PYDQETTDYRELPLPASVREAVWRRIEGLGAAPRRLLEAASLAGDGFSLEVLRGATAL
                     SEWESLEALEQALAADLLRRQDAGYAFSHELVRRSVREGLGPERRRLLHRKMAQSLAR
                     QGGSPARVAEHWEEGGRPQEAIPWRLRAALAAVRVYAHREALEQYQLALSDGAEGKVA
                     YEIERERARLWQTLDERTPWAEALGAMERLAQELGEAALQAETRLGWAEHHLLCGRYK
                     EALAEAEGVGQSGPLAAPLQAKALYLGGRALGAMGELGAAEARLLQAQVLLPAEPLTL
                     EVYDWLSIFAYRQGKLEAALGYTEAERALAQKLGNRTGQNNALQNAATFTAAQGRYQE
                     AVQLAERAIAEAREMGDITLLRYALLNLFAIHYQRSNFEAALGPLEEGLQMAREPQNP
                     EMEAKFLNNLSLVHWYRGALGEAYRAVSRALELSQRSGHRADALFYQVVLADDLHWLG
                     QPAEARRLLEAAVRSIQELGLWGRLPWAETHLARCEVSLGQPEQALKRLGRLRQEPHL
                     ADSLNPPRVAWVEGLAWLRLDQPARALQAVQDTHSDDPTTTSQLWSVRLWAQARLGQV
                     SQDDLQAGLKFLQAPEIPPLEKLALRQAVTAALRARGNLRQAQEQQRLCEQALRALCE
                     SLEGYPLLKEACRKAYGLYPGSPS"
     gene            176871..179282
                     /locus_tag="TCCBUS3UF1_RS00785"
                     /old_locus_tag="TCCBUS3UF1_1620"
     CDS             176871..179282
                     /locus_tag="TCCBUS3UF1_RS00785"
                     /old_locus_tag="TCCBUS3UF1_1620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C1"
                     /protein_id="WP_014514579.1"
                     /db_xref="GI:504327477"
                     /translation="MKPKLMLALFLGILGACTSPSPQGGPVGPDIQEFLTVGGYPAVR
                     LGNGEVKRLDKPEETAWYLDRFPPPATPGLAQVGPQNLPLAVDLTPYQTPVKDQGGRG
                     TCTAFAVVGALEAAYKRAYNLTLDLSEEFLNWQDKVNVLDTQSPPVPPSQSENFLAVW
                     GGGSVNYKLQSILNGERGIPLENQAPYNGQESFGDSGQWLPPITRNSPQRSMGEANLS
                     QRSQTYRIPFPLDWLMLPQLALEEGRYRVNQAVFAGGSQLTNPEWFKAQLAAGREVAF
                     GVRIPNNGKGVKGGIWMPGDMDWGDHAMLMVGYDDSKQAFRVKNSWGTSWNEGGYVWM
                     SYEFVRRGKVYEAASILSVMPPNFAVYTPQLFFGRYLLSHDGWRGVLDIYHIPNPSLF
                     RFQNDTDRRLGTYYGADGMARRVNGVIHGRQIDFYLDWGNTVARSYGELSGMRFTGFL
                     ADDNRTLAGTLDDGSGTTQGFYAVKLRDYLSGTPGGSLGLSAYLGNWQIDGLDVTAGS
                     FSITAVNPSTGQVTGTVFGGDPLVGTVSPTQPRRFTFQLGGQSYEGYMLALDPGVMAG
                     KVGSSKGFIATRRDFSAPQVSIQSPQSGATLYRTQTYTLSGQARGDNGSGFIVDLPCR
                     WASSDAGDTQFPLQGSCNPTFTLRPGSPASVTFTLSATAQGGASAQTSVTVNVQNPPN
                     SGPPSVSIIEPASGSSASVGSTVTLGGRAVGGTPPYRNYRWSWQASKPGCAEIDISVR
                     ALPNQPIGGGQYWEWNTAGAQNIPNGCGFDNAGGTLRLYVTDDLNLTGSASIAFRLFY
                     VPPPN"
     gene            179578..179835
                     /locus_tag="TCCBUS3UF1_RS00790"
     CDS             179578..179835
                     /locus_tag="TCCBUS3UF1_RS00790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013012421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433919.1"
                     /db_xref="GI:752794488"
                     /translation="MQYFRSSPEGAKDWLGKIRKGAPSWVGLQVGDEAGLFRGDQSQP
                     GFNLAFRYREYAFLLTNSSVNDPESYRKWALAVIERVQKFK"
     gene            179884..180567
                     /locus_tag="TCCBUS3UF1_RS00795"
                     /old_locus_tag="TCCBUS3UF1_1640"
     CDS             179884..180567
                     /locus_tag="TCCBUS3UF1_RS00795"
                     /old_locus_tag="TCCBUS3UF1_1640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514581.1"
                     /db_xref="GI:504327479"
                     /translation="MNKLWQTILVLALGLSLLALAQSAQRLILNGQVASTRVIVVQGV
                     AYVPLADVAKALGQTVVKVQGGYEIRAAGGANQLMGQFQGKVGDQILTGLFRVQVQKV
                     ERMESYTTRFDGGNRAIQPNNAQEELVVVTGVLKNAKQSGTVAPSLGTNNPGNTALAG
                     ADGRSFPPIAYDSPAGVNVGGGFTLLPGAALNFAVIFSVPRGTEAKALVLRVGEYGEV
                     GSKDVRVAF"
     gene            180624..181607
                     /locus_tag="TCCBUS3UF1_RS00800"
                     /old_locus_tag="TCCBUS3UF1_1650"
     CDS             180624..181607
                     /locus_tag="TCCBUS3UF1_RS00800"
                     /old_locus_tag="TCCBUS3UF1_1650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_041433627.1"
                     /db_xref="GI:752794195"
                     /translation="MRAMVLRRVGEPLALEDLSLPRPGPGEVLLKVEACGVCRTDQHI
                     ADGELPPPRLPLVLGHQVVGRVAALGEGVEGIPLGARRGVGWLGGTCGACKFCRRGQE
                     NLCPQAEFTGYGRDGGYAEYTLARAAFTYPLPEGLPAEGLAPWLCAGLIGYRAYRMVR
                     DREVLGLYGFGAAAHLLLQVARHEGKRVYAFVRPGDEAAKAFARELGAVWAGDSTEDP
                     PEPLEGALIFAPVGELVPKALADTEPGGVVVLGGIHMSPIPSMPYRLLWGERTLRSVA
                     NLTREDARAFLEVAPKVPVRAEVEVFPLEEANRALEALRGGGLRGAAVLVP"
     gene            complement(181689..181877)
                     /locus_tag="TCCBUS3UF1_RS00805"
                     /old_locus_tag="TCCBUS3UF1_1660"
     CDS             complement(181689..181877)
                     /locus_tag="TCCBUS3UF1_RS00805"
                     /old_locus_tag="TCCBUS3UF1_1660"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514583.1"
                     /db_xref="GI:504327481"
                     /translation="MASKPRSSYREFWLALLGALFGVWLYELQKEGGWQGIWRGIWPG
                     ILFFAGGVALVLYAYRKR"
     gene            <182693..183673
                     /locus_tag="TCCBUS3UF1_RS00810"
     CDS             <182693..183673
                     /locus_tag="TCCBUS3UF1_RS00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016328525.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433920.1"
                     /db_xref="GI:752794489"
                     /translation="LEELLRYLGLDAGFLFGLAEGVLVPWVAAGEFPKGYPELYRRFP
                     VVLGEGATRALEGGKAFALIPDYQEYPHALPPMKQAGLRTVLLIRLERGDSPYGVLVL
                     ASFRRPRDVPPEAQTFLLVARGELEAHLERRLQVEGTLEAIAAILERLDYETEGHMRR
                     VSELAVLLGERAGVKDLEGLRMGAYLHDLGKLFIPREILEKDAPLVTQEWRVVKTHPE
                     AGHEVLSRIPFLPQTALEVVLHHHEHWDGTGYPLGLKGEAIPLAARVFAVVDVWDALR
                     SARPYKPAYPEEEAMAELLAMAGRKLDPRLVELFLLLVREKVLTGKEKRR"
     gene            183670..183894
                     /locus_tag="TCCBUS3UF1_RS00815"
                     /old_locus_tag="TCCBUS3UF1_1690"
     CDS             183670..183894
                     /locus_tag="TCCBUS3UF1_RS00815"
                     /old_locus_tag="TCCBUS3UF1_1690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514586.1"
                     /db_xref="GI:504327484"
                     /translation="MKGETLEIFLDTPELPEAQREALARELQAAVERHLPGRPVRLLS
                     GVDGQGRRWLRLVIEMEPGRSLEAPKEVRG"
     gene            <184068..>185045
                     /locus_tag="TCCBUS3UF1_RS00820"
     CDS             <184068..>185045
                     /locus_tag="TCCBUS3UF1_RS00820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010459988.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433921.1"
                     /db_xref="GI:752794490"
                     /translation="GALLPLYGLNWFGLETCDRAPHGLWAGRSVGEFLAQVRGLGFNA
                     LRLPVSPEVLRDQGQVAPWARTGDPGYPQSPLAGLRYVLERAQGLGFHVLLDLHTFRC
                     DLIGGSLPGRPFDPARGYTRGDWHADLRRLARLSLEFPNVFAIDLFNEPHGLTWSEWK
                     ALVQEAAQEVLKVNPRILVAVEGVGNLSDHGGYPAFWGGNLKEATDDLGLGDRLLYLP
                     HVYGPSVHAMPYFSHPGFPENLPPIWDLHFGHLSGRGLPWGVGEFGGRYTGQDQVWQD
                     RFALYLRQKGVKVWFYWALNPNSGDTGGILQDDWRTPVAGKVNLLKGLMG"
     gene            186893..187381
                     /locus_tag="TCCBUS3UF1_RS00825"
                     /old_locus_tag="TCCBUS3UF1_1720"
     CDS             186893..187381
                     /locus_tag="TCCBUS3UF1_RS00825"
                     /old_locus_tag="TCCBUS3UF1_1720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514589.1"
                     /db_xref="GI:504327487"
                     /translation="MRKALVPALFLALLVALAQALNLDLRPYLVKAVEGKETYEENPL
                     GVRPGDLLEWRLLAENRSQGALRQVALVIPIPKETRYLEGTAKPLSLGSATIRPEFSF
                     DGGKTFGFPPLKKRIRVVENGKEVEKEVEVKPEEYTHARWVLPEMPKGARVQVSLRTV
                     VK"
     gene            187398..190064
                     /locus_tag="TCCBUS3UF1_RS00830"
                     /old_locus_tag="TCCBUS3UF1_1730"
     CDS             187398..190064
                     /locus_tag="TCCBUS3UF1_RS00830"
                     /old_locus_tag="TCCBUS3UF1_1730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514590.1"
                     /db_xref="GI:504327488"
                     /translation="MKRIHVGFLLVVLMGLALAAGTPAGTAITNQATATYIDSAGQPR
                     TTTSNLVTTIVQQVYSFTITPDGNNEGNPGQVRSGLPGSQVLFNYRVRNNGNGTDTIN
                     LSIAQGTSDNFDLQNVRIHLDANCNGNVDAGEGQVTQVTLPADGEACLVVAAVIPSGA
                     TSGQYGNLNLVGTSQGNASVVDNNNWARAVATAQAALTAFKAATPSGSVAPGTPITYT
                     ISGANTGGSGAYGYPVTVDSTSRTGILIEDVIPNGLRVTAMPTGSAGAGTVRFVYNTG
                     SGWSTLTSSNLPLTGNGTVRIGMLIEGSGPFFPQGAQYTFSFQAQVPSGVPAGTSYSN
                     FAVVRFDANGDGDADDPGETVTTNTTTNTVGAAYAVQVGPYGYPLGNGTGTYLVGAYT
                     ITRNADQQTVSAVYSGTTVIFRHTLRNTGNTADSFTLSPSGQPSGWACQLVADDLATP
                     ISGPVGPVAAGADLNFALRCQVPAGYTSASAINITVTATSVGDPSKWDATQDTVTQVL
                     LGYGVDLAARGRAGDNDQSNDNPPAQSANPGQAAYFPLEVYNAGQNPDVYNLAASLPS
                     GWSAIFYPDANCDGMPDGAPITNTALLNPGAKQCVVAAVSVPAGTAPGSNPVGFTATS
                     TTLPGVSDVVSSTVTVNLVAQVTLDPDRSGTVTSPGTLVYTHTLTNSSNAPAYCDISG
                     NGGAHGWTYQYSTDGSNWYGALTDVYVAPNGGTATIYVRLQVPAGQPVGRTDVNTVTA
                     NCDVTTGTPDNVYEATDTATETTTIVGGELRLQKTVDKSTAYPGDVLTYTVTAENIGT
                     GNLKEVKISDPLPHHTTFVSISATATGFPAGATILYSTDGTTWSSTPPTSLPAGGVVY
                     VGVDTDGDGNITSADFMLPAAKVTITLKVQVQ"
     gene            190219..192876
                     /locus_tag="TCCBUS3UF1_RS00835"
                     /old_locus_tag="TCCBUS3UF1_1740"
     CDS             190219..192876
                     /locus_tag="TCCBUS3UF1_RS00835"
                     /old_locus_tag="TCCBUS3UF1_1740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011229123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433922.1"
                     /db_xref="GI:752794491"
                     /translation="MWPKSFGALLWLLSIAFALTPAGTVIRNQAVAYAGGERYLSNEV
                     EVLVRPLCVPLLSPDGTTALPGQEAGVSPGGYAYLPFLLTNGGNDRFSLRLSHLFGPR
                     DWNPEEVHLYPDRDGDALPDPGASPLAEVSLAMGESLRLVLRVKAPSGASGALLLSPV
                     ASCPEGQEDRDNWARVVVQPGPVLALQKGMPLEALPGQEVLVVLRVRNLGDREAQGVV
                     ATDAPLPLPFVPSSASAPKGRVEYWDGALWAPSEPSGVRGVRLVLERLGVGEEAFLAF
                     RLLVPPGTPPGFVENLARAEGPGGPVEARASLRVLPLYAHHLGPRGNPRALPGGEGSP
                     DDRQAQRGLEGQTLCFAHTLENAGTGQDTYDLRVEGLPQGVDFWWEGPTGTPLGLPLT
                     LSPGESRDFSLCLRPSAPMGFTARVVATSRATGASNATWDLLEVLPASALTLWKEADP
                     PSGTTLRPGQEVVYTLRIQNAFAPLRGARVEDALSPWLEFVEASHGGLWDPTRRLVVW
                     NLDPLPLGETRLTLRVRVREDTPDDTLVQNAFSLRAQDLTQPILSPPTRHPVFGVRLL
                     LRKEVSPKSARVGDLLLYRLTLENPSPSLLTVRLRDLPPPGTAYEPGTAFLGCGASKL
                     PLEPKVQEGLLLWEGLELPGRGRICLEYKLRLLPGAPEELVNTAEAQGLSANGAATAS
                     GRAQALARLDLGPFALGGVLLGRVFLDLDGDGVFGKGDLPLPGARILLSNGTQALTDA
                     MGRYAFRNLSGLHQVMLDPDSAPFAPLPLPEGLGEGYRKRVLVQGATVADFPLRVPKG
                     YVRVLRATTLRMGPLSVEKRVVEVAGKALAELRVRSLEALPELTLRDPLPGGGERVFA
                     FGLFQGEEVLAYPLERPILTDPEVRWRYP"
     gene            <192858..197318
                     /locus_tag="TCCBUS3UF1_RS00840"
                     /old_locus_tag="TCCBUS3UF1_1750"
     CDS             <192858..197318
                     /locus_tag="TCCBUS3UF1_RS00840"
                     /old_locus_tag="TCCBUS3UF1_1750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514592.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433923.1"
                     /db_xref="GI:752794492"
                     /translation="ALEVSMRFGLVLLLAFLLIQGVVGASEAPKAELRVRVFLDLPGG
                     ERPGEGLLRAGGEERRVVGETVLALAPGRYPLAFLVEGAEVEGPSEVVLAPGERREVV
                     YRLRPRVELVLTPPSQRLPEGEEARFLLRATTDYPGLLPGELALELPEGLEALSPTRL
                     VGVLSRGRPAELSVAVRGPVGQYQVRGVLAPYGLVRAAGVEFYRKATFALRKEALTPR
                     VERGGEARFRLTVANQGDEAGRVRLRDLGGEGLEGPGLDQEVYLEAGQARSYEVAFRV
                     VGEGVAVNRAELLGPEGVVARAEARVEVLLPKPLLARELPFRRYLPGEAVEHRLVVRN
                     LGQAPLRYVLEDTCPDFLEPSGARFEGTLPPGGETVHTYRAQVRFGLEAEGVCQALLR
                     HQGEGVRAEVPLARVLLDLRKEVSPQRILEGSEATFLLKVHNPADHPVRVRLLDTPPK
                     GLPMEGLAWEGLLEAGEVRIFPLKASGVPAGLHVNRASAFVGEVPAAFPAEASLAALP
                     LLLPERLSEMALPFRVEGRGEELLLAFSLPEGAEYVPGSARILREGSLLPLADPLFLQ
                     EGGRLYWRLPFQGEGEVRFLLRHREALPPLAEPGLTLLASGREVPLQGAASLAEYRRA
                     KPLKGERQGAIREPQDGQVFQDQGAIRVVVEAPLGPLVLRVNGEPVGQDRLGKAELDE
                     GRGWQRLEYYGVPLRVGRNLLEVEGVAQDRLEVFRAGNPVRLRLTLVEAKTDGRTPLR
                     VLVEALDENGLPSGFGPLSVETDLEPLNPDAFLALSGYQILLKDGRGELLLRPLVAPR
                     EFYVRVGFNRLEAQSRFFAGEGAKGLWLAQGSVGVALRDPGAGLRLENLHPFGLARAY
                     AEGPFLGGQAQGALDTAGGLGQKLTQERFPVTGAAAEPKRPLTSDDPIAFRYDQPGFT
                     LAYERAPLGASLPEATALRLSTRGEARLEGFLALLPRGIVRETIRPDGTSFYRLSQPP
                     RPGSLTLTLVEGSKETRLEAGRDYAVDDLGNLQLARPLFPTTPDLAPVYLVAEYAPQN
                     APRDLLAYGLGAAYEGGGWRFGLSAAYLGAWRYGAELGYQEGTDRLGIRAGYAEGRLS
                     LALGAEARLGAFRLRGDLRSEDLAQGVRGLQGEARLAYEEGSLGVALEQTTPAQTAFL
                     LEYRTRPFSLGAGLGYLWTEGALALLGRAGYEEGGRRLLLTHTQALGPAKAITRLDAG
                     LPLDPNLGLEAGLAYTWGEGFGGTVALKQRFQGANLALSYELPTASGQGNRARFGVEA
                     PLPLDERWSLNLSAGAERSFARGEGLTSFGLAARYKAEEFSATLGAETAFAQETKLVL
                     KGGAAGSLDPENTLSADFAYQVLPRPQGRFTLAYALFAPQANLLTYHRLLWEGEPVLE
                     GEALFAYHQPGFQLRPGLAYRVKPQDPAANTFQVGLGGNLYLTERFGLGAALYYVFQP
                     ATGRSRLAPSAEFSLRALEGLWLNLGYGFGESLLQPEGLYLRLDLFGGSR"
     gene            197843..198934
                     /locus_tag="TCCBUS3UF1_RS00845"
                     /old_locus_tag="TCCBUS3UF1_1760"
     CDS             197843..198934
                     /locus_tag="TCCBUS3UF1_RS00845"
                     /old_locus_tag="TCCBUS3UF1_1760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514485.1"
                     /db_xref="GI:504327383"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     gene            <200735..>202081
                     /locus_tag="TCCBUS3UF1_RS00850"
     CDS             <200735..>202081
                     /locus_tag="TCCBUS3UF1_RS00850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011229121.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433924.1"
                     /db_xref="GI:752794493"
                     /translation="TDEVAGRITSVGRNNNGFTVAGFVYHDRQPNGMRDPAEDWSDGA
                     TIWVKLVQGSTVVATAQVDPGSGAFGFQGVMPGSYTLLVDNNSSTSDLTPTPPSGWLF
                     VTPPGGSLSVNVSGNVQGLLFGLFQGSLVEGRVFWDDGLGGGVANDALQNGGEGGVGG
                     VEVRATDGANLRTALTDGAGFYRLYLPASWGSVVLSHPLRPATGWNDGSVAQRVTSWS
                     QAASPSSPGAQVALGAASNLAGSTLVRNFGAVRESRLYPDGSGQTGSPGVYTFAHSYR
                     PGTLGSVVFSLASPPRYAYQVRLDANCNGSFDPGEGWTPFPASLAVGPTWPREPDGSL
                     RACALEVRALVPAGEPQGAVDVALVQATLTWANLASVQEVDGLTDTLQVVGGEVRLSK
                     RVRNVTQGTPLGTTGQGRPGDILEYCIAYRNLGTSPVGSFTLTDPVPFFTNPESSVG"
     gene            complement(202271..203062)
                     /locus_tag="TCCBUS3UF1_RS00855"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(203059..203871)
                     /locus_tag="TCCBUS3UF1_RS00860"
                     /old_locus_tag="TCCBUS3UF1_1800"
     CDS             complement(203059..203871)
                     /locus_tag="TCCBUS3UF1_RS00860"
                     /old_locus_tag="TCCBUS3UF1_1800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="WP_014514596.1"
                     /db_xref="GI:504327494"
                     /translation="MGRRLLPHLLLLLAAGLTLLPFAYQVGLSLTPPQALFTSPWPFA
                     HPLTLENYRVVLEKLPWARYTLNTLAFALGSALGQVLLGVLAGYAFAFRRPPLGGFFL
                     GLFVLSMLVPFVVTYLPSYLLVARLGLLNTFPGLILPMLTAGYAAFLLRQHFLGFPRE
                     ILEAAIVDGAGTKDLLLRVLLPANRPTLLALFLTLFIGAWNQFVWPMLVANRPEMYVL
                     TVAVQRFAGGEGSNAWGPLMAASVLATLPTLVLFLLFHRRILETLMEGGVRG"
     gene            complement(203864..204781)
                     /locus_tag="TCCBUS3UF1_RS00865"
                     /old_locus_tag="TCCBUS3UF1_1810"
     CDS             complement(203864..204781)
                     /locus_tag="TCCBUS3UF1_RS00865"
                     /old_locus_tag="TCCBUS3UF1_1810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Glycerol-3-phosphate ABC transporter permease"
                     /protein_id="WP_014514597.1"
                     /db_xref="GI:504327495"
                     /translation="MQGVGAARGLGQGGRRRQADLEALLLLAPGLLLLLVFVYWPLLY
                     NLWLSLHDWNLVRPKAEFVGLANYRLLLQDPLFGQLLRQSLLYMGLALLGNFLLPLGL
                     ALLTLQVKGRWAELYQALLFAPTVAAVSVAALVWLYLYLPAAGPLAKGLAALGLPAPN
                     FLADPRYALPAIALVANWKFLGFHYLIALAGLKALPREVLEAARVDGAQGWPLLRHVL
                     LPLLFPTLLFLLLSALASALDYAFVPVEVMTQGGPFGHTSHLMYAVYQEAFRFFRAGV
                     AAAQAVLLTLGLGALILGQLYLLGRRGYG"
     gene            complement(204769..206040)
                     /locus_tag="TCCBUS3UF1_RS00870"
                     /old_locus_tag="TCCBUS3UF1_1820"
     CDS             complement(204769..206040)
                     /locus_tag="TCCBUS3UF1_RS00870"
                     /old_locus_tag="TCCBUS3UF1_1820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041433630.1"
                     /db_xref="GI:752794198"
                     /translation="MKGLLGFVVAAGLSLAQAPITLQYWHINTEVFGLPALRELIREF
                     ERRNPGIKVEERYNPNAYTGLLQNLQAALAAGNPPDVVQMGYLYTRYAAKNLPYVPID
                     ELAKRYGGERHLRRFAPNVLALGQVDGVLVGMPYSLSNIVAYYNADLFRRAGLDPDRP
                     PATWEGWRRAARQIKERTGKYGIYLILLDDNWAVEALIRSNGGTLLRCEGGFFRTGLD
                     SKEAAEALGMWAGLVREGLALGVPLQQGEQAFLAGEAASFMTTIARRAGLQEQTRGRF
                     ELRATRFPTFGGKPPALPSGGNVLMVFSQDPKRQEAAWKFIQFLTSPEGFTLWTKGTG
                     YVPLLPELIRDPRYLKDFVEKNPIQRVAVEQLPFTAPWTGFPGPNGLAASQTLFRAVQ
                     KALAGQATPEAALKEAAAEINRLIGTERCRE"
     gene            206110..206493
                     /locus_tag="TCCBUS3UF1_RS00875"
                     /old_locus_tag="TCCBUS3UF1_1830"
     CDS             206110..206493
                     /locus_tag="TCCBUS3UF1_RS00875"
                     /old_locus_tag="TCCBUS3UF1_1830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_014514599.1"
                     /db_xref="GI:504327497"
                     /translation="MNRARDWLEQARHNLGHAQRSLDLGDYAWACFAAQQSAEAALKG
                     LHLSKGQVAWGHSILDLLSGLPEGVEPPEALLEAAKVLDKYYIPTRYPDAHPAGPAAR
                     HYTRLEAQEALRLAEEILRFVEARM"
     gene            206490..206894
                     /locus_tag="TCCBUS3UF1_RS00880"
                     /old_locus_tag="TCCBUS3UF1_1840"
     CDS             206490..206894
                     /locus_tag="TCCBUS3UF1_RS00880"
                     /old_locus_tag="TCCBUS3UF1_1840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_014514600.1"
                     /db_xref="GI:504327498"
                     /translation="MTRIFPFDPKARLEEVRRAAQSLQEWPEVLGVVLFGSLARGEAT
                     AFSDADLLVLLAHTPLPFPERLLRYRPQGVRGVEVFPYTLEEVRQSLRGAWGLAPVAL
                     REGVVLWEREGALRALAAELGDAILGGSAGGG"
     gene            complement(206863..207771)
                     /locus_tag="TCCBUS3UF1_RS00885"
                     /old_locus_tag="TCCBUS3UF1_1850"
     CDS             complement(206863..207771)
                     /locus_tag="TCCBUS3UF1_RS00885"
                     /old_locus_tag="TCCBUS3UF1_1850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_041433632.1"
                     /db_xref="GI:752794200"
                     /translation="MVRLEGLSKRYPRGGGVEGVDLEVGEGEVLVLLGASGSGKTTLL
                     HLVAGLLLPDRGRVYLGGKEVTHLPPERRQVGYVFQDQALWPHLTALEHLLLVMPRPD
                     RKEALALLERVGLLDHAGKRPGELSGGQRQRVGLARALARRPKVLLLDEPYSALDPVL
                     REELRLEVRVLLKEMGTTALHVTHDPEEAMLLADRVGVMAEGRLLQVGSPEEVYEAPG
                     SLAAFLALGRANLLPQDGEVLAFRQEWVREGGEVEALVLERRTLRGEVLCRVHLPWGE
                     AWVRLEARPGERVGLGFTRLLRFPQG"
     gene            complement(207765..209198)
                     /locus_tag="TCCBUS3UF1_RS00890"
                     /old_locus_tag="TCCBUS3UF1_1860"
     CDS             complement(207765..209198)
                     /locus_tag="TCCBUS3UF1_RS00890"
                     /old_locus_tag="TCCBUS3UF1_1860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041433925.1"
                     /db_xref="GI:752794494"
                     /translation="MFLWGLALALALPLFLLFLRGLPTFPRTLQDLDVVLQSLALAGA
                     GTLLTLLLALALAAWGLLGRVGRGWEGLLLLGYLVPPFVTGMGVLFSLEGIGMEAYGA
                     PGILLAWTLHYTPLAYLLLKPQVRVALGLLGAARVHGVVGVRALRVFLPPLLPPLLAA
                     GGALYLALLGNFGVPAVLGLPERVYVLPTLAYARLMSPLAQDPLGEAAALGIWLALLA
                     LPALLLSRPPLLEAQEPLLPPPRPIYRHLFALYALLALALTLLGLVREALQNPYTGAL
                     DPAFGEALALPLVQRGLRNSLLLALATTGLLLLLALALRPFPQALGRLRRVLDLHYLL
                     PGTLLGLGLILLLGPTPLYGTPWILFLAYLLNFAALALRALEGSVRVEGAVWAGRVHG
                     LGAWRAWLRLGYPLLLPSAFAGFFLIFPLAFAEITLSALLYAPGAETVGVAVLSALNG
                     GLYREAAALGLLLMALSATTLLGRPRW"
     gene            complement(209219..210163)
                     /locus_tag="TCCBUS3UF1_RS00895"
                     /old_locus_tag="TCCBUS3UF1_1870"
     CDS             complement(209219..210163)
                     /locus_tag="TCCBUS3UF1_RS00895"
                     /old_locus_tag="TCCBUS3UF1_1870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514603.1"
                     /db_xref="GI:504327501"
                     /translation="MKGKSVLTLALLVGSALAQGTLTLYTSEVLADVNALVEAFRARN
                     PGVQVQVFRSGTGEVVAKLRAELEAGNPQPDLLWFANEDFLKELGAKGLLRRVPPTVP
                     GYPVQYAPGGGLYHEVRLLYNILAVNTQRVRTPPALWRDLLRPEYRNLLAMPDPNFSG
                     AALATVGTLAERLGMGFFAQLKEQGLRIEQSNPVLQQKLARGEYGLAITTDFGVRQEI
                     ARGAPLAVVYPRDGAILVPTPVAVASWSKNPELAVRFLNFLLSPEAQRIFAERGYYPV
                     MPGAPRPQGAPEQVVGLKARFADSATLERFNTLFGLRR"
     gene            complement(210329..211606)
                     /locus_tag="TCCBUS3UF1_RS00900"
                     /old_locus_tag="TCCBUS3UF1_1880"
     CDS             complement(210329..211606)
                     /locus_tag="TCCBUS3UF1_RS00900"
                     /old_locus_tag="TCCBUS3UF1_1880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514604.1"
                     /db_xref="GI:504327502"
                     /translation="MKNLLPLLTLLAFLGYLASPRGAGQGEATPALELVGWALLPADT
                     FAPGPPSGAYRETPGFRSPSPAFAGQPVQGFSAIQRGPVAGTYWVLSDNGFGSKANSP
                     DYLLRLYLVRPEPKTAQGGEGGVEVLRHVQLRDPLRKVPFPILNEGTRERLLTGYDFD
                     PESFVIGPDGSLWVGDEFGPYLLRFGPDGVLLDPPYPTPDFGQGKDPAKDQVRAPQNP
                     ALLLNPPAPGQAYPANLATSRGFEGMAINPGKTRIYPMLEGAVAGDPPGTLRIYEFDP
                     AARRYLGLAGLYRLEDPAHAIGDIVAVNEEEYLVIERDSRQGDEARFKRVYLVNLKRK
                     DAQGFVSKELLVDLLNLRDPRGLSPFSRGGAYRFPYFTIEAVLPLDGETLLLVNDNNY
                     PATGGRGAGVKDPNEFIWIRLAKPLNLDPALKR"
     gene            211807..212175
                     /locus_tag="TCCBUS3UF1_RS00905"
                     /old_locus_tag="TCCBUS3UF1_1890"
     CDS             211807..212175
                     /locus_tag="TCCBUS3UF1_RS00905"
                     /old_locus_tag="TCCBUS3UF1_1890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514605.1"
                     /db_xref="GI:504327503"
                     /translation="MPELEVSRRFGLVVPDGVLLAREGEGPVEVTEFRFPPDSSYRAY
                     SLEELGERLRAQLEARGFSLRCRTYNALPLFGGPQYTVRLARGAEGVGTFLRPLPQPD
                     AYRVEVAPGDPNPPLGCPAR"
     gene            212320..213555
                     /locus_tag="TCCBUS3UF1_RS00910"
                     /old_locus_tag="TCCBUS3UF1_1900"
     CDS             212320..213555
                     /locus_tag="TCCBUS3UF1_RS00910"
                     /old_locus_tag="TCCBUS3UF1_1900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433926.1"
                     /db_xref="GI:752794495"
                     /translation="MGAQGQAPGAGEVQVVGPYALPPTPIRALNPHLREAEVQEALRR
                     GWPVADRPAIGSGLAYLGGGRFLGLTDRGPNGDCPGGKFFPLPRFAPALVPFRLDEAG
                     RAIRLEAPLLLRTPGGSPLTGLPNREEEDIPFAAADCKEKLPLDPSGVDTEDLAVLPG
                     GKGYLLVEENSPSLLYVDPRGRLLVRYTPEGVRFSARYPVRDILPKVLALRRNNRGLE
                     NLALSGDGKTAWAVLQSPIGSTRDPAYDASLVARAVRLDVSDPERVRVTGMYLVPFSD
                     PKDYPKPNRPRDMKYSAATWVDGEKILLLERAEGGARVYLVDFAQATDLLAHPKGASP
                     ELDRAGTDYAALGIRLAPRRLLLETWRFPAFDTDKLEGLALLEDGRTLAIVDDNDFAI
                     TGKEGPSRAWLVRLAEGLR"
     gene            213571..216987
                     /locus_tag="TCCBUS3UF1_RS00915"
                     /old_locus_tag="TCCBUS3UF1_1910"
     CDS             213571..216987
                     /locus_tag="TCCBUS3UF1_RS00915"
                     /old_locus_tag="TCCBUS3UF1_1910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_014514607.1"
                     /db_xref="GI:504327505"
                     /translation="MRKVGWLWLWTVGLLAACTGQRSSTGGETPVRVLNVPDTVQAVT
                     LEVNGTPYPVAREGEVWTARVRLPQGEHTFIARGLDAPGGIVLYKAHERKRVVPGQEV
                     RLRMYRLTSDLEVEVENPAPGEAYLAKAAGAMAALPGGRGLLQGVPTGRGVSLLVEAR
                     DPSGMLLRQGTAQVDLSETPRSVRVRLGEVAHEPPRVRLVGPVQVERGQAYTLRVEAE
                     DPNPQDRGVVLSRLAVEWGDGAREEVALSGRQAVRELVHTYTASGSYTVSVRVENSAR
                     LAAQESLALAVLEPETPVTIEPGPDLARVALAVTGAPEGTEALLAEITPETPLVPQAL
                     RPLDLRNRYQVALFPQGGAWRGGLHLPRGLGYRLLLRARVGGQEVLSREEAFRTDGAE
                     VVLERPFVPAPEYACPAPGAPLKAAYEVQGRGARSPLEGQTVAVRGVVTAFFPGLQGF
                     FLQDPRGDGDPATSDGLFVYYGNTSLSLTPGQYVQVVGQVAEYAASGDTLGTLTQLRL
                     SGHAVCGEAGLPQAVSLSLPAQDLEALEGMRVRLSGLTVTEVYNLGRFGELTLAPSRL
                     VHPNADGDPATRLDPNTPPYPGHTLVLDDASTRQNPSPIPYLPQGGTLRVGDRLVAAE
                     GVLEWRYGAYRLQPTQAPTFQAANPRPAPPSGPGLRVASFNLYNWFTTLSGTFTPPGC
                     TTPLDRRGATSQQELERQRAKLVAALTALDADVVALQEVQNNGATAIQALVDALNAAL
                     GPGTYAYVPDPEGGLGCDAIKVGFIYKPARVEPVGAPKALQSPTFERYPLAQAFRDKA
                     TGGVFTAVSVHLKSKGGCDPSDPDTGQGCWNRRRTAQAQALAGWVDTLKAVDPDVVVL
                     GDFNAYEEEDPLALLRGRGLVPLLSGHHTYVYMGLSGALDHAYATPSLSAQVRGALAW
                     AINAEEPRVLDYTLANKPDDRFAPDPYRSSDHNPLLLRLELAPDRPPCAGEGARVVIN
                     EFRFRGPSGGNDEFIELFNRSCTPVNLGGWKVQGLSGTGSTWSDRATLANVTLEPGQY
                     YLLANTSSGGYSLGVAPDQTYTTGISDNRAVRLLDAGGQVVDLVGFASSGQFEGQGLA
                     DGPTSSTGLGQISWKRIPSGKDTDNNLQDFQFGQGWANPQNRQSPLYGDN"
     gene            217114..217854
                     /locus_tag="TCCBUS3UF1_RS00920"
                     /old_locus_tag="TCCBUS3UF1_1920"
     CDS             217114..217854
                     /locus_tag="TCCBUS3UF1_RS00920"
                     /old_locus_tag="TCCBUS3UF1_1920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_014514608.1"
                     /db_xref="GI:504327506"
                     /translation="MPLATLRRQNLLELLRQHRGLSTKELARRLGVSEATVRRDLAAL
                     ARQGLLQREHGGAIAPEAEPPYAEKLARNREAKEAIAQRAALLVPDGATVVLDSGTTL
                     LALARLLSGRPLRAIALDLPIAQALAQGETEVLLAGGRVRNGFFSLVGPWAEELLGRV
                     RADLFFLGADAFDPEGVTNHTFEEAAVKRKAMEVSRKTVLLADGSKWGKRAPAFVTPL
                     SALERVITDLEDPTLEALVPVEVVRGAL"
     gene            217841..218641
                     /locus_tag="TCCBUS3UF1_RS00925"
                     /old_locus_tag="TCCBUS3UF1_1930"
     CDS             217841..218641
                     /locus_tag="TCCBUS3UF1_RS00925"
                     /old_locus_tag="TCCBUS3UF1_1930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sgc region protein SgcQ"
                     /protein_id="WP_014514609.1"
                     /db_xref="GI:504327507"
                     /translation="MERFEALFGPKPVIAMVHLRALPGTPLYEGDLEGIVEAARRDLL
                     ALQEAGVDAVMFGNENDRPYQLRVDPASTATMAYVIGRLRGEIRVPFGVDVLWDPLAT
                     MALAAATGAAFAREIFTGVYGSDMGLWQGRAGEALRYRRLLGREDLFLLYNVSAEFAS
                     PLDARTLPERARSAVFSSLADAVLVSGPMTGEGVALEHLRAVKEALPGVPVLANTGVR
                     HETVAEILGVADGVIVGTALKRDGVTWNEVDPERARAFMDRVREARGR"
     gene            218641..220113
                     /locus_tag="TCCBUS3UF1_RS00930"
                     /old_locus_tag="TCCBUS3UF1_1940"
     CDS             218641..220113
                     /locus_tag="TCCBUS3UF1_RS00930"
                     /old_locus_tag="TCCBUS3UF1_1940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate kinase"
                     /protein_id="WP_041433635.1"
                     /db_xref="GI:752794203"
                     /translation="MVLGVDIGTTGVKALLLSEEGRVLAEAEHPHALRAPAPGFAEED
                     PEDWWQGLRATLARLLEGRDKASLRAIGLSGMVPALVLHDGEGRPLRPSLQQNDARAV
                     REIRELEAHFGNQWLFARTGATWNQQVLAPKLLWLRRHEPQAFAQARWISGSYEHLAF
                     RLTGERYQEANWALESGLWDPKAEAWLAEVLAYVGLEPDRLGPVRRPHEGVGEVTGEA
                     ARATGLPKGLPVIAGSADHIAAALASGLKEPGEAVVKLGGAGDFLYAIDRFAPVPELF
                     IDFHDLPGLFVINGCMATTGSLLKWFQGAFRPGVGFAQLDAEAEGIPPGSQGLVVLPY
                     FLGEKTPIHDPEARGTVVGLTLSHTPAHLWRALLEAVAYAFRHHLEVLEARGHRVERL
                     FVMDGGARSPLWRRILASVLERPLERLLGGERGSAYGTAFLAGVAAGLWGFADLRREV
                     AEVTEPEPTWIPPYRELYGVYREVYQRLKDLYPRLGGGYA"
     gene            220106..220876
                     /locus_tag="TCCBUS3UF1_RS00935"
                     /old_locus_tag="TCCBUS3UF1_1950"
     CDS             220106..220876
                     /locus_tag="TCCBUS3UF1_RS00935"
                     /old_locus_tag="TCCBUS3UF1_1950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_014514611.1"
                     /db_xref="GI:504327509"
                     /translation="MPNALVTGAGTGIGRAIAERLVRDGFKVWVTDLKEEWAQEVGEA
                     LGMPHLKVDVTRRTDLEQARERVYAEDGRLDLLVANAGVSTMNPFLDLTEEEWDFNFA
                     VNAKGTFLTLQTFARAMVAQPPMPGRGVRGKLVAIASMAARQAAPLLAHYSASKFAVL
                     GLVQAAAKELAPYRITVNAVNPGFVRTSMQEREVAWEARLRGLTPEEVVQDYLRQTPL
                     GRLEAPEDVAGVVSFLAGPDADFITGEAVEVNGGAWIF"
     gene            220860..221675
                     /locus_tag="TCCBUS3UF1_RS00940"
                     /old_locus_tag="TCCBUS3UF1_1960"
     CDS             220860..221675
                     /locus_tag="TCCBUS3UF1_RS00940"
                     /old_locus_tag="TCCBUS3UF1_1960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514612.1"
                     /db_xref="GI:504327510"
                     /translation="MPGSSRGLRHLAHALLWAYSLAFLLPLLWTLRSALLPEGLAYAL
                     PPAWGPWTLENFAQVLQGPLGKAFRNSLLVAGLVVALGLPLAAGLGYALARHRLGGEP
                     LRFAVLATQMLPPIVLALPLFALFRALGLSGSLWALVLAYLAFALPFMAWLLLGFFQG
                     LPRELLEAAYVDGASPYQAFFRVVLPLSAPGLFAAGVLGFLLSWNEFLFALLLSGRET
                     QTVPVALSALVTQRGVLFAQVAAGVVLSVIPVALLARTVDRYLVEGLTLGAVK"
     gene            221689..222951
                     /locus_tag="TCCBUS3UF1_RS00945"
                     /old_locus_tag="TCCBUS3UF1_1970"
     CDS             221689..222951
                     /locus_tag="TCCBUS3UF1_RS00945"
                     /old_locus_tag="TCCBUS3UF1_1970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514613.1"
                     /db_xref="GI:504327511"
                     /translation="MRRLLAVALALWGLSLAQGVVLRALMEDVPETRIIEALLPEFER
                     ATGIRVEFEKVQYAAMHDKLVAQLLAPESAYDFLQVDFLWAGEFPAAGWLEPLEPFVK
                     ASGFDLTPYYPSMLDLVGYYRGTLYMIPMYNYAMGLIYRKDLLERKDLKGRFQSQFKR
                     PLALPKNLQEYVDLSLFMARNAGVAGAAMQGQRGDPNFMEFSNYLFAAGGDYVDKGGR
                     VVLNSPQGERALTLYVRNLREGAQKGALNANLDDTFRVMCQGGAFSMVTYWWMLPQLN
                     DPKQCPKVAGKVALSPMPGGVGVSGGWGWAIPKNSRNKEAAWRFISWVESKEIVRQRA
                     LQGHAPTRKDAFQDPEVLRKYPYYKEAERILARAKKVPIFAYTAEMEDVVGREISLAA
                     AGQKGVKQALQDAAKGLEALLRKAGLLR"
     gene            222961..223806
                     /locus_tag="TCCBUS3UF1_RS00950"
                     /old_locus_tag="TCCBUS3UF1_1980"
     CDS             222961..223806
                     /locus_tag="TCCBUS3UF1_RS00950"
                     /old_locus_tag="TCCBUS3UF1_1980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012744680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="WP_014514614.1"
                     /db_xref="GI:504327512"
                     /translation="MGERRSAWVLALPGLLLLAGVVGFPLLYALFLSLTGYTFLRPSY
                     ALQGLARYREALADPYFLNALGLTALYLLLTVGLTLALGLLLAVLLHQNLPFRGFHYF
                     AVSLPMLIAPVGVGLIWKMILHPELGILAYLLGGVDFFGEARYALLSLALVDVWQQVS
                     FAALVLLAGLRSLPREPLEAAYVDGATPWQAFWRVTFPLLRPVLLALLVLQTLTEVRT
                     YDLVYVLTRGGPGSSTDLVSYYIYRKAFLGLDLSGASAMGYLLLLLSLLLVAAYYRLL
                     TRGWT"
     gene            223809..224576
                     /locus_tag="TCCBUS3UF1_RS00955"
                     /old_locus_tag="TCCBUS3UF1_1990"
     CDS             223809..224576
                     /locus_tag="TCCBUS3UF1_RS00955"
                     /old_locus_tag="TCCBUS3UF1_1990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015858360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433637.1"
                     /db_xref="GI:752794205"
                     /translation="MGFRPPKDPEGFLAYARVLAGRYAFIEVPGSAAPHLEGVAQEAR
                     GMGYRLTYHARYLDLYPGSPVPEIREASLRLLREDLERAARMGAFLVNVHAGNIPWTD
                     YPPPGLSPAHEALREAEGRLRREYLERALEALAGLASLALDLGLKLTLENLPAPQEVP
                     RTPEEMALFLAVPGLEFCLDLGHAQMAGQDPKGFLEALGGRLVHVHAHRNDGRFDLHL
                     PPRPEDLNPFLDTPCTLLVELPPRGVGEYLALVGDQP"
     gene            224668..224988
                     /locus_tag="TCCBUS3UF1_RS00960"
                     /old_locus_tag="TCCBUS3UF1_2000"
     CDS             224668..224988
                     /locus_tag="TCCBUS3UF1_RS00960"
                     /old_locus_tag="TCCBUS3UF1_2000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="WP_014514616.1"
                     /db_xref="GI:504327514"
                     /translation="MFVVMNRIPVKPEYADRFEEVFRTRARLVDRMPGFIRNLVLRPK
                     DPEDPYIVITFWESEEAFRAWTESPEFREGHARSGTLPKEAFRGPNRLETFSVFLDSQ
                     DSHG"
     gene            224981..225610
                     /locus_tag="TCCBUS3UF1_RS00965"
                     /old_locus_tag="TCCBUS3UF1_2010"
     CDS             224981..225610
                     /locus_tag="TCCBUS3UF1_RS00965"
                     /old_locus_tag="TCCBUS3UF1_2010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514617.1"
                     /db_xref="GI:504327515"
                     /translation="MARPDIETPSAWVLLKRARERVYTLPEDFPGFRGTLALFAGGLW
                     HFGRVEVQGFSPKVDLLGHLRSVAERELASLLGHRRPVPFPEGEGKYPMRLFEEGPLG
                     TGIALEDPFRSRIWVKGNRLQVIERHLAGGSFRIHLEVWREVEEGLLPQRFLLVHRDP
                     EGRVVRVERFRDEYQKVGPYWLPVEREVVVEAKGLEVLVLRLEELEVNG"
     gene            225607..226512
                     /locus_tag="TCCBUS3UF1_RS00970"
                     /old_locus_tag="TCCBUS3UF1_2020"
     CDS             225607..226512
                     /locus_tag="TCCBUS3UF1_RS00970"
                     /old_locus_tag="TCCBUS3UF1_2020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin receptor"
                     /protein_id="WP_014514618.1"
                     /db_xref="GI:504327516"
                     /translation="MKGFYVGLLLLSCTLAQAQPFRVVDAKGTEIQVRSLERIVSLDG
                     ITTEILFALGVGDKVVGRDDSSYYPPEVLKRPSVGYQFRLSAEGILSLRPTLVIGRED
                     VRPPQVVDQLRGAGVAVVLVPTEPTVEGAKRKIRTVAQAVGRLEQGEALVRALERDLL
                     ALRAFQAQQAPKGRLRGLFLYLRGPQTTFVCGEGSTPVGMMELAGLINAAKGIRECQP
                     MTAESVVAARPDVLVVFQKGLESVGGLEGLLKLPGVAQTPAGQNRKVVAMDDLYLGSF
                     GPRAGRAALDLFRAAYLREGFVEVR"
     gene            226649..227659
                     /locus_tag="TCCBUS3UF1_RS00975"
                     /old_locus_tag="TCCBUS3UF1_2040"
     CDS             226649..227659
                     /locus_tag="TCCBUS3UF1_RS00975"
                     /old_locus_tag="TCCBUS3UF1_2040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemin ABC transporter permease"
                     /protein_id="WP_041433927.1"
                     /db_xref="GI:752794496"
                     /translation="MRARAYRLALLGLALLLPLALLLGAGLGAYPIPPLAIPGILYRG
                     EGLEYQVLTALRFPRVLGAALVGGLLALAGAVLQGFFRNPLVDPGLIGVSSGAALGAA
                     LFIVLVPGAGNLEVYALPLFAFLGGLLATLLLWRIAQTPLGVQVSVLLLSGIALNALV
                     GGGIGILTFLASEQELRSLTFWTLGGFSGLTWRLLLAALPLALLALYLLFPLARGLNA
                     LALGEREAFHLGVGLEGLKRRAVAGAALGVGVSVALAGGIGFIGLVAPHLFRLLAGPD
                     HRYLLPGAFLLGASLAVLADLLARTLAAPAEMPVGVITALLGGPFFLYLVLRYKREVY
                     RA"
     gene            227652..228428
                     /locus_tag="TCCBUS3UF1_RS00980"
                     /old_locus_tag="TCCBUS3UF1_2050"
     CDS             227652..228428
                     /locus_tag="TCCBUS3UF1_RS00980"
                     /old_locus_tag="TCCBUS3UF1_2050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014514621.1"
                     /db_xref="GI:504327519"
                     /translation="MLEARGLGYRKEGRWLLRGVDLSLAPGDFLAVLGPNGSGKTTLL
                     RLLAGELSPSEGEVRLLGRPLGSYTPLELARQRAVLSQNRELAFSFTAYEVAFLGRHP
                     HLEGRERSLDHEKTLEALRRAQALPLRERLYPTLSGGEGIRVEVARLLNQEPRFFLLD
                     EPTNHLDPRYALEVLLLFRALAYEGRGVLAVLHDLNLASLFANRLLLLKGGRVLAYGS
                     PEAVLCPELLEEAYEVPFYALAHGGVSLFLPVPREVVRGT"
     gene            228418..>228681
                     /locus_tag="TCCBUS3UF1_RS00985"
                     /old_locus_tag="TCCBUS3UF1_2060"
     CDS             228418..>228681
                     /locus_tag="TCCBUS3UF1_RS00985"
                     /old_locus_tag="TCCBUS3UF1_2060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011229089.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433928.1"
                     /db_xref="GI:752794497"
                     /translation="MEPEHAQEVARLSPTRYLARCACHGGTYHLHWDAGTFRLNQEGI
                     AFLMRVLQEVLENGTGGVVWLGSVGLRFGPEEGEELLRLLRAGL"
     gene            complement(228743..229963)
                     /locus_tag="TCCBUS3UF1_RS00990"
                     /old_locus_tag="TCCBUS3UF1_2070"
     CDS             complement(228743..229963)
                     /locus_tag="TCCBUS3UF1_RS00990"
                     /old_locus_tag="TCCBUS3UF1_2070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514494.1"
                     /db_xref="GI:504327392"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     gene            230009..230926
                     /locus_tag="TCCBUS3UF1_RS00995"
                     /old_locus_tag="TCCBUS3UF1_2080"
     CDS             230009..230926
                     /locus_tag="TCCBUS3UF1_RS00995"
                     /old_locus_tag="TCCBUS3UF1_2080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514623.1"
                     /db_xref="GI:504327521"
                     /translation="MRRVFFAFLFTAVALAQQGTCPGERVPHDLGEVCLSKVPDRVAA
                     LDWRPLEDLLLLGVRPVAGADLADFPKWVKVPLPQGIADLGGRTAPNLERLLALRPDL
                     ILGYTGFQGRLYPELSRIAPTALYDYLPSEGQLAAMRRHFLLHAQLVGKAKEGERILS
                     DLDRFLAQARERLEQRGLGGRPFLLVQAWARDKVYNIFTRSTLASEVLEAVGLRNAWT
                     GKAEAYGLSRVGPEGLVRLVRENPGVQVLLIAQPGNNPLADPAIGPLLRLQGARVHPM
                     DPATWTYGGPLSVRVLVEEALRVLLGGKP"
     gene            231492..231854
                     /locus_tag="TCCBUS3UF1_RS01000"
                     /old_locus_tag="TCCBUS3UF1_2100"
     CDS             231492..231854
                     /locus_tag="TCCBUS3UF1_RS01000"
                     /old_locus_tag="TCCBUS3UF1_2100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA hydrolase"
                     /protein_id="WP_041433929.1"
                     /db_xref="GI:752794498"
                     /translation="MVHLVFPGETNHYGTLFGGTVMAWMDQAAFVAATRHARRKVVTV
                     HSDAVDFQRPVPLGSIVELVARVVGVGRTSMRVAVELWVEPLEGDRYLAAKGGFVLVA
                     LDGEGRPAPVPPLEGVKE"
     gene            231857..234001
                     /locus_tag="TCCBUS3UF1_RS01005"
                     /old_locus_tag="TCCBUS3UF1_2110"
     CDS             231857..234001
                     /locus_tag="TCCBUS3UF1_RS01005"
                     /old_locus_tag="TCCBUS3UF1_2110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="WP_014514626.1"
                     /db_xref="GI:504327524"
                     /translation="MRTLAYGFPRLGPDREYKRLLEGFWSGEVSEEAFRQGLEGLEAL
                     RLAAYRRHVDLYPVGEMSLYDPLLDLAVMVGVYPIDPQDLGAYYALARGKGALPLRKW
                     FGTNYHYLAPLLPEAPRYKPHWNKPLEAFRKHPEGLPHLLGPYTLLRLAQNPPEGGER
                     ARHLEALGEVYAAFLGELKGAGAPLALLEEPALGLDGAEEDLPALERVYGRLLEALPL
                     ALLTPYLLPRPEVGAGLYPLPWAAASRDLEAPRGGPRVPILGVVEGQGVWRTPLLEVA
                     RRLREALGEGEVWLAPRAPLYHLPWRVGSPPPGLEGRLAFAEERLGELALLARLLRGE
                     EGALAEAQAWRAPGEPPRLPPLSPPPGPRPPGPVRKEAQRDLPLPPFPTTTIGSFPQT
                     QELRALRARFRSGKLSPEAYGEAIREAIARTIRFQEAVGLDLLVHGEPERSDMVEFFA
                     ERLEGFHTHPSGWVLSYGSRVYRPPILAGPVRRKGPLALEELRYAQSLTPKPVKAILT
                     GPITLAAWSYLPEGASFAEAVLHLAEAIGEEVRALEGAGFRFLQIDEPALLEKLPLRA
                     EAQPAYLELVREAFRRAVPVGPGVQVHLHLCYSEYAALRPFLEAMDPDVVSLEAARQE
                     PRFLGALEGLDLGLGPGAFDVHSPRAVSPEEMEGRLLAYLDHIPPSRLWVNPDCGLKT
                     RTWPEAEANLKAMVEAARRLRARFGGEDAHRT"
     gene            233985..234950
                     /locus_tag="TCCBUS3UF1_RS01010"
                     /old_locus_tag="TCCBUS3UF1_2120"
     CDS             233985..234950
                     /locus_tag="TCCBUS3UF1_RS01010"
                     /old_locus_tag="TCCBUS3UF1_2120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleotide reductase"
                     /protein_id="WP_014514627.1"
                     /db_xref="GI:504327525"
                     /translation="MLTEPRVHYRPYEYPGLLRFRDAIRHSYWVHTEFSYAADVQDYA
                     LVGEAERSLVRRALLAISQVELSVKLFWARVYEVFPKPEVAEVGMTFAESEVRHANAY
                     AHLLDLLSLSEAFPKALEEPPLKARQRLLASVLERARGGSLREYALALLLFSAFTEHI
                     SLFSQFYILMALNRRQGRFKGISNAIEATSKEENLHGLFGVELLRLLRMERPELFVGF
                     DEEALGFAQELFRAEEDLLSWLFAGGEPEAVAFAEVREFLKARYNEVLALHGLPRPFA
                     VKEELLRDTDWFALELLADKEVDFFNKRSVAYARRVQSYDPESLF"
     gene            234960..237728
                     /locus_tag="TCCBUS3UF1_RS01015"
                     /old_locus_tag="TCCBUS3UF1_2130"
     CDS             234960..237728
                     /locus_tag="TCCBUS3UF1_RS01015"
                     /old_locus_tag="TCCBUS3UF1_2130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="WP_014514628.1"
                     /db_xref="GI:504327526"
                     /translation="MRKTKREYEPWYWANEWTRLYMSRGYLLPGVSVEERVRQIARRA
                     EALTRIEGFAEKFERYMARGWYSLATPIWANYGLGRGLPISCYGTYVEDDTASILRAV
                     AEIGMMSKQGGGTSVYLGNLRPRGAPIRDNGESNGSYAFASLFDRVIEVFNQGSTRRG
                     QCAAYIPIEHPDFPEWLRIQREGSEIQSLFWGVTVGDAWLEAMVAGDREKRERWAQVL
                     KSRAEVGIPYIFFRDNANRARPEIFKRLGVEIHGSNLCVVGSSLAVTSEGIRRVEDLY
                     REGKPLTLFDGEKPVPASPMYLIERDADVYTVITKSGRRHTVTGYHKVKTQRGMVPAL
                     ELKPGDKIAIQRNEGLFGSYHNPDLAFLLGLYHGDGTQTDKQIFIDLWEHDFDLKEKI
                     EACVERVYLANGWDAYEVFVPSVRTASRRASIPRFYPTPQVGKEKKLRLGSTKLKQLG
                     FEKFLIPDWIWQGDKETQAAYLKGLFYADGTVRVGESEGNPIQLALASVNKEFLRQVQ
                     IILTNLGINSRIYKLHDAGNTLLPDGRGGHKEYPTKDSWRLVIGDKNSALKFEDLTGF
                     LSRKGVHLERREYRDNTKKWDEVVAVEYAGKEDVYCCTVYTDEHVWVCDGIITSNCTE
                     IALPSTPEESFVCCLSSLNLLHFDEWKDTDAVETLTIFLDSVLDDFIEKAQGIPYMER
                     AVRFARRYRAIGIGVLGWHSYLQSKGIPLESADAVFLNGLIFKTILERAEEASRWLRA
                     RHPEDELAELMERRNATLMAVAPTKSSSFILGQVSPSIEPYTSNYYLKDLQKARVPFK
                     NPFLEELLRAKGKDEERVWRSILEHNGSVQHLDFLTDEEKDVFKTFAEVSQKTLINLA
                     AGRQRYIDQGQSLNLVIHPEAPPRDVNELYLHAWRSGLKALYYQFSSSTAQAYSRDLL
                     LSCRACEG"
     gene            237745..238605
                     /locus_tag="TCCBUS3UF1_RS01020"
                     /old_locus_tag="TCCBUS3UF1_2140"
     CDS             237745..238605
                     /locus_tag="TCCBUS3UF1_RS01020"
                     /old_locus_tag="TCCBUS3UF1_2140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514629.1"
                     /db_xref="GI:504327527"
                     /translation="MRVASLVPSGTLLLRALGVEPVGVSHACPNPRGAVVLTESLIPK
                     GLSQEEIDRRVREAYAQGASLYRVRGEALEALAPDLLVAQGVCEVCAATPQEVAGALR
                     FLSQRPRVLELRGTRLGDLFAELQALGEATGREGEARALTQALRERLLALPLPSHRPS
                     VAFLEWLDPPYLGGHWVAEVVEGAGGRYLGPGPGERSRRVDPKGLPQAEVVLLAFCGY
                     SLAEAQEAVARHLSRGGWLGEYLRGRRAYLLDAAPFQALTHLTVEGVELLSRLLRGEE
                     GVEGLALPLA"
     gene            238640..239230
                     /locus_tag="TCCBUS3UF1_RS01025"
                     /old_locus_tag="TCCBUS3UF1_2150"
     CDS             238640..239230
                     /locus_tag="TCCBUS3UF1_RS01025"
                     /old_locus_tag="TCCBUS3UF1_2150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514630.1"
                     /db_xref="GI:504327528"
                     /translation="MAKVRRTGPGALALLVGLSLLLAACGGPAGSLQDPRLEVLEDMR
                     RLGLPPEVIATYGEALESLGPRLAPQGTGDLQLVQAIALGSVPHYEAYYARRQDYPQF
                     DWSRDGCSAPEGLGLGYRETFRPACNVHDFGYRNFPRFPELYNERGRRLADDNFLVNM
                     NAICRPMGLVNRAACYSAAHAYYWAVRAFGGGHFYR"
     gene            239254..239643
                     /locus_tag="TCCBUS3UF1_RS01030"
                     /old_locus_tag="TCCBUS3UF1_2160"
     CDS             239254..239643
                     /locus_tag="TCCBUS3UF1_RS01030"
                     /old_locus_tag="TCCBUS3UF1_2160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010657429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Magnesium transporter"
                     /protein_id="WP_014514631.1"
                     /db_xref="GI:504327529"
                     /translation="MGGNTGSQTATLLIRSMALGQVRPRLGDFLLVLRRDIPVALGVV
                     IALLEALLAFFSKGVGTEILLVVGLSMLTTTALGSLVGIFLPFLAKRLGADPATLSAL
                     VITSGMDLLGVMVYFGYAYAFLGDLLR"
     gene            239932..240282
                     /locus_tag="TCCBUS3UF1_RS01035"
                     /old_locus_tag="TCCBUS3UF1_2170"
     CDS             239932..240282
                     /locus_tag="TCCBUS3UF1_RS01035"
                     /old_locus_tag="TCCBUS3UF1_2170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514632.1"
                     /db_xref="GI:504327530"
                     /translation="MRGGELILQAGLVFWVLVVLSVYVFYLLLYALFLLQREGKVEPS
                     LLLRLEGLAQLAPLVGLLGTALGMIQAFLALSGEGNPQGLAKGIAEALVNTAMGLLVA
                     VVAYGGRVFLERGR"
     gene            240279..240662
                     /locus_tag="TCCBUS3UF1_RS01040"
                     /old_locus_tag="TCCBUS3UF1_2180"
     CDS             240279..240662
                     /locus_tag="TCCBUS3UF1_RS01040"
                     /old_locus_tag="TCCBUS3UF1_2180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter ExbD"
                     /protein_id="WP_014514633.1"
                     /db_xref="GI:504327531"
                     /translation="MRPLNLVPLIDLFLLLALFGLMLAQFPEALSGGIAQERALRVEL
                     PQGEGTPGGGALLIELSRDGRLALEGKPLPSLKALEEALKALPLGDRPVRLEADREAA
                     HGQVVAVMEAVRRAGGKGVQVAVKK"
     gene            <241159..241851
                     /locus_tag="TCCBUS3UF1_RS01045"
     CDS             <241159..241851
                     /locus_tag="TCCBUS3UF1_RS01045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014629882.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433930.1"
                     /db_xref="GI:752794499"
                     /translation="APQGAEAPGGAKEETSPSLGQAPSPGPKEEPLSQARSPLLGEKK
                     EEISPGNGKAQLSSGVEALRNGQGSSPVPTGEPLSQGRALSRGEGEGEALGRASREGL
                     GREGLPPVGKGGSGEEGARCAVVVELRGLPYAQGPSPAILDPQGRLVWPDPKRVQGVP
                     TEVVDRSGIALFFRPGEFREEAYGRVYRVRALATRPRTPGSRFPELVVVGEEEARLLL
                     GAPPTCQAVFIR"
     gene            241862..242473
                     /locus_tag="TCCBUS3UF1_RS01050"
                     /old_locus_tag="TCCBUS3UF1_2200"
     CDS             241862..242473
                     /locus_tag="TCCBUS3UF1_RS01050"
                     /old_locus_tag="TCCBUS3UF1_2200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514635.1"
                     /db_xref="GI:504327533"
                     /translation="MRKGFVLIPLLVLVPSLAWSPAPTLEEAQGVVEGVYSRLPRLPV
                     AWESEAPPWRPWRGECPSSGGSRPVAVRVGGQLEVVEILAERARNEFRRVRAQEVLPQ
                     AKRFLPDGHLRVYLTVEGLARLEWREAYTLGALVGDKPRRAYRVTYLDDWQKEEKGYR
                     GTLVFYLDLSEGVDPQGELLLLLMTEAEADCVYALSVPLGRFR"
     gene            complement(<242736..244766)
                     /locus_tag="TCCBUS3UF1_RS01055"
                     /old_locus_tag="TCCBUS3UF1_2220"
     CDS             complement(<242736..244766)
                     /locus_tag="TCCBUS3UF1_RS01055"
                     /old_locus_tag="TCCBUS3UF1_2220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514637.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433931.1"
                     /db_xref="GI:752794500"
                     /translation="MIGPVQTVEVFLNRFPLRPLEEEEASPWLLQVQLDPPPEPEATY
                     ALLGRLARQVGPMVARFGTGLVSWSLPEGLALEGQVAGSRGSHAYRLLPQGRRPLDPA
                     RPGDREALNALARRRLELGLQQAFPKGYRVEGRRLLGLKPLREGPGWRLLRGAELDLM
                     VDPEGRWLLEVDLVHRLEATLDLEGWLAQGHPLPARARNAYGGGYRGVWEVVRLGEEA
                     PEEVLLENGLSLLAYHKQKGHWEGGSPGRVVWVRDPRRAKETPHLTGLLVPVLTLEEL
                     EEPLALQIPPEPRRKDAEQVARVVAQRLFGLPEARPLRVQARRLPQAQLRAHGGKRVG
                     KPADALRVGALGAREATVALLRLDGGQGWPPLLLEALKGVARASGVSMRFLIGQTPLP
                     ERELAFRQALEGIRAQGAEALLVLTPPLSPERRNRLKALALQEGLPTQLLNTPLGPGD
                     RHRMANALLGLLAKLGWPVVALEGRYAAELAVGFDAGGRDTLRFGGAACATTGDGSFL
                     GWALPEAQVGERIPERVAWDLLANTLKGFHNAYGRFPRHVLLLRDGRIPQGEFRLALE
                     GLRQEEISYDLISVRKTGGGRIYPVRGRLGDGVFLPLEGDAFLLLTVHREGRGTPRPL
                     KVVREAGETPLEEVARQVYHLTRLYPPSGFLFPRLPAPLHLADRLVKERARVG"
     gene            244773..246092
                     /locus_tag="TCCBUS3UF1_RS01060"
                     /old_locus_tag="TCCBUS3UF1_2230"
     CDS             244773..246092
                     /locus_tag="TCCBUS3UF1_RS01060"
                     /old_locus_tag="TCCBUS3UF1_2230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyrinic acid a,c-diamide synthase"
                     /protein_id="WP_014514638.1"
                     /db_xref="GI:504327536"
                     /translation="MQLPRLLLAAPHSGAGKTTLALALLQALRERGLAVQPFKVGPDY
                     IDPTHLELASGRRPYNLDGFFLDGEGLLSLFRHGARGADLALIEGVMGLFDGKDPQGR
                     VGSTAQVARLLQAPVVLVVDAGGMAGSIAPLVQGFARFDPGVRVVGVLANRVGSARHA
                     EILREALAPLGLPLLGWLPLDPGLELPERHLGLVLAGEVRPPLEALRKALRLDLEGLL
                     RLAGEAPPLPEAPPFLPERHPPRARVAYAWDRAFRFYYPEALELLEALGAELIPFSPL
                     ADGALPQAEALLLGGGYPELFARELSENTPMREAIRRFRGPVVAECGGYMYLSRGLWV
                     GEAFFPMVGLVPGEARMGERPVLGYREVEALRDSPLAQRGEAFKGHEFHYAHLPPSPS
                     PAWRRVGGEEVEGYTDGRVLASFVHLYLPARPQGALRLLLSAQNPLG"
     gene            247014..247314
                     /locus_tag="TCCBUS3UF1_RS01065"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            <248109..249431
                     /locus_tag="TCCBUS3UF1_RS01070"
     CDS             <248109..249431
                     /locus_tag="TCCBUS3UF1_RS01070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011229147.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433932.1"
                     /db_xref="GI:752794501"
                     /translation="KAKRLGGQQALGVALLPMDKVLGQHENNREWVLAHYQTYAREAG
                     VLALDPREEGALGRALSLPSPNPGAKDLPFRPPEAGPVLLGLLSEQPIPLLASFLVHR
                     PKEVLLVSTQDLERRLGRLASAQAAFSRLGARVQVRQVSGPWALDEVEALFAPVLGAI
                     QARGLSGVANLAGGTKAMALGLLRVLPPGFRVEYLRGSTLEGLPEGDPLPVPWAEVGP
                     EAVLHLYGYQLERDPKLGQIQPHQEVLARAEEFLRHVEDPQRARAFLEAWEKSFAAEA
                     EGFRLRWRDLRPSAGLALEYLAFFHLHRLLTPRGARVEPGAHLRPLWAHPGLNPREVD
                     GLVWHRGSLAFVECKPDLRSALSKHQEDAALFVLQENFGGVFGRGLLLVQRGRWKPHE
                     KPPAELPWVLRNPRLRLLSLEGGTPYPGGRVYAFPEELEEALRDWGWP"
     gene            complement(249428..250450)
                     /locus_tag="TCCBUS3UF1_RS01075"
                     /old_locus_tag="TCCBUS3UF1_2280"
     CDS             complement(249428..250450)
                     /locus_tag="TCCBUS3UF1_RS01075"
                     /old_locus_tag="TCCBUS3UF1_2280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr6"
                     /protein_id="WP_014514643.1"
                     /db_xref="GI:504327541"
                     /translation="MGRREALQGVRLDPQGTHRGLWLDKYLAEAEREDTEAKGRLVKE
                     VAGIAEPQGYGAFFARYLEALEAMGAETRRATTRSRLVVGLGGEGVLETSLTLHRTYS
                     VPYIPGSALKGLASRYAHLYLEGEAWRRDPRGEAQAGLFGTTEEQGAVVFFDALPYPK
                     TWRIHPDLMNPHHADYYGGGGAPPADWDSPVPVPFLSVKGTFLLALAPAPGVPREEAR
                     PWLQAAWRILAWALREEGVGAKTASGYGRMDLEGESAPSPPQAASSPAYEALRTQLRS
                     TKYRDLPAFLEREAQAILGLSPQELRGLKEAMEERKFLQNAADLKAWAKRSETLRQVL
                     QKLGVL"
     gene            complement(250453..250797)
                     /locus_tag="TCCBUS3UF1_RS01080"
                     /old_locus_tag="TCCBUS3UF1_2290"
     CDS             complement(250453..250797)
                     /locus_tag="TCCBUS3UF1_RS01080"
                     /old_locus_tag="TCCBUS3UF1_2290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr5"
                     /protein_id="WP_014514644.1"
                     /db_xref="GI:504327542"
                     /translation="MRTRSQNWAQAAYERVRARKDWEKREEYQDMALKLPVLVRQAGL
                     SQALAFVHSRGKEGHRAVGDDLAAVLGHGNLEALAEAARRAELLQYLRLTREVLQVAE
                     WFKRFAQALLED"
     gene            complement(250801..251664)
                     /locus_tag="TCCBUS3UF1_RS01085"
                     /old_locus_tag="TCCBUS3UF1_2300"
     CDS             complement(250801..251664)
                     /locus_tag="TCCBUS3UF1_RS01085"
                     /old_locus_tag="TCCBUS3UF1_2300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr4"
                     /protein_id="WP_014514645.1"
                     /db_xref="GI:504327543"
                     /translation="MKGHATALLFLHALSPLHPGTGQGLGAIDLPIAREKATGIPYLP
                     GSSLKGVLRDRARGEGWDEDTLEAVFGPETERASEHAGALQVGDARLLLLPVRSLYGV
                     FAHVTSPYLLERFLREARMVGLNPPEGPAAPPQEGVAVAPGSHLAAEGRVFLEDLDLR
                     AQAGEAVGAWEAWLSQQTQAPVGGRMAVVHDDLMGFLLETATEVVARIRLEDTTKTVA
                     RGALWYEESLPAESVLYSLVRTEASHRKTKPLGAASVLELFQGLVDGQALQLGGKATV
                     GRGLCRVRVGR"
     gene            complement(251661..252911)
                     /locus_tag="TCCBUS3UF1_RS01090"
                     /old_locus_tag="TCCBUS3UF1_2310"
     CDS             complement(251661..252911)
                     /locus_tag="TCCBUS3UF1_RS01090"
                     /old_locus_tag="TCCBUS3UF1_2310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr1"
                     /protein_id="WP_014514646.1"
                     /db_xref="GI:504327544"
                     /translation="MRKFQEAFGPRKREAGGSLVRRDGVRILTWERSYLLLTPLFGGG
                     VEPKRADPVSVVRATEVRGQLRFWWRAVRGWQAEGDLGRLWRLEASLFGHAGEGGASP
                     LAVELEVVEEGKEEAAFQDLPGKNFPRGRSDIAHPYLAFPLQRTRQDPVNHPVRVGVR
                     FRLRLACPERIEGLDPKEELEAALWAWETFGGIGGRTRRGFGALALEGSSPPTEEGIR
                     AQLRRYSRERGWPPGVPHLTPKSLVRVMGLSWREVAEAYRAFRQRRAKDDPRNPGRSR
                     WPEPDQVRRLTGRNHPRHPPRHPVGKFPRARFGLPIIFHFKDEGDPPDTTLKPPLEGT
                     DRLASPLILRPLGKGITLVAILEGSGVPGDRAVLETHDKKRSWEVQVGLTPEEAQRIE
                     PLGGEVDPLRAFLRYLENRAGGGR"
     gene            complement(252908..254017)
                     /locus_tag="TCCBUS3UF1_RS01095"
                     /old_locus_tag="TCCBUS3UF1_2320"
     CDS             complement(252908..254017)
                     /locus_tag="TCCBUS3UF1_RS01095"
                     /old_locus_tag="TCCBUS3UF1_2320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cmr3"
                     /protein_id="WP_014514647.1"
                     /db_xref="GI:504327545"
                     /translation="MLIEPRDPLIVRDGRPFTNSPGARAHSLAFPLPQTLAGAYRARR
                     GMEEGLSFPQDADRVREWGLKGPLLAEEAETGWRLLAPRPLDALKLGERVYALRPLEV
                     PEGAGTNLPQGLFPVGLPKTGLKGKPSPLPAFWYWEDWQRWLLEEAPEGFQPKGHGGP
                     TIEVRTHVSLRPEAGTAREGALFQTSGLEFAYRRGEGDGRPHRLALALWPEDGVEVEG
                     IHPLGGERRLAYWRRGGPPLPPMPSGLLEALWEHRAARIVLLTPAFFRKGYLPEKDAF
                     LGAQVVGAAVGRPVVVSGWDLKKGRPKPTRRAVPPGSVYFVRLPGEWSREEVRAFAEK
                     VWLQNLSEEETDRKDGFGLAALGVWSGKPWRWEEV"
     gene            complement(254007..255779)
                     /locus_tag="TCCBUS3UF1_RS01100"
                     /old_locus_tag="TCCBUS3UF1_2330"
     CDS             complement(254007..255779)
                     /locus_tag="TCCBUS3UF1_RS01100"
                     /old_locus_tag="TCCBUS3UF1_2330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Crm2"
                     /protein_id="WP_014514648.1"
                     /db_xref="GI:504327546"
                     /translation="MESLLAISLGPVQDFIATARRTRDLYAGSRLLSEAAGKAAEVLA
                     ERLGPERLIFPAPKTKEELAKLGQAGIPNVLLARVSEGLDPGALAEVALGAAREYLRE
                     KAKELFTREGRRAYVSLEAALDQVGDLLEGYYAHLPLQGDYPQARERVMALLGARKNT
                     RDFRPVSWGSPAYKSSLDGARESVLLLPESRAEALRVRLRLGLREGEYLSGPDLLKRW
                     WEAEGGFVSTIHMAALPFWEGVRKAGKEGLFRKGLEDLAQLAGEEAKGNTRHPALRDT
                     PFWEWDVRLLYESRLEEFPALGEDPRRLEEARGRLRRLLGELGLGSPGSYYALLHADG
                     DRMGEAIDRQKTPEAHRELSRALALDFAAQVRELVQGRGGGLVYSGGDDVLALLPLHR
                     ALETAWALARRFQEVMARFGGGEGKPSLSVGLAVVHHLEPLQDALELARKAERLAKEG
                     PEGTPEDEKRNALGVAYSPRSGSELLVRGRWDETPRLTQRLLRYADLLRAGEVPSRAA
                     HELRELLAWRKGLSEEALVAEALRILGRKAMEKKYRQELSDWIQNARDVERLAQELIL
                     ARPLAEALDQAGIPVESREVWDAH"
     gene            complement(255828..>256088)
                     /locus_tag="TCCBUS3UF1_RS01105"
                     /old_locus_tag="TCCBUS3UF1_2340"
     CDS             complement(255828..>256088)
                     /locus_tag="TCCBUS3UF1_RS01105"
                     /old_locus_tag="TCCBUS3UF1_2340"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433640.1"
                     /db_xref="GI:752794208"
                     /translation="ETGLLELMAFLRVLEDPVLKAKQVKGLQDLVGVLQSRNQPLLIH
                     GLLVPTEKQVEQVQQLGRELLKALQEEGAPSLELEVLPLERL"
     repeat_region   256084..257261
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=256084..256113
                     /rpt_unit_seq="gtttcaaaccctcataggtacggtcagaac"
     gene            complement(257448..258431)
                     /locus_tag="TCCBUS3UF1_RS01110"
                     /old_locus_tag="TCCBUS3UF1_2350"
     CDS             complement(257448..258431)
                     /locus_tag="TCCBUS3UF1_RS01110"
                     /old_locus_tag="TCCBUS3UF1_2350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="WP_014514650.1"
                     /db_xref="GI:504327548"
                     /translation="MPKPVYIFSSGRLSRLANTLVLETEDRKRHLPVEQVSELYLFGE
                     VDLNKRFLEFAAQKGILLHFFNRFGYYVGSFYPREHLLSGYLTLRQAQHYLDANRRLN
                     LARRFVEGGLENIRRLLRKEEAKGKRVSDALDTIGEILSQVKGAQHVGELMALEGRAR
                     ESYYAVWDELLGEEWSLERNRRPPKDPVNALVSFGNTLLYTAILAQIYQTHLDPRIGF
                     LHEANYRRHSLNLDVAEVFKPVLVDRMIFRLIRRGQIKTGHFLREGQGVFLSEAGKRL
                     VVEEWENSLQATYRHLSLKRSVSYRTTLRLELYKLEKHLIEENPYIPYRFR"
     gene            complement(258424..258945)
                     /locus_tag="TCCBUS3UF1_RS01115"
                     /note="CRISPR-associated protein Cas4; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(258921..261158)
                     /locus_tag="TCCBUS3UF1_RS01120"
                     /old_locus_tag="TCCBUS3UF1_2380"
     CDS             complement(258921..261158)
                     /locus_tag="TCCBUS3UF1_RS01120"
                     /old_locus_tag="TCCBUS3UF1_2380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas3"
                     /protein_id="WP_014514653.1"
                     /db_xref="GI:504327551"
                     /translation="MLLARTSPDEPLLEHLLGVGALAEGYLAPLGLGEEGRLAGLCHD
                     LGKATPYFQEMLAGQRAKGDPLTWHALLGALYAAWTARQRGMGEKSLLLFLAVLEHHG
                     SLKTPWERIPLGPRQASEKAWKILPKQIRALQESPLFPALVADLGLPPPEAFLGEGAW
                     EEAERLAREADALLDREGRDLGLHYRLALLYSALLDADRRLAGQAPPKGEGIPIPPEA
                     AEAHLARKSRPTPLSPQREALFRGVGEVLEGPLERVFPARLTLTAPTGAGKTLAALRF
                     ALALRERVHRERGFRPKVVYALPYIAIADQVEEEARGVLQAAGLKPEEHLLVHHHLAL
                     AREEEGSVEEALLLQETWDAEVVVTTFHQLFPTLVGPGSALRPLHALAKGAILILDEV
                     QTLPAELWPFLGELLRQLPGQMTVISMTATQPGLVKGQEVAPHLPSYPRRVRLAWHGA
                     RTLEELGQALLQEGPKSRLVVVNTVREAISLYRFLREEGLPHLYLLTSHIIPKHRKAR
                     LGEIRAKLQEGQPLTLVATQVVEAGVDLDFQEGYRAFAPMESILQVAGRVNRSALGEG
                     RLWVLDLEGDGGRRVYGTILLDRSRRVLGPRLAEGLWDLEAYALLPQYYRLVEEGISQ
                     AKGQDLLAKLARLDYSQLRFTLIEEAPSIPIFIEWDQEATRLLGELEGALTLKDPGER
                     RKRLRPLLARIQGYTVSPLLQRALKNLPPPLLGREEWRHVPREAVADFYDEEMGFLWE
                     MEQFL"
     gene            261201..261923
                     /locus_tag="TCCBUS3UF1_RS01125"
                     /old_locus_tag="TCCBUS3UF1_2390"
     CDS             261201..261923
                     /locus_tag="TCCBUS3UF1_RS01125"
                     /old_locus_tag="TCCBUS3UF1_2390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas6"
                     /protein_id="WP_014514654.1"
                     /db_xref="GI:504327552"
                     /translation="MPSEGGRLSLRFFAEGRLPVTYREGLQAALYQALPLPLGQRLHD
                     GGLLEGHRPLKLFVFSRLQGLLYLREEKAFLAQGELVLHFASALPEVVEGLAKGVWER
                     GGLEVHGLFLRLLGMDLDPLPEGGDLVVEALSPITAYRTEGGRTLYFNPLNREFALLL
                     EANLVRKAQLLGLEAGSLALKPVGFRPQHKRVERYKDTWIEGWMGRYRLEGSPHLIRL
                     ALLTGLGAKNSQGFGFVREVKG"
     gene            261971..263791
                     /locus_tag="TCCBUS3UF1_RS01130"
                     /old_locus_tag="TCCBUS3UF1_2400"
     CDS             261971..263791
                     /locus_tag="TCCBUS3UF1_RS01130"
                     /old_locus_tag="TCCBUS3UF1_2400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514655.1"
                     /db_xref="GI:504327553"
                     /translation="MEDYVQRASGRLYLLDLDPQNRVAGFTPYELDEEKCARFLWVGD
                     PPASNAPRDRATTKDLRYLLGQVPTRMAEHSGLKSLLQGFLWDPGKPGGKARYLLDLR
                     GWRLQGAKDAEAPPFRIQGGRLEMDGTAEGKTAGELAEALAQVLRAAYDIRSPEKGGV
                     LLFSLALSGKPLAEYPEYGDYLRQRLLQEPFAEAQMGICHGCGRKDRVTGNFSAFRLK
                     FYITDKKSFAPGVDEGAFPRAYALCQTCFAALGVGERLAWERLRQRFLERDVLVLPEA
                     DFPQESLERLLERLVGQVQGLERLERWKDFLERAAHRQEEVRYLGFSLLFFQRAQAAT
                     KAEELVLEVPPSRVEAILKTLQEARERGFPVEGLRDWLFLMPLSRGRKGEMGQMGLAL
                     QAVSRIFLQLPLFPKDLLPLWLKTAERVYREDGTLYALTRYRAGQGVIDLVNLGAGWM
                     WVLQRLEVWGGNMEGEVKGALPLTEEEKPLFEAYGFGALRAGLYLLGQAMEAVGQAQA
                     RLSEYRKEPLLDSIGWQGMSLVRVRHLVPEVMAKATYYLEGDDRTRVLDLLGRATDLL
                     ERSRESLSEREVPYYILMGYAQARSKRLRSGRREEVTHGG"
     gene            263781..264740
                     /locus_tag="TCCBUS3UF1_RS01135"
                     /old_locus_tag="TCCBUS3UF1_2410"
     CDS             263781..264740
                     /locus_tag="TCCBUS3UF1_RS01135"
                     /old_locus_tag="TCCBUS3UF1_2410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Csh2"
                     /protein_id="WP_014514656.1"
                     /db_xref="GI:504327554"
                     /translation="MVANAEILYLYEAKDTNPNGDPDAENRPRMDYVGQRLLVSDVRL
                     KRYVRDYLLARGEDVWVRSREDGSRTDADGRLEDLKGLYKEETGRDAGAKKKDLDPEF
                     LAWYLRRLRDVRLFGAVLPIKAEGESKGGTGQFVGAVQFDWGYSLHPVEVYTATISSV
                     FAGRTEGGKGEHGTFGKDHRVHYALIAFWGRVSKRRGEAVGLTSEDLEVLEKGLLEGL
                     LEGATTRSKVGQTPRLYLRVDWKEGFRPMGDPRDGLSIRPVEGKAPEGIRSVRDYVLQ
                     AHALSESLNSLRESIARVRLWQHPDLQLEGLNLSGLSLEEVNL"
     gene            265457..265717
                     /locus_tag="TCCBUS3UF1_RS01140"
                     /old_locus_tag="TCCBUS3UF1_2430"
     CDS             265457..265717
                     /locus_tag="TCCBUS3UF1_RS01140"
                     /old_locus_tag="TCCBUS3UF1_2430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas2"
                     /protein_id="WP_014514658.1"
                     /db_xref="GI:504327556"
                     /translation="MYVVMVYDVAVERVVKVLKVGRRYLTWVQNSVLEGELSPAQYAR
                     LKAEVRKIIEPSDAVRFYLFPNRDSLRIETIGSTKNEPDQFI"
     repeat_region   265902..266881
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=265902..265931
                     /rpt_unit_seq="ctttgaaccgtacctataagggtttgaaac"
     gene            complement(266880..267971)
                     /locus_tag="TCCBUS3UF1_RS01145"
                     /old_locus_tag="TCCBUS3UF1_2450"
     CDS             complement(266880..267971)
                     /locus_tag="TCCBUS3UF1_RS01145"
                     /old_locus_tag="TCCBUS3UF1_2450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514485.1"
                     /db_xref="GI:504327383"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     repeat_region   268040..269753
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=268109..268138
                     /rpt_unit_seq="ctttgaaccgtacctataagggtttgaaac"
     gene            270256..271476
                     /locus_tag="TCCBUS3UF1_RS01150"
                     /old_locus_tag="TCCBUS3UF1_2470"
     CDS             270256..271476
                     /locus_tag="TCCBUS3UF1_RS01150"
                     /old_locus_tag="TCCBUS3UF1_2470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514494.1"
                     /db_xref="GI:504327392"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     gene            271715..272806
                     /locus_tag="TCCBUS3UF1_RS01155"
                     /old_locus_tag="TCCBUS3UF1_2480"
     CDS             271715..272806
                     /locus_tag="TCCBUS3UF1_RS01155"
                     /old_locus_tag="TCCBUS3UF1_2480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514485.1"
                     /db_xref="GI:504327383"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     gene            complement(275018..276238)
                     /locus_tag="TCCBUS3UF1_RS01160"
                     /old_locus_tag="TCCBUS3UF1_2500"
     CDS             complement(275018..276238)
                     /locus_tag="TCCBUS3UF1_RS01160"
                     /old_locus_tag="TCCBUS3UF1_2500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011228558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014514662.1"
                     /db_xref="GI:504327560"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVHKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     gene            complement(276724..279642)
                     /locus_tag="TCCBUS3UF1_RS01165"
                     /old_locus_tag="TCCBUS3UF1_2510"
     CDS             complement(276724..279642)
                     /locus_tag="TCCBUS3UF1_RS01165"
                     /old_locus_tag="TCCBUS3UF1_2510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I deoxyribonuclease HsdR"
                     /protein_id="WP_014514663.1"
                     /db_xref="GI:504327561"
                     /translation="MSISSERRTVQNPLLRYATEAGWTYVPPDEALRLRSGEDKPFLH
                     AVLVEQLQRLNPGVVTHATKAEEVVRRLQALRADIEGNREAWEYLKGLKTIFVEADRR
                     ERNLRLLDPDRPEDNRFHVTDEFVFRSGARRIRADVVFFINGIPVLVIETKAATRLEG
                     IAEAFDQIRRYHAEAPDLLVHLQLFALTHLVQFFYGATWSLSRKMLFNWREEHGSGDF
                     ETLVKSFLAPRRVMRVLTEYILFARKDGELTKVVLRPHQMRATERVLARAHDPQKRRG
                     LIWHTQGSGKTYTMLTIARRLLEDPRFENPTVLLIVDRNELEQQLFQNLEAIGFSRVH
                     LALSKRHLRELLAADTRGIIVSMIHKFDDMPADLCTRHNVFVLVDEAHRSTGGDLGNY
                     LMGALPNATFIGFTGTPIDRTAHGKGTFKTFGTDDPQGYLDKYSIRESIEDGTTVPLH
                     YQLAPNDLIADREAMEREFWAAAELEGVADIEEINRVLDRAVTLTNMLKNPERVAKIA
                     AFVADHFKQYVQPMGYKAFLVAPDREGCVLYKEALDRHLPSEWSAVVISAGHNDPAHL
                     KRYHLSEDAERRLRQAFRKPGENPQIFIVTEKLLTGYDAPILYCMYLDKPMRDHVLLQ
                     AIARVNRPYESEQGQRKTTGLIVDFVGIFDNLERALAFDSQDVSGVVQGIDALKARFA
                     QLMDEGRHTYLPIAAGEVGDKAAEALLEHFRDKDRREAFYQFFRELEEVYEILSPDPF
                     LRPHLNDYQRLAEMYRLLRASYEPHIPVDKSFLRKTATIVQQHTHTSLVHEPSATYEI
                     GAAMLMALLNAEQPDTVKVFNLLKELYRLVEAKGHSAPYLLSIGERAEEIRRRFEERQ
                     IESQEALRELNELIRQLRAAEEERRQRGDLAARPHAEQAFTVEWWLRLHNIAPERAKE
                     VADTMEAAFAEFPHWMSDRRQEGELRKCLYKALFAISVSDVVAWTNAILDLLRRATDA
                     "
     gene            complement(<279699..279836)
                     /locus_tag="TCCBUS3UF1_RS01170"
     CDS             complement(<279699..279836)
                     /locus_tag="TCCBUS3UF1_RS01170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550036.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction modification system DNA specificity
                     subunit"
                     /protein_id="WP_041433933.1"
                     /db_xref="GI:752794502"
                     /translation="MLQAVDQRIQAEEAHVHALEALFRTLLHELMTARRRLPAEFIAK
                     FA"
     gene            complement(280913..282481)
                     /locus_tag="TCCBUS3UF1_RS01175"
                     /old_locus_tag="TCCBUS3UF1_2530"
     CDS             complement(280913..282481)
                     /locus_tag="TCCBUS3UF1_RS01175"
                     /old_locus_tag="TCCBUS3UF1_2530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_014514665.1"
                     /db_xref="GI:504327563"
                     /translation="MDLTTLENWLWEAACAIRGPVDAPKFKDYILPLIFLKRLSDVFE
                     DELRSLAVEFGGIDVAQNLVEQERAHGKVTLVRFYIPENARWETVRRQTSHLGEYLTD
                     AVRALARENPVLAGVIDIVDFNATAAGQRIVPDEYLARLINVLSRYRLGLGDVEPDIL
                     GRAYEYLLRKFAEDQGQSAGEFYTPREVGVLMARLLEPEPGMMVYDPTCGSGGLLIKC
                     HLRLLERFGKQENGRLKLPTNIAPLHVFGQEINPATFAIARMNAVIHDIQADIRIGDT
                     MRQPAFKGQGGGLQTFDLVVANPMWNQKFPQELYKNDPYNRFCYGAPPSSSADWGWLQ
                     HMLASLNERGRMAVVLDTGAVSRGSGNQGSNRERDIRKAFVEADLIEAVILLPENLFY
                     NTTAPGVIIVVNRRKRYPGQILLINASQLFAKGRPKNYLTEEHIETIASIYHAWGDPA
                     GANRDAPLHAIITREEAARNDYNLSPSRYVSISGSEEVLPLEEALVRLEEAEEERAEA
                     ERALQAVLQQLGLR"
     gene            complement(283205..283957)
                     /locus_tag="TCCBUS3UF1_RS01180"
                     /old_locus_tag="TCCBUS3UF1_2540"
     CDS             complement(283205..283957)
                     /locus_tag="TCCBUS3UF1_RS01180"
                     /old_locus_tag="TCCBUS3UF1_2540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433934.1"
                     /db_xref="GI:752794503"
                     /translation="MPWRLKEVLPEALKRAGGKERLQRGLVLASWKEVVGRELARLTE
                     AVALEEGVLTVWVADPVTAHQLTYSRLALLRRYEERFPGKVREIRFLVGRLEAPSPEP
                     PPPPKDPEAGRKALALAQLAPSELREAVARAAFALFAHKRGNPCPLCGTPSETHPCPT
                     CRRLLESPLVRKEAERLKRGRPPRLEGEALLVARHLARERLLAEMRELYPQALREAGL
                     RPLLRDLARRFQSLFPEEALPEGVQSLLAKED"
     gene            complement(283942..284973)
                     /gene="recF"
                     /locus_tag="TCCBUS3UF1_RS01185"
                     /old_locus_tag="TCCBUS3UF1_2550"
     CDS             complement(283942..284973)
                     /gene="recF"
                     /locus_tag="TCCBUS3UF1_RS01185"
                     /old_locus_tag="TCCBUS3UF1_2550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514667.1"
                     /note="Required for DNA replication; binds preferentially
                     to single-stranded, linear DNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecF"
                     /protein_id="WP_014514667.1"
                     /db_xref="GI:504327565"
                     /translation="MRLRLFRQKGFRNLYLETFHPPPVPFAVVGGNAQGKTSLLLGVH
                     LLLGGEVRASLADLVRFGEREAWLYGEVETELGRYRVEQRLFPEGREIRVNGKAVGLK
                     GLWELPGSVLLLPEDVEVVLGPKEERRGFLDRMIGRFSRRYAALLSAYEKVLRQRNAL
                     LKAGGNGLSVWDRELARYGTEIMAFRRRFLRRFLPTFQEVHRSLAPGEVGLALEESAQ
                     GDFLEALEQRRPEELLRGQTLLGPHRDDLVFLLAGRPAHRFASRGEAKALALALRLAE
                     HRLLWEHHGEAPLLLVDEWSEELDPGRRKALLTYAQGLPQAILAGLQTPEGMPVCSMA
                     GGVVLCPGG"
     gene            complement(284974..286146)
                     /locus_tag="TCCBUS3UF1_RS01190"
                     /old_locus_tag="TCCBUS3UF1_2560"
     CDS             complement(284974..286146)
                     /locus_tag="TCCBUS3UF1_RS01190"
                     /old_locus_tag="TCCBUS3UF1_2560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014514668.1"
                     /db_xref="GI:504327566"
                     /translation="MSALGLLFLTLFNSVLGLSLLFPILGPLGRSLGLSEVQVGLFST
                     GYALMQFLLAPYWGRRSEGGRKPVLLLGILGFAASFLLFGLLALLGQKGLLPPGLLFP
                     LLLLSRLLGGAFSSATLPTAQAYVADVTGRENRTAGMALLGAAFGLAVIVGPAIGAGL
                     AGLLGLLAPVFFASGIALLNALFVALVLPESRPQGTREERRLSPWDGRVFPLLLLGFA
                     LNLSSVALEQTVAFYFQDRLGLSGVATAQKVGLALVLYGAVAVLVQGFLVRRLAWPPK
                     TLLLLGLPLGLAGFLVLVLAQGFWALALGLALQGAGAALAGPGVTAALSLAVGEGEQG
                     PVAGLNASAQALGRMLGPLLGTGLYRLAPEAPYLLGAGLLLLSWALLPLLFRRVRL"
     gene            complement(286155..286970)
                     /locus_tag="TCCBUS3UF1_RS01195"
                     /old_locus_tag="TCCBUS3UF1_2570"
     CDS             complement(286155..286970)
                     /locus_tag="TCCBUS3UF1_RS01195"
                     /old_locus_tag="TCCBUS3UF1_2570"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q72GX5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate import ATP-binding protein PstB"
                     /protein_id="WP_041433643.1"
                     /db_xref="GI:752794211"
                     /translation="MVSLEMLKEHETVRTAPVSPGEALVEVKDLNLYYGAKQALFHIS
                     VRFPKNQVTAIIGPSGCGKSTLLRSLNRMNDLIPGVRVEGEVLYEGVNIYDPRVDPVA
                     VRRHIGMVFQKPNPFPKTIFENVAFGLKLMGVKGSELEDRVVEALKRAALWNEVQDIF
                     KKQSGLRLSGGQQQRLCIARAIAVEPPLLLMDEPTSALDPIATQAIEDLILELKERYT
                     VVIVTHNMQQAARISDRTLFMHLGVLVEEGPTEVIFTKPQHPYTEAYITGRFG"
     gene            complement(286964..288178)
                     /locus_tag="TCCBUS3UF1_RS01200"
                     /old_locus_tag="TCCBUS3UF1_2580"
     CDS             complement(286964..288178)
                     /locus_tag="TCCBUS3UF1_RS01200"
                     /old_locus_tag="TCCBUS3UF1_2580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_014514670.1"
                     /db_xref="GI:504327568"
                     /translation="MNKTLAQPPQEAFGTDPWKTRIDRTFARALVLPLILSIGLLILL
                     LGDTLYRSVSVQVVRADEGPGKTYPFGLSASEVLKQELLARGYTEEEVKALLQDPTER
                     RVLFLQNRVELMWNTQDGPFRYVVTGLRDERVEDFSLAEGLRRWNELKAGLGEGERLV
                     LNPWLDQSFLTRTPSRSPLTAGIGVAIWGTVWVLSLALLIAIPVGIGTAILLEEYLRE
                     GTLNRILEVNLRNLAGVPSIVYGLLGLAIFVRELGLGPTILAAALTLGLLGIPVIVVT
                     SREALRAVPESLRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAARLIGEAAPLL
                     LVGAAAYVPFFPSGPMSEYTVIPVQIYLWVSMNIPEFARVAAAGILVMLLALSGLYLL
                     ALYLRNRFRREW"
     gene            complement(288171..289073)
                     /locus_tag="TCCBUS3UF1_RS01205"
                     /old_locus_tag="TCCBUS3UF1_2590"
     CDS             complement(288171..289073)
                     /locus_tag="TCCBUS3UF1_RS01205"
                     /old_locus_tag="TCCBUS3UF1_2590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_014514671.1"
                     /db_xref="GI:504327569"
                     /translation="MEILKQRPSRNPKEVLTFALLVLLSSVTLFTTLGVILSLIGDVA
                     QFFRRVPLLEFLLAPEWTPLFDEPRYGISPLIAGTFLVTFIALLVAVPLGLALAIYLS
                     EYASGPARARIKGTLELFEGIPTVVFGYFALLFVTPLLQRFIPDLNIFNPLSAGLVMG
                     FAIIPYISNVAADAMESVPRSIREAAYALGARPYEVALRVVFPAAISGIIAAIILATS
                     RAIGETMIVAIAAGQRPALTLDPRETIATMTSYIVQAATGDQPTGSTAFYALFAVGFT
                     LFLLTLLLNILAQYVVERYRERYE"
     gene            complement(289130..290095)
                     /locus_tag="TCCBUS3UF1_RS01210"
                     /old_locus_tag="TCCBUS3UF1_2600"
     CDS             complement(289130..290095)
                     /locus_tag="TCCBUS3UF1_RS01210"
                     /old_locus_tag="TCCBUS3UF1_2600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014514672.1"
                     /db_xref="GI:504327570"
                     /translation="MRKAIGLALVALLGTALAQVRSDGSSTVYPITQAVAEEFVTRNP
                     QVKISVAFSGTGAGFQKFCRGETDVQNASRPIRKSEMEACQKAGIQYIEIPIAYDALS
                     ILVNKQNTWAQCLTTAQLKSIWEPNAKVNFWKDLNPAWPNRRIVLFGAGTDSGTFDYF
                     TEAIMGRAGSIRKDYFPSEDDNVIMRGVTGNPYAMAFVGFAYYEENKDKVRALAVDGG
                     KGCVAPSRESVLNGTYTPLARPLFIYVNLKSLERKEVRDFVDFYLSPAARRAIRATGY
                     VELPEEAYRIGQALVARKKTGSFFSDLPPGTPLSKFIEELRKEVQ"
     gene            complement(290132..291247)
                     /locus_tag="TCCBUS3UF1_RS01215"
                     /old_locus_tag="TCCBUS3UF1_2610"
     CDS             complement(290132..291247)
                     /locus_tag="TCCBUS3UF1_RS01215"
                     /old_locus_tag="TCCBUS3UF1_2610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="WP_014514673.1"
                     /db_xref="GI:504327571"
                     /translation="MKRVLVAMSGGVDSSVAAYLLKEAGYEVVGAMMRFWPEEPPAPR
                     LEAGGGRAWESCCTPDAAYEARRVAELLGIPFYLLDYREVFAEEIIQPFLRDYAQGRT
                     PNPCARCNTQVKFGAFLKQARRLGLDYVATGHYVRREGEALLRGVDPAKDQTYFLWGT
                     PKEAIPHLLFPVGGFHKAEVRAMAARAGLPTARKPESQNLCFIAGDLRGFLAEKLQAR
                     PGPLVDVETGEVVGEHQGASLYTLGQRKGLGLHKTHLERYVVGLDPGANIVYVGPKEA
                     AFWGGLEGEEVNLLAELPEEVEVQVRYRTPPVRARVESLSPLRLRFQSPVFAVTPGQS
                     AVFYQGERLLGGAVIRKGLYNLAGFDPKLMEKALTFS"
     gene            complement(291244..292125)
                     /locus_tag="TCCBUS3UF1_RS01220"
                     /old_locus_tag="TCCBUS3UF1_2620"
     CDS             complement(291244..292125)
                     /locus_tag="TCCBUS3UF1_RS01220"
                     /old_locus_tag="TCCBUS3UF1_2620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514674.1"
                     /db_xref="GI:504327572"
                     /translation="MRLPFLAQQATLGGSAALEGVMMKAPWAWALAVRLPNGQVHVER
                     HEEAALAQRYPWARLPLLRGVVALWDALSVSYRALARSAELQGEEEVPKGALWGTVAF
                     SLLLGIALFIVLPGFLSGLLLDPARHPVLYNLLAGLLKVGILVGYLLFIGRLPEIRRF
                     FMYHGAEHKAIHAYEKGLPLTVENVLAQPRFHPRCGTTFLAFVIVVSVLVYSLIPAPE
                     VLWWRLLARVLFLPVVAALAFELLYFSARHEDPLSRALRGLGFRFQALTVAEPTPDMV
                     EVAIRSTQAALGEKVVA"
     gene            292166..293557
                     /locus_tag="TCCBUS3UF1_RS01225"
                     /old_locus_tag="TCCBUS3UF1_2630"
     CDS             292166..293557
                     /locus_tag="TCCBUS3UF1_RS01225"
                     /old_locus_tag="TCCBUS3UF1_2630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="WP_014514675.1"
                     /db_xref="GI:504327573"
                     /translation="MITLHAAEAPLWQAQVPLKVLWVRQGKLSPQGEALDIRLEGLLR
                     RAWEGAGLKGESGESLLLATPEGHFLLVAADGYARQAGGRLAQLLGRYAFLEALVEPL
                     EDGYALAEGLWLGAYRFLRYKGQPGERPLALHLLGVEEGVLERARKVAEGVYFARDLV
                     NEPPNVLTPEALAEAALALRPLGVEVEVLDEEAIAALGMGAFLAVAQGSANPPRFIQL
                     RYRPEGARGRLDLVGKGLTFDSGGYSLKPTEGMAAMKGDMAGAAAVLGAFKAAALLGL
                     PVELWGYIAACENLISGRAYRVGDVLKTLSGKTVEVMNTDAEGRLTLADALAYAERQG
                     AERILELSTLTGAAVVALGEEVAALFATEAAWGERVRQAAQRAGEKVWPMPLEAAYRE
                     KLKSPVADLKNVGDRSGGAITAALFLAEFVRVPLVHLDIAGPAFAKKAHALGPEGGTG
                     FGVRTILEVAQDL"
     gene            complement(293600..294043)
                     /locus_tag="TCCBUS3UF1_RS01230"
                     /old_locus_tag="TCCBUS3UF1_2640"
     CDS             complement(293600..294043)
                     /locus_tag="TCCBUS3UF1_RS01230"
                     /old_locus_tag="TCCBUS3UF1_2640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_014514676.1"
                     /db_xref="GI:504327574"
                     /translation="MPRMKEKENYRARLKAVGLRHTLPRERILSYLDRKNVHPTPEEL
                     YNGLKKRGYDIGLSTVYLNLHVLREHGLIYEFKDPKGDTRYDGYNEPHVHLVCTACGK
                     VEDLLLKNLPELDLSGAQGAAAERTGWALEGFRLELRGKCPTCQG"
     gene            294240..294503
                     /locus_tag="TCCBUS3UF1_RS01235"
                     /old_locus_tag="TCCBUS3UF1_2650"
     CDS             294240..294503
                     /locus_tag="TCCBUS3UF1_RS01235"
                     /old_locus_tag="TCCBUS3UF1_2650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator"
                     /protein_id="WP_014514677.1"
                     /db_xref="GI:504327575"
                     /translation="MERPVYRLLRLVFALGLAHALFLLGQEAVRAHQLAKERERLEEA
                     VHQAEARVARLRAEVEAAQDPAHLEALARRLGMVRPEEILKRR"
     gene            294500..294757
                     /locus_tag="TCCBUS3UF1_RS01240"
                     /old_locus_tag="TCCBUS3UF1_2660"
     CDS             294500..294757
                     /locus_tag="TCCBUS3UF1_RS01240"
                     /old_locus_tag="TCCBUS3UF1_2660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514678.1"
                     /db_xref="GI:504327576"
                     /translation="MREDPAQVLLEDEALTEGLTDEEAEVLLSWLLDLAREAGPAQLS
                     HLRRLGHEITRLSRDYGVPVEEAIGLVELAWGEDEPPSLRA"
     gene            complement(294754..295611)
                     /locus_tag="TCCBUS3UF1_RS01245"
                     /old_locus_tag="TCCBUS3UF1_2670"
     CDS             complement(294754..295611)
                     /locus_tag="TCCBUS3UF1_RS01245"
                     /old_locus_tag="TCCBUS3UF1_2670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514679.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_041433935.1"
                     /db_xref="GI:752794504"
                     /translation="MNLRRLRLFLLLAEERNFHRAAERAYLSQPALSQQIRALERELG
                     VRLVERKPFRLTPAGEILRAEGERLFQEALALRERVRRAGWGELRFGVPENLLPDLMP
                     LLDHLRRGLGQPVEILEMHTPEQVKALKEGRLDYGLAGLRVEDPALDQEPLLEVPIVV
                     VLPEGHPLASRERVPLKALKEAPFLLIPKEALPPLHEAFMEVFRRAGFTPKVVREVAR
                     FPQAVSLVAAGVGVHLTLAPYRVFPHPGTVLRPLEEAAALQVSLIYRKAPPPPRLLEV
                     RALLRSWAP"
     gene            295733..298450
                     /locus_tag="TCCBUS3UF1_RS01250"
                     /old_locus_tag="TCCBUS3UF1_2680"
     CDS             295733..298450
                     /locus_tag="TCCBUS3UF1_RS01250"
                     /old_locus_tag="TCCBUS3UF1_2680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase"
                     /protein_id="WP_014514680.1"
                     /db_xref="GI:504327578"
                     /translation="MTESALKEALQALSAEERARLRQVENREWVESLEYVLRVEGWER
                     AEELLRLLDEYLYLQGYFPENRLSTPYLNTIPREKEPPYPGDLELERRIVNILRWNAA
                     MMVARANKRADGIGGHISTYASIAELYEVGFNHFFRGPEAGLDRDLVFFQGHSSPGIY
                     ARAFLEGRLSEADLENFRREVHPPVPGGRGLSSYPHPWLMPDFWEFPTVSMGLGPIQA
                     IYQARFMRYLEDRGLKPKSSAKVWAFLGDGEHDEPETVGALHLAAREGLDNLVFVVNA
                     NLQRLDGPVRGNSKVIQELERLYRGAGWRVIKIVWGAAWDRLIARDREGHLLRRFEAL
                     VDGESQRYAAFGGKELRERFFNTPELQALIQGMTDEELTELTRSRGGHDLKKIYAAYK
                     AAVEHRGSPVVILARTIKGYGMGPTAMAKNVAHQVKKLTEEDLKEARAFLGIPVPEER
                     LSELPYYHPGPDSPEVRYLQERRKALGGFVPERRVRFQGGLEVPGEDFFQEFYEGSGG
                     REISTTMAFVRILAKLLRHPTVGKLLVPIVPDEARTFGMEALIAQVGVYSPQGQLYIP
                     VDAGTLTAYKESKEGQILEEGITEAGAMADFIAAGTAYAHWGIPTIPFLITYSMFGLQ
                     RIGDLVWAAADQRTRGFLMGATAGRTTLEGEGLQHQDGQSPLYALAAPNLQVYDPGFA
                     YELAVILEDGLRRMYAQGEDVFYYLTIENENYPHPPIPEPRDRVKEGILKGLYLLRPG
                     EGKGPRVQLWASGPLLPQALRAQELLLDYGVVAEVWSATSYKALYLDAMEAERERRLL
                     GRARKPYVQAAMEGHEGPVVAATDYLKALPNLVRGYLDRPFCPLGTDGFGRSDTREAL
                     RDFFEVDARHMAYAALALLVEEGKLEAGVLGRARAHLGLKLEEVPPHRR"
     gene            298462..299703
                     /locus_tag="TCCBUS3UF1_RS01255"
                     /old_locus_tag="TCCBUS3UF1_2690"
     CDS             298462..299703
                     /locus_tag="TCCBUS3UF1_RS01255"
                     /old_locus_tag="TCCBUS3UF1_2690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514681.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_014514681.1"
                     /db_xref="GI:504327579"
                     /translation="MELKLPELGDNVAAATVVGVLVKEGDRVAPGQPLLELETDKAVM
                     EVPAEAGGVVRRVLVKVGDEVRPGQAFLELEGEGAPVSPVQALPQAPEPPKAEAAPPR
                     PAPPSGPSEEGRLIPAAPSIRRLARELGVDLKGVRGTGLAGRITEEDVRRAAGLAPAL
                     EAPAPALPPVPRLPDFTRWGPVRVEPMSGVRKATLRAMAQAWAQVPMVTHFDEADITE
                     LEALRKRYAKRAEERGYRLTLTAFLLKALALTLKAFPKFNASLDAERQEVIYKDYVHI
                     GVAVDTPHGLLVPVIRHVDQKGVLRLAKELQEVSERARERKLSPEEMQGGTFSLSNLG
                     GIGGTGFTPIVNWPEVAILGVSRSQVKPLWDAEKETFLPRLVMPYGLTYDHRLIDGAE
                     AARFCRHLAALLEDPLGLALE"
     gene            299739..300650
                     /locus_tag="TCCBUS3UF1_RS01260"
                     /old_locus_tag="TCCBUS3UF1_2700"
     CDS             299739..300650
                     /locus_tag="TCCBUS3UF1_RS01260"
                     /old_locus_tag="TCCBUS3UF1_2700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="WP_014514682.1"
                     /db_xref="GI:504327580"
                     /translation="MRVIVVGTRGSALALAQTRWVVERLKESWPEAEFKVKTVKTRGD
                     QGANPREQAIFVKELQEALLSREIDIAVHSLKDLPTEEPPGLKIAAIPRRQDPRDVFL
                     GRAYKRLEDLPQGAVVGTSSVRRKAQLLAYRPDLVVKDLRGNVDTRLAALGNGEYDGI
                     VLAAAGLIRLDLRNRIDQFLEPEVMLPAPGQGALALEVRQGDDLAEELCYALHHHASY
                     DRVRAERAFLRGLGAGCMAPVGALAQVAEDGTLLLEGTLLSPDGRSFIRAEIEGEASE
                     AEELGLELARDVLEQGGREILEQTRQV"
     gene            300675..301070
                     /locus_tag="TCCBUS3UF1_RS01265"
                     /old_locus_tag="TCCBUS3UF1_2710"
     CDS             300675..301070
                     /locus_tag="TCCBUS3UF1_RS01265"
                     /old_locus_tag="TCCBUS3UF1_2710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514683.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_014514683.1"
                     /db_xref="GI:504327581"
                     /translation="MALKRLTRQRKAVLEVVRRAHNHPDAAWIYQEVRKVVPKVSLGT
                     IYRTLEALVEEGYLVPITKAGEATRYDANLHPHLHLVCQGCGAIVDLEVDLPDLRGLA
                     QEAHPWVEVREVEVTYKGLCPTCKAALEG"
     gene            301071..302309
                     /locus_tag="TCCBUS3UF1_RS01270"
                     /old_locus_tag="TCCBUS3UF1_2720"
     CDS             301071..302309
                     /locus_tag="TCCBUS3UF1_RS01270"
                     /old_locus_tag="TCCBUS3UF1_2720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="WP_014514684.1"
                     /db_xref="GI:504327582"
                     /translation="MHPLAWLYARQGVVTLGLERIRALLRRLGNPQEAYPVALVGGTN
                     GKGTVARVLAAILEEAGLKVGLYTSPHLVDFRERLAVGGEPVSQDQLHRLLEEVRPHA
                     EAVGASFFEATTALALLHFARQGVEFAVLEVGLGGRLDATNAAEPMLSIVTNIGHDHL
                     EVLGPTLRDVAREKAGIFRPGVPALTAARGEGLWELRAQAAALETPLWVLGEAFALGE
                     VAPSSRGLAFTLFLRGEERRFHTPLLGPHQAENLALAAVGGRLLGAGWEAVAGGLARA
                     THPGRLERIPLEGKELLLDGAHNPEGAWALREALGFHGLLPAALVLAFTRGKDLAAMA
                     EALRGLGPVVLTRYHSPRSEDPRALLPLFPGALVEEEPLRAVERALALEGRAVVAGSL
                     YLVGEVLRGLKGLPPEERWQ"
     gene            302441..303199
                     /locus_tag="TCCBUS3UF1_RS01275"
                     /old_locus_tag="TCCBUS3UF1_2730"
     CDS             302441..303199
                     /locus_tag="TCCBUS3UF1_RS01275"
                     /old_locus_tag="TCCBUS3UF1_2730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433936.1"
                     /db_xref="GI:752794505"
                     /translation="MVLALALAGGLGSLLAGCTPSAQCTTPICLVAHWPLNETAGATS
                     VADQVLNPILNTGVPMPGSVQGFPGSGGPLAVSGQVGGALYFPGNGASYVRVPHTPDL
                     NLGYGSLYLEAWVAPVQCGLGAYYPILDKWDASTNSGYALYLEGTGPGQVRVGFRLGG
                     SAFFSSTSFPANFTPPVGGTWTQVAVKVDGNSGSFTVNGAPAGTFAAPSGSTTNSLDL
                     WLGALHTPPSGKVHCEIALDEVKVGRVNPMFSGQ"
     gene            303208..304452
                     /locus_tag="TCCBUS3UF1_RS01280"
                     /old_locus_tag="TCCBUS3UF1_2740"
     CDS             303208..304452
                     /locus_tag="TCCBUS3UF1_RS01280"
                     /old_locus_tag="TCCBUS3UF1_2740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_014514686.1"
                     /db_xref="GI:504327584"
                     /translation="MKRLWPLLPLAFLLPACGPGGPQALNVVLVDGLGEPLQPLAAAW
                     RLGPPPSTSGMPWNALPVAQSSWSLPIPPGARFQVAFRCPNAGLTQFYLSLDLNRAEL
                     GNKLMVRCPSVYASPTVTVTGSVSLPLQSGTAASARDQASFTGGGFSGLALPQGSGRE
                     VAVFGVDAGGTSYFGRTSPLSVGPGTTSVGPIPLASAPSLTATTPLGFFSSARLLLNS
                     FVPMPLASWSGGSQAVARPALLGGDLFEFWTCHGSSCAIRRLDQASPTVAAGATVSLS
                     VPPLSFSGTQTHTPTALPTLANLAFSGFSPTLGPLGYALFLGEPGVRYWRHYLSPGAL
                     GNATSYYLDVENAPGFSGVVPTPGQSVQLRATAFAGDQPLGVLLAARPIPEETLPAHT
                     LFLDWAWPVHLEAALLQASFTW"
     gene            complement(304442..305575)
                     /locus_tag="TCCBUS3UF1_RS01285"
                     /old_locus_tag="TCCBUS3UF1_2750"
     CDS             complement(304442..305575)
                     /locus_tag="TCCBUS3UF1_RS01285"
                     /old_locus_tag="TCCBUS3UF1_2750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514687.1"
                     /note="catalyzes the formation of
                     N-succinyl-2-L-amino-6-oxoheptanedioate and L-glutamate
                     from N-succinyl-L-2,6-diaminoheptanedioate and
                     2-oxoglutarate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyldiaminopimelate aminotransferase"
                     /protein_id="WP_014514687.1"
                     /db_xref="GI:504327585"
                     /translation="MSRVPEPSVFLVVDEAKRKARERGVRLLDLSIGSTDLPPPPGPL
                     QALREALDDPSTYGYCLKSCTLPFLEAATRWYRERYGLFLDPRREALALIGSQEGLAH
                     LLLALTEPKDLLLLPEVAYPSYFGAARLASLETHPIPLREDGLADLSRVPEEVWRKAR
                     VLLLNYPNNPTGAVADWAYFEEALGLAKRYGLWLVHDNPYVDQVYEGEAPSPLALPGG
                     RERVVELFSLSKSYNLAGFRLGFALGNEEALSRLERVKGVVDFNAYAGILRLGVAALA
                     TPKETTRGFARVYRERALGMAKALEGSLDLLPPRATMYLWGRLPGGLDDLGFVLDLVA
                     RGVALAPGQGFGPGGRGWVRIALVRPLEELLRAAGIIREVLTR"
     gene            complement(305568..306062)
                     /locus_tag="TCCBUS3UF1_RS01290"
                     /old_locus_tag="TCCBUS3UF1_2760"
     CDS             complement(305568..306062)
                     /locus_tag="TCCBUS3UF1_RS01290"
                     /old_locus_tag="TCCBUS3UF1_2760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdenum cofactor synthesis domain protein"
                     /protein_id="WP_014514688.1"
                     /db_xref="GI:504327586"
                     /translation="MFRVGILTVSDKGFRGEREDTTHLALRETLKGGPFAVAAYEIVP
                     DEPPMIKKVLRLWADREGLDLILTNGGTGLSPRDRTPEATREVLEREVPGLPELMRLK
                     GLERTPMAALSRGVAGVRGRTLILNLPGSPRGARESLEAVLPILPHALSLVTGKVWRE
                     GHHE"
     gene            complement(306077..307120)
                     /locus_tag="TCCBUS3UF1_RS01295"
                     /old_locus_tag="TCCBUS3UF1_2770"
     CDS             complement(306077..307120)
                     /locus_tag="TCCBUS3UF1_RS01295"
                     /old_locus_tag="TCCBUS3UF1_2770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_014514689.1"
                     /db_xref="GI:504327587"
                     /translation="MATLEAVLDLLKPPHRGSATPQEEEAFRRLRAFLEAQGLRVQEI
                     PFRGVPSYGWELLGISLLLALSPLSPLPPLLGALGFFLYFQGRRPWGFLLDRHPSRNL
                     LCWKGEGEKAVLLLAHVDTAKTFFLYHPGRVRAFRSNFLLNALLAFLAPLLALTPWKW
                     AVGAYFLLQAGLLLHRELFAPYVEGGNDNASGVAVATALFLETEPRPGFRLGLALTGC
                     EEVGALGAKALLPHLPPDTLVLNLDNVGRGELFYVEGEGMLRYFPYHGALLEAARKTP
                     GAKPLRYRLAYLDTLPLAQRGFPSLGLIRLEGGVPPDWHWPTDTFARLDRKALEETFT
                     YAQRILGRVLQEA"
     gene            307141..307722
                     /locus_tag="TCCBUS3UF1_RS01300"
                     /old_locus_tag="TCCBUS3UF1_2780"
     CDS             307141..307722
                     /locus_tag="TCCBUS3UF1_RS01300"
                     /old_locus_tag="TCCBUS3UF1_2780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine acetyltransferase"
                     /protein_id="WP_014514690.1"
                     /db_xref="GI:504327588"
                     /translation="MWSFPQRLVGRYVRLEPLSLAHLSGFLAQFDPEVYRFLSRMPLE
                     PTEEALKAHLEGLLAEPGRVNWAVYLGEELAGRISVIAPDPEHRKLEMGTMIFKPFWG
                     SPANKEAKYLLLRHAFEVLGAERVQFKVNLKNERSQRALESLGAVREGVLRKNRRLPD
                     GTFRDDVVYSILREEWPGVRAGLEARLYGPGSP"
     gene            307703..308887
                     /locus_tag="TCCBUS3UF1_RS01305"
                     /old_locus_tag="TCCBUS3UF1_2790"
     CDS             307703..308887
                     /locus_tag="TCCBUS3UF1_RS01305"
                     /old_locus_tag="TCCBUS3UF1_2790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014514691.1"
                     /db_xref="GI:504327589"
                     /translation="MAQEALSLLVLSLTYLGLALGGLPGYRMNRAGVALVGASFLLLL
                     GTLDLEAAWQALDAKTLVFLFGVMVLNAHLAYAGFFGLAAERLLGLARTPLALLVLLT
                     LGAGGLSALFLNDTMALLLTPLVLALTRGLGLNPVPYLLALMGAVNTGSLLTPTGNPQ
                     NILVASLSGLAYLDFVRALWLPALLGLLLQVVLLAFLYPEVRSRKPLPPLPPLRYRLH
                     RPLLRKGLGVAVGLLLAFLLGYPLAQGALVGAGLLLFTRRLRSERYFLRVDWELLVLF
                     GGLFVVTEGVRRLGLAEALLPLGESPLGLLLAATLLSLLISNVPAVLLLAPLVNDPRD
                     WLLLAGGSTLAGNLTLLASVANLIVAEGARKEGLGVGLGEHLRFGLPLTLLTLALLYG
                     LL"
     gene            complement(308879..310183)
                     /locus_tag="TCCBUS3UF1_RS01310"
                     /old_locus_tag="TCCBUS3UF1_2800"
     CDS             complement(308879..310183)
                     /locus_tag="TCCBUS3UF1_RS01310"
                     /old_locus_tag="TCCBUS3UF1_2800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_014514692.1"
                     /db_xref="GI:504327590"
                     /translation="MDLLEAKALLERGGTTPLALLEEALERARAFADRNALAYLDEEG
                     ARKEAARLAEEQRRGQVRGPLHGLPLTVKDLFPVKGMPTRAGTQAPLPPLPEEAQAVR
                     RLKEAGALIFAKTHMHEIALGITGENPWTGPVRNAIDPTRQAGGSSGGSAVAVALGIG
                     LASLGTDTGGSIRIPAAFNGVVGFKPSFGRISLEGALPLSRSTDHAGPLARTVRDAHF
                     LTEILAGESIPLEGPQNPTFGVPLDFLEGRLGQGVRKAFQRLLEDLPLLRAEVREVSL
                     PLPGAYEVYTRLVRYEAARIHEKALKEHPEGFSPSVREALLAGLALTEKDYRDAVAER
                     EALRLSLTKALRGVDALLLPVQPLPAPPLGTEEVELESGRKGHREAFLTLTLPFSLLG
                     VPALSLPFARVDGMPVGLQVVGPYAEDGKVLAIGGWLEARLK"
     gene            complement(310164..311393)
                     /locus_tag="TCCBUS3UF1_RS01315"
                     /old_locus_tag="TCCBUS3UF1_2810"
     CDS             complement(310164..311393)
                     /locus_tag="TCCBUS3UF1_RS01315"
                     /old_locus_tag="TCCBUS3UF1_2810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514693.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiI"
                     /protein_id="WP_014514693.1"
                     /db_xref="GI:504327591"
                     /translation="METLVLVNLFHELALKGGNRPLFLKRAKAHVQRALKGTEARLEA
                     LWPLALLFRLPQEAWPEARARLGETLGVESFARVLRTAPDLEALKAALAGILEDGGFA
                     SFRIRAQRSDKGFPLTSPEVERLLGAFVRERTGAQVRLKGAEREFRVRLLPGAALLEA
                     ERHLGPGGLPPGVSGKVVALLSGGIDSPVAAYRLMRRGAEVALVHFHPFPLLPGGSRE
                     KAKALAERLVRFQHRLRLHLVPFSEVQRQILLEAPKAYRVVLYRRFMLRIAEAIAREE
                     GALALATGDSLGQVASQTLENLHVMNGAATLPVFRPLIGMDKQEIKAEALRLGTYAIS
                     ILPDEECCTLFAPKHPVTRADLEVVLEVERRLPLKDLVALALREREVVAYAWPGRKPL
                     GEKAGQAFIMEHGPAGG"
     gene            complement(311510..313522)
                     /locus_tag="TCCBUS3UF1_RS01320"
                     /old_locus_tag="TCCBUS3UF1_2820"
     CDS             complement(311510..313522)
                     /locus_tag="TCCBUS3UF1_RS01320"
                     /old_locus_tag="TCCBUS3UF1_2820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_041433937.1"
                     /db_xref="GI:752794506"
                     /translation="MKARATCPLDCPDACSLLLTLEGGRLVRVEGDPRHPITQGFACG
                     KTYRYPERVRERLLYPLRRVGRKGEGRFERVSWEEALEGIAARLRAILDRYGGEAVLP
                     YHYAGTMGLVENQHPLAFFRAIGASELLETICASTGSAAWEMTYGPRMAPDPEEIPEN
                     ARYLLLWGVNSLATHSHLTPFLKEAKRRGAKVVHIDPYANLTSRFAHEHLKLRPGTDA
                     ALAYALAHVLFREGLVDWAYLEEAATGVEAFQEAAEAWTPERAEALTGVPAPAIRRLA
                     RELGEARRVFLRVGYGMTRHPGGGNSLRAVLLLPALLGAWRYPGCGAMLSTSGAFPLN
                     KRFLGGRHLLEGRHPHRGYFRPNPGVRAINMNQLGTALTGLKPPIRALFVFNTNPLVV
                     APNTGKVRAGLEREDLFTVVLEQVMTETARYADYLLPATLFYEHPDLYTSYGHYYLSW
                     NEPLAEPQGEARPNTWVFRELAQRLGLEEPTLYWSAEEVARSLLDTDHPYLEGITLER
                     LKAEGFLKLRLPKPFLPFARGPVRFSPPPQVLPTEPLPDYPLVLLTPPAPRFLNSTYG
                     DVAALAEAEGGEPLLLIHPQDAEARGVTDGGLVYLRSPWGQVVRRARVTEAPIPGTVV
                     LEGIWWEKWAPDGKGINHLTSEGLTDLGGGSTFHATPVEVEPLRLA"
     gene            313553..314179
                     /locus_tag="TCCBUS3UF1_RS01325"
                     /old_locus_tag="TCCBUS3UF1_2830"
     CDS             313553..314179
                     /locus_tag="TCCBUS3UF1_RS01325"
                     /old_locus_tag="TCCBUS3UF1_2830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514695.1"
                     /note="cleaves the the RNA-DNA junction of a RNA-DNA/DNA
                     heteroduplex; does not have RNase H activity; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="WP_041433938.1"
                     /db_xref="GI:752794507"
                     /translation="MEALEAPFWRQGLRVAGVDEAGRGAWAGPIVVGAVVLPPGVYPF
                     RDSKRLSPQVRRRLAAEVRRVALGFALGVAEVAEVDRLGVLKATLLAAERALALLRPP
                     PEALVTDYLALSTPLPLLAPPKADEESPSVAAASILAKVHRDALMEELDRLYPGYGFA
                     QHKGYGTEEHREALFRLGPSPVHRRCFAPVAQAPLRFSEAEGEGEGLS"
     gene            314194..314664
                     /locus_tag="TCCBUS3UF1_RS01330"
                     /old_locus_tag="TCCBUS3UF1_2840"
     CDS             314194..314664
                     /locus_tag="TCCBUS3UF1_RS01330"
                     /old_locus_tag="TCCBUS3UF1_2840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514696.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514696.1"
                     /db_xref="GI:504327594"
                     /translation="MRFFLVLVAGLLSACTVTLEGITLTYRLDLTPAILRFEPDRGAG
                     ATYFVGEEVRFLLTLESPGWVSLVAVDPDGRTYEFDRLYLGRGTHLLPPGAYRYTLTP
                     PRGLYRVRAVYTDHEPGSVRLEGMFTDWEARLRVYLEASRTRRHQVVETHFYLR"
     gene            314746..315825
                     /locus_tag="TCCBUS3UF1_RS01335"
                     /old_locus_tag="TCCBUS3UF1_2850"
     CDS             314746..315825
                     /locus_tag="TCCBUS3UF1_RS01335"
                     /old_locus_tag="TCCBUS3UF1_2850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514697.1"
                     /db_xref="GI:504327595"
                     /translation="MKRRDFLKKAGIGVAASAAFGPVFAQAQPTVRWRLASSFPKSLD
                     TIYGAAEVLAERVSELTGGRFQIRPYQAGELVPGLQVMDAVQQGTVEMGHTASYYYVG
                     KAQVLAFDTAVPFGLTARQQNAWMYHGGGIELFRPIFADFGIIQFPGGNTGVQMGGWF
                     RKEIKTVADLKGLKMRIPGPGGQVMSRLGVVPQVIAGGDIYPALERGVVDAAEWVGPY
                     DDEKLGFYKVAKYYYYPGWHEPGPMLSFYVNLREWQKLPKDYQQAIEVAAAEANLWMM
                     AKYDRLNAPALQRLIKAGVRLRKWPAEVMKAAQKAALDWYEEEAAKDATYRKVYTAWK
                     AFREEQYRWFGVAELGYEGFAFPAS"
     gene            complement(315878..317371)
                     /locus_tag="TCCBUS3UF1_RS01340"
                     /old_locus_tag="TCCBUS3UF1_2860"
     CDS             complement(315878..317371)
                     /locus_tag="TCCBUS3UF1_RS01340"
                     /old_locus_tag="TCCBUS3UF1_2860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_014514698.1"
                     /db_xref="GI:504327596"
                     /translation="MSLESLMPPLMFLALIVFLLSGYPVAFSLGAVGIVFGFLGIALD
                     IFPAPLLRAMPDRIFGIMSNQLLLAIPFFTFMGIILEKSGLAEDLLDTMGKLFGPLRG
                     GLALSVVFVGAILAATTGVVAASVMAMGLISLPIMLKYGYNPRFASGVILGSATLAQI
                     IPPSVVLIVLSDQLGVSVGDMYQAALIPAGLTVAFYFLYVVYVALFRPRWAPALPLEA
                     RPDAGKETGAAFALLSYLLVGVGAYAVGRFLPAWAEWLEILLALGLWTLILLPWIRKN
                     PLLRKALLSMVPPLVLIFLVLGTVLIGLATPTEAGAMGVVGALILAALNRRLSFPVLY
                     GAMEGTARLTAFVIFILIGSTLFSLVFRGVDGDLWVEGFLTGLPGGEVGFILFVMVLV
                     FLLGFFIDFFEIAFIALPLLAIGADALGIDKLWFGLLVGVNLQTSFLTPPFGFALFYL
                     RNVAPASVRTGDIYLGGVPFIGLQLLVLLLTYLLREPILRFVHGAGG"
     gene            complement(317368..317907)
                     /locus_tag="TCCBUS3UF1_RS01345"
                     /old_locus_tag="TCCBUS3UF1_2870"
     CDS             complement(317368..317907)
                     /locus_tag="TCCBUS3UF1_RS01345"
                     /old_locus_tag="TCCBUS3UF1_2870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014514699.1"
                     /db_xref="GI:504327597"
                     /translation="MRFLLGLSRAIDTLTEGVGRAVVWLVLLVALLSAGNAIMRYGFS
                     YSSNAYLEAQWYMFSLIFLLGGAYALKHNAHVRIDLVFGRLSRRTQAWIDLVGTVLFL
                     LPMALGVIYLAWPWAMNSFWGKEMSPDVGGLPRWPIKLALPLGFALLALQGLSELIKR
                     IAFLTGHLQLKEEREEVVE"
     gene            complement(317995..319203)
                     /locus_tag="TCCBUS3UF1_RS01350"
                     /old_locus_tag="TCCBUS3UF1_2880"
     CDS             complement(317995..319203)
                     /locus_tag="TCCBUS3UF1_RS01350"
                     /old_locus_tag="TCCBUS3UF1_2880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008630783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_014514700.1"
                     /db_xref="GI:504327598"
                     /translation="MRHGPGWFLSLSAYWFATSLKWFLVLLVLLPAKVAEVSPPEEKA
                     TRLGFLFGLGAVMAILGPPIMGYLSDRLGRRRPFLLLGSLLTALALLLLAHAPSYGVL
                     LLAYLLLQLADDLATGPYSALIPDLVPKGERGTASGYMGVLQVSGQVLGGVVGFLLPL
                     HPQAYLAALVNLLGAFWSLKLVPERLPTRSERPFLKAMAAPWRDRDFLLVYLTRFLVM
                     LGFYLAQTYLQYYLGDVVQTFQAWGRSLTEEPFQAVALLGLLISLGAGLSSVPAGRAS
                     DRMGRKPLIYLSGAGLGLLMPFLLLFPRYDLLLFLSLFFGLFYGVYLAVDWALVSDIL
                     KEPEAHATQMGLWQTSIVVPQVLAGAFGRPLDLLNAQAPGLGYLVLFGLAGGFFLLGA
                     FLVAPIRRAR"
     gene            complement(319214..320047)
                     /locus_tag="TCCBUS3UF1_RS01355"
                     /old_locus_tag="TCCBUS3UF1_2890"
     CDS             complement(319214..320047)
                     /locus_tag="TCCBUS3UF1_RS01355"
                     /old_locus_tag="TCCBUS3UF1_2890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_014514701.1"
                     /db_xref="GI:504327599"
                     /translation="MRLLAAVDLGDTLEGVVASARFLQGGLGIPAEVVHVVPTPYLEA
                     LARRFPELGPSLEAALGQVEAKVEAVLRGTGLKARVLRGFPAQVVAGEALRSKAVLLG
                     HKGEGSLEVLARGGLARYLLHRGEVPVLLLPRALKGVRRIAVGLDESPASLAAFRVAE
                     AWGRALGAEVLGLHLVSGEGGCCFPTYLDPRGLALAEVLERARAHLEALLRATGVVEV
                     SKGEDELDLLRLAEARGADLLVLGSKAKSTWRHRLGRMVETLVARTPLPLLVVPEAAV
                     W"
     gene            320079..320897
                     /locus_tag="TCCBUS3UF1_RS01360"
                     /old_locus_tag="TCCBUS3UF1_2900"
     CDS             320079..320897
                     /locus_tag="TCCBUS3UF1_RS01360"
                     /old_locus_tag="TCCBUS3UF1_2900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="WP_014514702.1"
                     /db_xref="GI:504327600"
                     /translation="MLWLRDRALDLSRPRLMGILNLTPDSFSDGGLYLDPERALARAR
                     AMVAEGADLLDLGAESTRPGAEPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAE
                     EALRMGAHLLNDVTGLRDERMLALAARFGVAAVVMHMPVPDPKAMMAHARYGDVVAEV
                     RAFLKAQAERALRAGVPQVVLDPGFGFGKLLEHNLALLRRLEAIVELGHPVLVGLSRK
                     RTIGELTGVEAPGERVLGSVAAHLYAVLKGARILRVHDVGAHREALAVWNALWG"
     gene            320900..321256
                     /locus_tag="TCCBUS3UF1_RS01365"
                     /old_locus_tag="TCCBUS3UF1_2910"
     CDS             320900..321256
                     /locus_tag="TCCBUS3UF1_RS01365"
                     /old_locus_tag="TCCBUS3UF1_2910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_014514703.1"
                     /db_xref="GI:504327601"
                     /translation="MGVIALLGLEFYGRHGVMPEEGRLGARFVVDLWLSVPFEGKGDR
                     LEETVDYAAVYALVEEAVRHRRFYLIEALADHLAEALIQAFPRLEGVRVRVHKPHAPI
                     PGVFRDVYAETEKKRS"
     gene            321433..321975
                     /locus_tag="TCCBUS3UF1_RS01370"
                     /old_locus_tag="TCCBUS3UF1_2930"
     CDS             321433..321975
                     /locus_tag="TCCBUS3UF1_RS01370"
                     /old_locus_tag="TCCBUS3UF1_2930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433648.1"
                     /db_xref="GI:752794216"
                     /translation="MERVAIFIDGSNLYKGLVQHLGSDYRLNFVEFITLLTAGRRLLR
                     AYYYNAPLPPEDPAAKAHQSFLNYLKRVPYVAVRLGRLERRADGFVEKGVDIQIAIDI
                     LRLAYADAYDVAVLVSGDGDFAEVVRVVQDMGKQVENTTFHALSSHRLAQQADRFYPL
                     DDFPWERLRAPSLPQASEGE"
     gene            complement(321996..322409)
                     /locus_tag="TCCBUS3UF1_RS01375"
                     /old_locus_tag="TCCBUS3UF1_2940"
     CDS             complement(321996..322409)
                     /locus_tag="TCCBUS3UF1_RS01375"
                     /old_locus_tag="TCCBUS3UF1_2940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015715951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="WP_014514706.1"
                     /db_xref="GI:504327604"
                     /translation="MERTFVMVKPDGFRRGLVGEILARFERKGFRLVGLKALRIPQEL
                     AEKHYAEHREKPFFPSLVAFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIR
                     GDFATTIDENVIHGSASLEDAEREIALFFRPEELL"
     gene            complement(322431..323363)
                     /locus_tag="TCCBUS3UF1_RS01380"
                     /old_locus_tag="TCCBUS3UF1_2950"
     CDS             complement(322431..323363)
                     /locus_tag="TCCBUS3UF1_RS01380"
                     /old_locus_tag="TCCBUS3UF1_2950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine phosphatase"
                     /protein_id="WP_014514707.1"
                     /db_xref="GI:504327605"
                     /translation="MPGLAFALETHPGLKRPKNEDALGYTLTPWGGVFVVADGMGGHR
                     TGEVAARLAVETILAHLKEGEPSPKALLQAFEEANARIHGEAQRPENRGMGTTATCLL
                     LDLPYALLAHVGDSRAYLLRQGELTLLTEDHSWVAERVRQGLLTPEEARTHRWRNVIT
                     NALGSFPQARVDLLGLKLEPGDVFLLCTDGLSGVLDERTLGEVLRHFPPQEAASRLVA
                     LANEWGGPDNISAIVVRVPEELPRNPRPYALPLEAAQGKPVGLKLGEEPDELPTQVLE
                     PERKGARLGWRDVLLIGLWILVVGYILLGYFRKP"
     gene            323497..324927
                     /locus_tag="TCCBUS3UF1_RS01385"
                     /old_locus_tag="TCCBUS3UF1_2960"
     CDS             323497..324927
                     /locus_tag="TCCBUS3UF1_RS01385"
                     /old_locus_tag="TCCBUS3UF1_2960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514708.1"
                     /db_xref="GI:504327606"
                     /translation="MRWEKIAPYTYRIPRQGKMRVDAVFFASEEILRDLEAENYASLA
                     QLANVATLPGIVEPALAMPDIHWGYGFPIGGVAAFDPEAGGVVSPGGVGFDINCGVRL
                     LVSALTLEDLLPRQRELADALFRLVPSGVGSERKDVRFSKKELKEILKEGAGWLVRKG
                     FGHPEDLRFIESEGRLPWANPDKVSERAFERGAPQIGTLGSGNHFLEVQYVDQVYDLE
                     AAEAYGLFPNQIAVLIHTGSRGLGHQVCQDYVERFLKVAPRYGIELVDKQLAAAPIRS
                     PEGEDYLQAMAAAANFAFANRQLIAHFVREAFEAVGFTPREHGLRVLYDLAHNNAKFE
                     EHGGRRVLVHRKGATRAFGPGYPEIPREYQRVGQPVLVPGDMGRYSYVLAGTEGAMAH
                     AFGSSCHGAGRKMSRHQAKRVARERNLVKELAERGILVRAATRATVDEEMPEAYKDVS
                     SVVEAVQGAGIGKKVARLRPLIVVKG"
     gene            324962..326439
                     /locus_tag="TCCBUS3UF1_RS01390"
                     /note="periplasmic protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(326436..326882)
                     /locus_tag="TCCBUS3UF1_RS01395"
                     /old_locus_tag="TCCBUS3UF1_2990"
     CDS             complement(326436..326882)
                     /locus_tag="TCCBUS3UF1_RS01395"
                     /old_locus_tag="TCCBUS3UF1_2990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA pyrophosphatase"
                     /protein_id="WP_041433650.1"
                     /db_xref="GI:752794218"
                     /translation="MAVPLLGEVLLLTRRSPHLPTHAGQVSFPGGVVEPGESPVEAAL
                     REAEEEVGLGGLEPLGFLSPTLSPQGFLVQPVVVHREDLPPLRPNPLEVAEVLLAPLE
                     ELLRVEPWSEVRGGRTVWHFPWRGVDIWGVTGNILKEFLEVWQRAS"
     gene            complement(326912..327508)
                     /locus_tag="TCCBUS3UF1_RS01400"
                     /old_locus_tag="TCCBUS3UF1_3010"
     CDS             complement(326912..327508)
                     /locus_tag="TCCBUS3UF1_RS01400"
                     /old_locus_tag="TCCBUS3UF1_3010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514711.1"
                     /note="functions in degradation of stringent response
                     intracellular messenger ppGpp; in Escherichia coli this
                     gene is co-transcribed with the toxin/antitoxin genes
                     mazEF; activity of MazG is inhibited by MazEF in vitro;
                     ppGpp inhibits mazEF expression; MazG thus works in
                     limiting the toxic activity of the MazF toxin induced
                     during starvation; MazG also interacts with the GTPase
                     protein Era; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase"
                     /protein_id="WP_014514711.1"
                     /db_xref="GI:504327609"
                     /translation="MGGMERLLEVMRRLRGPGGCPWDRAQTHASLVPYLLEEASEAAD
                     ALLEGNPQAMAEELGDVLLQVAFHSVIAEEEGRFTYGDVERGIVEKLIRRHPHVFGEA
                     SAHTPEEVKARWEALKAEEGKEERPCGLPQHLPTLLRAYELQRRGVEPGSEEGLRAAL
                     ERGDLEEALWNLVGLFAKRGLDPESALRRRSLRACREA"
     gene            complement(327483..327932)
                     /locus_tag="TCCBUS3UF1_RS01405"
                     /old_locus_tag="TCCBUS3UF1_3000"
     CDS             complement(327483..327932)
                     /locus_tag="TCCBUS3UF1_RS01405"
                     /old_locus_tag="TCCBUS3UF1_3000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514712.1"
                     /db_xref="GI:504327610"
                     /translation="MRSRLAGILLSLPFFLQLLGLGDTPLGGGLCGEVFRVGDPSLAL
                     QTPGFWYGLLFMLLLALELGFGLSLLLLPLLEVRLSPGWLRGGRYLVGLLLLLFLLTR
                     TAGLPFPGPSGWALEPAPLDPLSLLLVGLSLAGGVLLGENGRHGAAS"
     gene            complement(327942..328691)
                     /locus_tag="TCCBUS3UF1_RS01410"
                     /old_locus_tag="TCCBUS3UF1_3020"
     CDS             complement(327942..328691)
                     /locus_tag="TCCBUS3UF1_RS01410"
                     /old_locus_tag="TCCBUS3UF1_3020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514713.1"
                     /db_xref="GI:504327611"
                     /translation="MTLLFLREVGRNPWGLGLLLLPALLALGFQGRGEGVGLVGLYSG
                     LLLLLPPLALALAVPLLASREEWAFLLGLPLPPGKAFAEGVLGVFLGLGLPLLPGLLL
                     GAGLLGLSPGSTLWLLLSGVGLLAFWVGVAALLSALLLEERRALGLGFGLFGLGNVLY
                     GPLVVALAVRLQDHPLEGLLSLALLLNPQEIHRVALLSGVKAPVLTGPLGYLVAERLG
                     AVAPLWGLAYLFAFGFLLTLLAALVFARRDR"
     gene            complement(328688..329200)
                     /locus_tag="TCCBUS3UF1_RS01415"
                     /old_locus_tag="TCCBUS3UF1_3030"
     CDS             complement(328688..329200)
                     /locus_tag="TCCBUS3UF1_RS01415"
                     /old_locus_tag="TCCBUS3UF1_3030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514714.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514714.1"
                     /db_xref="GI:504327612"
                     /translation="MERRRFLWVLAGSLLPWARGAPRALRVGVEACPYCFMTLLDARH
                     AAQAVNPQGKAFFYDDPACLLDQLNGWGGPSLRAREVYLADYGESTRSEPRWVPAEGA
                     ILYHHPRIRTPMGSGLLAFARREALEGHLRERPERAGGRVLSWAQALKEGGKRPWVPA
                     AFFPPPPKAP"
     gene            complement(329210..329872)
                     /locus_tag="TCCBUS3UF1_RS01420"
                     /old_locus_tag="TCCBUS3UF1_3040"
     CDS             complement(329210..329872)
                     /locus_tag="TCCBUS3UF1_RS01420"
                     /old_locus_tag="TCCBUS3UF1_3040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_014514715.1"
                     /db_xref="GI:504327613"
                     /translation="MRNRREVLKALGGLVLGSPALAQMAPGEGTPGGVRVPAKPIPWE
                     GGSCAFCEMPIKTPEGAWRGRTFPKGFFEQTYSQIAFEKPRPAPHNPKETVEALHFES
                     IACMVNYAWVHGLRDGEGATFYVTDRGAYDPARPQETVRLVPARSATFYWGERMMVVM
                     NAKLLAFASAKAAQDFAEAHKAQHGRQRFYSFQTLLDLAPLPEMNLVALLARHAGLLQ
                     NR"
     gene            complement(329856..330533)
                     /locus_tag="TCCBUS3UF1_RS01425"
                     /old_locus_tag="TCCBUS3UF1_3050"
     CDS             complement(329856..330533)
                     /locus_tag="TCCBUS3UF1_RS01425"
                     /old_locus_tag="TCCBUS3UF1_3050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_041433651.1"
                     /db_xref="GI:752794219"
                     /translation="MVAVQDLRKDGRLRGVSLEARGGVVGLLGPNGAGKSTLLALLAG
                     RLKPSAGKARLLGLDPRDPRALALRAYLPQSPRLFPHLKGKEVLEGARRAKGLGLEAL
                     EEAVARMGLEGVWGKPVGTLSGGERQRLALAASLMGNPPIWLLDEPTAALDPKGRERF
                     WAWVGEKGEGVALLALHHVEEAQRAQRLVLLKGGKVLEEGPPERLLGPRGERLPWLME
                     VLYEEPA"
     gene            complement(330512..331732)
                     /locus_tag="TCCBUS3UF1_RS01430"
                     /old_locus_tag="TCCBUS3UF1_3060"
     CDS             complement(330512..331732)
                     /locus_tag="TCCBUS3UF1_RS01430"
                     /old_locus_tag="TCCBUS3UF1_3060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein"
                     /protein_id="WP_014514717.1"
                     /db_xref="GI:504327615"
                     /translation="MSHLPPLPWGVMKRASLLLALAGVSLAAPVLRLEGEVEGPLVLT
                     TPGLEVEAEGAVLRGRKGHTLSLLAPGIRVRGLKVVGAGGGDDFFEPDAAVYLRGCEG
                     CLLEGLEVEGAPAAVRLEDSPRAKVQGLRARGLGASPGVLVYRSPGAQVVESHLAGFM
                     DGIYAEYSPGLVLRGNRLTGHGRYGFHVMFSWHVRVEGNESWGNGVGNAVMHGAENRV
                     RGNRLHGHRSPLAYGLLLQDERGSQVEANRFQENTLGLVLLDAAQVGVRGNRFQENGT
                     ALRITREKGGNSARVEGNLFLGNLYDLLVDDPEAKAQVVGNAYDRASGLPVPHLPSSS
                     FALLLARQPELSLLALSPGVLLWEGAEAQVPGLRLLSLADPQALALPPSRRAHAPLLL
                     LGLLGGVLWWRFRT"
     gene            331790..332206
                     /locus_tag="TCCBUS3UF1_RS01435"
                     /old_locus_tag="TCCBUS3UF1_3070"
     CDS             331790..332206
                     /locus_tag="TCCBUS3UF1_RS01435"
                     /old_locus_tag="TCCBUS3UF1_3070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_041433653.1"
                     /db_xref="GI:752794221"
                     /translation="MRHLAVLAFLGLALAQPLAVPGWVRLVPPGVKDTAAYLTLENRG
                     QVALRLVGAETPVAQRVSLHREHREHRGGHTVLGMRPLPHLDLPPGARVAFRPGGYHF
                     MLEGLKRPLKAGEKVELVLKFADGTRLRVVLPVEMR"
     gene            332203..332790
                     /locus_tag="TCCBUS3UF1_RS01440"
                     /old_locus_tag="TCCBUS3UF1_3080"
     CDS             332203..332790
                     /locus_tag="TCCBUS3UF1_RS01440"
                     /old_locus_tag="TCCBUS3UF1_3080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transporter"
                     /protein_id="WP_014514719.1"
                     /db_xref="GI:504327617"
                     /translation="MRRRIFPLLAVLLLVGLAYWLLPKGGHSFYGTRLLNPKPVDFTL
                     QGPSGPVRLGEMGGRLVLLFFGFVHCPDVCPTTLIALKRAYERLSPEEQARVRVVFVS
                     VDPDRDTPEVSDRYAKGFHPSFLGLSGSPEAVQEVARTFGVYYQKTQYRGPGEYLVDH
                     TATTFVVQDGKLVLLFSPEKVEATDKVVADLRALF"
     gene            complement(332797..333591)
                     /locus_tag="TCCBUS3UF1_RS01445"
                     /old_locus_tag="TCCBUS3UF1_3090"
     CDS             complement(332797..333591)
                     /locus_tag="TCCBUS3UF1_RS01445"
                     /old_locus_tag="TCCBUS3UF1_3090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="WP_014514720.1"
                     /db_xref="GI:504327618"
                     /translation="MDSPLLYALLGGVFTWGLTAVGAASVFLWQEPSRKLLDGLLGFA
                     AGVMLAASVFSLLLPGMEIAQAQGMLPWVPAVVGFLLGGGLLRLLDRFLPHLHLGPGA
                     QEEGLHTAWRRTTLLILAITLHNFPEGLAVGVAFGAAGLDPSGAATLGGAVALAMGIG
                     LQNLPEGLAVAWPLRRAGIGAGRAWFYGQLSAIVEPLGAVLGALLVAEMQALLPYLMA
                     LAAGAMVFVIVEEVIPESQSEGNGDTSTFGVMVGFALMMALDVALG"
     gene            333657..334721
                     /locus_tag="TCCBUS3UF1_RS01450"
                     /old_locus_tag="TCCBUS3UF1_3100"
     CDS             333657..334721
                     /locus_tag="TCCBUS3UF1_RS01450"
                     /old_locus_tag="TCCBUS3UF1_3100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="WP_014514721.1"
                     /db_xref="GI:504327619"
                     /translation="MLDKLARLEEEYRELEGLLADPEVLKDPRRYQALSRRYAEMGEI
                     IALIREYRKVLQDLDGLEDLLDDPELKEVAKGEREALLARKEELERDLERHLLPKDPM
                     DERDAIVEIRAGTGGEEAALFARDLLEMYLRFAEEMGFETEILDSNPTDLGGFSKVVF
                     EVRGPGGYGTFKYESGVHRVQRVPATETQGRIHTSTATVAVLPKAEEADFQLNMDEIR
                     IDVMRASGPGGQGVNTTDSAVRVVHLPTGIMVTCQDSRSQIKNREKALMILRSRLLEM
                     KRAEEAERLRQTRLAQIGTGERSEKIRTYNFPQSRVTDHRIGFTTHDLEGVLSGRLQP
                     LLEALKRADQERQLEAMTEA"
     gene            334721..335188
                     /locus_tag="TCCBUS3UF1_RS01455"
                     /old_locus_tag="TCCBUS3UF1_3110"
     CDS             334721..335188
                     /locus_tag="TCCBUS3UF1_RS01455"
                     /old_locus_tag="TCCBUS3UF1_3110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015715940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutT"
                     /protein_id="WP_014514722.1"
                     /db_xref="GI:504327620"
                     /translation="MRREILVVAAILLDRQGRVLLVGNDWGRRGQVRYTLPGGTVEPG
                     ETVLDALVREVREETGLRVRGIEHLAYVIQVEDRRKNERTLAMAFRASYEGLLNPRDP
                     DGHIVEARFFTPEEVAARLSGHRPLQEPLLDYLSGERGRFYAYPGWGQPGVRV"
     gene            complement(335185..335850)
                     /locus_tag="TCCBUS3UF1_RS01460"
                     /old_locus_tag="TCCBUS3UF1_3120"
     CDS             complement(335185..335850)
                     /locus_tag="TCCBUS3UF1_RS01460"
                     /old_locus_tag="TCCBUS3UF1_3120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514723.1"
                     /db_xref="GI:504327621"
                     /translation="MDPGLEAAFRYVERLLFGDMERPGLTLYDLERLVGYPAKGDGPL
                     SYTLPRTKSLSGVQGVRFFYYPKDPGLQLIVEVEDLEGRKHLRHFRWNGFTWEVPEGK
                     RGDLKSTEEALGMAQLGEDYFLGYPREEALELEEAVRKGEALGAKYLLCPRCKARVFY
                     APAVRPAGVACPRCGNPTLLFKTLSGGEGNKDPLEALAEEQRALRKALEELTAYLKRK
                     LGP"
     gene            complement(335904..338840)
                     /locus_tag="TCCBUS3UF1_RS01465"
                     /old_locus_tag="TCCBUS3UF1_3130"
     CDS             complement(335904..338840)
                     /locus_tag="TCCBUS3UF1_RS01465"
                     /old_locus_tag="TCCBUS3UF1_3130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amylopullulanase"
                     /protein_id="WP_014514724.1"
                     /db_xref="GI:504327622"
                     /translation="MKLHGILIGLMMAPLALAQPLRVAILWHQHQPPYENPVTGQYEE
                     PWVRAHGVNDYPWMAEVLKEFPEIKVTFDYTSTLLKQIGDYLSGKAKDAYWRVSEKPL
                     SALSQEERAFIVARFFDLNPRFVEKSPRYRELQAKKARGEAFSDADLQDLRVLWNLYW
                     INIDYIERDPGLRALYRKDRGFTQEDVNYVLKKHLELMATILPLHRELWRKGQIDLIT
                     TPYYHPILPILLDKEAIRESNPALSLPKEPIAWPEDAAWQVRAGREYFKALFGQEPKG
                     MWPPEGAVSQKAAELYAQEGIGFLVTDEAILGKSGFPVNPATLTRIYHVEKDGKRVRL
                     FFRHRDLSDRIGFSYSGMPAERAVEDFIGTLLEIRRQVIGQNPNAVLTIALDGENAWE
                     NYPNNGNEFRRLLYRRLAEEERKGTLKTVLFSELLSEPSLPIARLGTGGWAGDFAMWA
                     GEPEENEAWDRLARARQAVLDFQAQGGDPKAVEKALGLIYQAQASDWFWWYGQDTGFP
                     NNPPFDEAFRAILQAVYGTIGQKPPEALFIAVRPPVQPQGTPGRVKPTLDGQAGPEEW
                     RGAAYLPDLEGTTMQTQDDLIRGVYLGFDEQHVYLRVDLKEGVRAKDLLGQGYRLHLY
                     ATTPKEEGGAAFPEGAEVPLGFPLQQRVTLDLDGVREGQATLVRFAYREGAWVLASSP
                     ADLAGRRAWVDQVVEMRIPYTTLRAEAGDTLRLALVLEKGGRVLDTAPNGSPLALSLP
                     QRLAGKEVLRLRDPEGDEHGPGTYTYPKEGAFAPYKGLFDLLEMRVLDSGATWTLVFT
                     FGEMTNPWGAPAGFSHQLLNVYLDFKEGGRTDTFAKGAKVAFDPAHPWDLFLKAAGWP
                     QYGQRVGFPDGTDTADGVVVGSNPADKQVILQLDKKYFNPTPGQRVCLYVLVGSQDGY
                     GPDHFRPVGKEAGPWNLGGAQNEDAPLVVDYLWPEKGTQEAMLSPYGGGKLAVLKPYC
                     LNWPAP"
     gene            338927..339976
                     /locus_tag="TCCBUS3UF1_RS01470"
                     /old_locus_tag="TCCBUS3UF1_3140"
     CDS             338927..339976
                     /locus_tag="TCCBUS3UF1_RS01470"
                     /old_locus_tag="TCCBUS3UF1_3140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014514725.1"
                     /db_xref="GI:504327623"
                     /translation="MSLLFSPLTLRGLRLKNRLAMSPMCQYSATAEGQVTDWHLLHYP
                     TRALGGVGLVLVEATAVLPEGRISPLDLGIWSEDHLPGLKELARRIREAGAVPGIQLA
                     HAGRKAGTTPPWEGGKPLGWRVVGPSPLPFAEGYPVPEALDEAGMERVLEAFVQGARR
                     ALRAGFQVVELHMAHGYLLSSFLSPLSNGRTDAYGGSLENRMRFPLRVAQAVREALPP
                     ELPLLVRVSATDWAEGGWGLPDTLAFAERLKALGVDLLDCSSGGVVPGVRVPAAPGFQ
                     VPFADAVRKRVGLATGAVGLITEAFQAETLLQAGSADLVLLGRVLLRDPYFPLRAAKA
                     LGVPAEVPPQYQRGF"
     gene            339997..341406
                     /locus_tag="TCCBUS3UF1_RS01475"
                     /old_locus_tag="TCCBUS3UF1_3150"
     CDS             339997..341406
                     /locus_tag="TCCBUS3UF1_RS01475"
                     /old_locus_tag="TCCBUS3UF1_3150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514726.1"
                     /db_xref="GI:504327624"
                     /translation="MRAFPPEREEDFAPLLPEEVVRRGLAYFQEGRVRRVFRLGERLW
                     GEVQGSGPEAYRVEVGPGLVGRCTCPHPRFPCKHAVALLYAHLERKAQDLAPLLAALA
                     PEEAKALLLRLAHLPQVAFLLAEALAPERAFREGVRRMRQAFRLGGGEEEARGLLLRL
                     EGAGREEVEAFLEALLQAPFDPEPYLEAALERYRALGPRLSFLLGLYLRHPSEALKEA
                     WLRLGEGRPEEALALLGGRDPEGRRRGLRAELLLRLGREEEALAALKEGLEGVEDYLH
                     LVGRLLALGRVAEALRYAEEARDWFGKDPRLLPLLDLLVAHRGLPEDHRARFALRPNL
                     EDYLALKAKLGRAFAQERPALLRPVEDPVLLARIYLLEEDWKALDRLLRRLPPKAYPR
                     LAEALEERLPQEALRLYREAAQARVAEGGRPAYREAAQILKRMARLDPEATRRTIREI
                     LQAHPRRRALREELAFLLA"
     gene            341474..341564
                     /locus_tag="TCCBUS3UF1_RS01480"
                     /old_locus_tag="TCCBUS3UF1_t40"
     tRNA            341474..341564
                     /locus_tag="TCCBUS3UF1_RS01480"
                     /old_locus_tag="TCCBUS3UF1_t40"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:341508..341510,aa:Ser,seq:tga)
     gene            341574..341666
                     /locus_tag="TCCBUS3UF1_RS01485"
                     /old_locus_tag="TCCBUS3UF1_t50"
     tRNA            341574..341666
                     /locus_tag="TCCBUS3UF1_RS01485"
                     /old_locus_tag="TCCBUS3UF1_t50"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:341608..341610,aa:Ser,seq:gct)
     gene            341701..342372
                     /locus_tag="TCCBUS3UF1_RS01490"
                     /old_locus_tag="TCCBUS3UF1_3160"
     CDS             341701..342372
                     /locus_tag="TCCBUS3UF1_RS01490"
                     /old_locus_tag="TCCBUS3UF1_3160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar fermentation stimulation protein"
                     /protein_id="WP_041433939.1"
                     /db_xref="GI:752794508"
                     /translation="MALPLPPLKPCRFLGRKNRFLVEADVGPLHLPNSGRMAELLLPH
                     APCFYWPKPTPKTRGRMVLVEREGVLVGVDATQANRLLELLLGQGVLGPLEALEREVR
                     LGGERLDFRARLGGREALLEAKNCNRVEGPLALFPDAPTARGARHLRLLAGWAREGGL
                     AYALWFVQHPQAQAFALDPADGALLEAAREAWEAGVRLRAYRVRPSLKALHLEGELPW
                     VWLPT"
     gene            complement(342361..343107)
                     /locus_tag="TCCBUS3UF1_RS01495"
                     /old_locus_tag="TCCBUS3UF1_3170"
     CDS             complement(342361..343107)
                     /locus_tag="TCCBUS3UF1_RS01495"
                     /old_locus_tag="TCCBUS3UF1_3170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="WP_041433656.1"
                     /db_xref="GI:752794224"
                     /translation="MEPLSISVGAVFLYALFTAIATGLGALPFLFTRNIVARHLGLAN
                     AAAAGLMLSASFGLIYEGVQASLGRTLLGVLLGLFFILLSHRYLEGREVSFGHMSALD
                     ARKALMMVGIMTLHSFAEGVGVGVAFGGGEALGVFITLAIAVHNIPEGLAISLVLIPR
                     GVSVLGASLWSIFSSLPQPLMAVPAFLFVEAFKPALPVGLGFAAGAMIWMAVAEILPE
                     ALKEAEAEGVATVLTLAVALMVAFQILLGG"
     gene            complement(343118..343810)
                     /locus_tag="TCCBUS3UF1_RS01500"
                     /old_locus_tag="TCCBUS3UF1_3180"
     CDS             complement(343118..343810)
                     /locus_tag="TCCBUS3UF1_RS01500"
                     /old_locus_tag="TCCBUS3UF1_3180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_014514729.1"
                     /db_xref="GI:504327627"
                     /translation="MNLLLLHGFTSHPLLTLGPLPQALREAGFSVRQPTLPGHGTRPE
                     DLLQVRWRDWLETARAAYRDLPEPRGVVGLSMGALLAAHLAAETPTALLVALAPALAL
                     KSPLAPLAPVLAPLIPRFPGPDSICDPECQRQNPNYPYFPTRAVLQLLALMGQTPRVL
                     PRVEAPALVVEAGKDKVVKGVRRYHRLLGSARKDYLVFPESGHDLLLDRDREAVARAV
                     QDWIIATSNHSQ"
     gene            343866..344648
                     /locus_tag="TCCBUS3UF1_RS01505"
                     /old_locus_tag="TCCBUS3UF1_3190"
     CDS             343866..344648
                     /locus_tag="TCCBUS3UF1_RS01505"
                     /old_locus_tag="TCCBUS3UF1_3190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514730.1"
                     /db_xref="GI:504327628"
                     /translation="MLEGNLAEFPFPSLVGALMSAGRTGRLHIRPPFLEGQVYLRAGQ
                     VVHAQVQAGDKALEGEEALDLLVGLKRAPFAFEPETLPPHTTLMGGLAVPARLAEAQA
                     AWKSLALPADWGYVLRLPAGGGEVELSAEALKVLAQVEGKRIAEVLVAPGVLRLARIL
                     HTLLQMGALEAVPLVAVPPASLLVLPIYGPGSGVAYVDEALYAEWARTIRHGFRLRLH
                     PLGAVMEVRPRPNIQGRLGLLEEDLKRLRLRRGDKVEVVPEV"
     gene            344652..346007
                     /locus_tag="TCCBUS3UF1_RS01510"
                     /old_locus_tag="TCCBUS3UF1_3200"
     CDS             344652..346007
                     /locus_tag="TCCBUS3UF1_RS01510"
                     /old_locus_tag="TCCBUS3UF1_3200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine glycine permease"
                     /protein_id="WP_014514731.1"
                     /db_xref="GI:504327629"
                     /translation="MDVLAWNDYLNRIVYGFPMKLVFLLVGAYLVIFQIRWFSAPLRM
                     MRVSFSETFGAIRERTYGFGGQITPFQATMVALSATVGTGHLLGMLAAVLVGGPGAVF
                     WMWLGYFFGTGTKFAEATLAVHFRRRYADGSVSGGPMHYLLRGLPRLRFLGYLFAFFA
                     AVAAFGIGNLSQAGAVGGALAPLGAPPALVGLFLALLVGVILGGGIVRVARFAQVVVP
                     LKLLLFLVAILPLFILYAGQIPQALALVFQAAFSPEAALGGAAGYSLFAAINAGLGRG
                     IFANEAGLGSAPIAHAQAQVDHPVRQGFWGVTEMFVSFLVTSLTALTFIASGLWRQGG
                     SAAEAATALFQAHPLGGVVLALTVAVFALGTMVSWGFYGEEAAAFLFGEGVRWPYRLT
                     FAVLAFVGPLGGLEAFLAISDTLNGLMAIPNLLGLILLGPVVARLTYGFFRGEPWVPP
                     R"
     gene            complement(346014..346412)
                     /locus_tag="TCCBUS3UF1_RS01515"
                     /old_locus_tag="TCCBUS3UF1_3210"
     CDS             complement(346014..346412)
                     /locus_tag="TCCBUS3UF1_RS01515"
                     /old_locus_tag="TCCBUS3UF1_3210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514732.1"
                     /db_xref="GI:504327630"
                     /translation="MVFRRNPTPPVADWKPTPEEWRVYTLCDGRRSEEEVVRESGLGE
                     EAYRVLADLLKQGLILPVEGPKELCARLVELLRRRLGPKAEPLVARLEGCASRESLEE
                     EALRVALKVKLTLDKKAGEELEKAIREMFR"
     gene            complement(346415..346699)
                     /locus_tag="TCCBUS3UF1_RS01520"
                     /old_locus_tag="TCCBUS3UF1_3220"
     CDS             complement(346415..346699)
                     /locus_tag="TCCBUS3UF1_RS01520"
                     /old_locus_tag="TCCBUS3UF1_3220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018460955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514733.1"
                     /db_xref="GI:504327631"
                     /translation="MEKVLLLLGFLVMVYNVLYGLRLKRAIPGGVMGERGGQMLFLIF
                     FFAASYLGVLLLTWGEPSSLLLLLLSLILLLGSVFVHLVLRLLDAIVASL"
     gene            complement(346709..346984)
                     /locus_tag="TCCBUS3UF1_RS01525"
                     /old_locus_tag="TCCBUS3UF1_3230"
     CDS             complement(346709..346984)
                     /locus_tag="TCCBUS3UF1_RS01525"
                     /old_locus_tag="TCCBUS3UF1_3230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514734.1"
                     /db_xref="GI:504327632"
                     /translation="MWFRKDPHVKPEGPMAFRVRVRTRSGEVVELRLSKSMEISPIEG
                     GYYVRKEIVAPRSLDRAVLEIWFDRGYRPVRKAVEGGELIPIREWNG"
     gene            complement(346986..347462)
                     /locus_tag="TCCBUS3UF1_RS01530"
                     /old_locus_tag="TCCBUS3UF1_3240"
     CDS             complement(346986..347462)
                     /locus_tag="TCCBUS3UF1_RS01530"
                     /old_locus_tag="TCCBUS3UF1_3240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014514735.1"
                     /db_xref="GI:504327633"
                     /translation="MSLSPAATRVQRALEEGGFGHLRVEELPVSTRTAAEAAQAVGAE
                     VGQIVKSLVFVGEKGGYLFLVSGKNRLDPGKAAALAGEPLRRASPEEVRALTGFAIGG
                     VPPLGHPTPLPTFLDQELLGYGVVWAAAGTPRALFRTRPEELLALTGAKVADLKEG"
     gene            complement(347459..348574)
                     /locus_tag="TCCBUS3UF1_RS01535"
                     /old_locus_tag="TCCBUS3UF1_3250"
     CDS             complement(347459..348574)
                     /locus_tag="TCCBUS3UF1_RS01535"
                     /old_locus_tag="TCCBUS3UF1_3250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="WP_014514736.1"
                     /db_xref="GI:504327634"
                     /translation="METLEWMKARLPEFLRDLEAFVRRESPSGDLKGLEEAAAFLEKA
                     FAPLKGRLSRKDTPAGPILLLKREGEGEPVLVLCHYDTVHPKGSFPEPFRLERDRAVG
                     PGVYDMKGGILALLYALRHAEATGRRLPPLEILFTPDEETGSRESRPLIEAAAKKARA
                     ALVLEPPTLEGDLKVARKGVGLYRLKALGKAAHQGVEPEKGVNAILELAHQIPKVAAL
                     EDRDKGTTLGPNVLRGGTVSNVVAEEAWVEIDLRAWTLEEARRVEEALRALSPALPGA
                     RLELTGGLNRPPMEPTPESLSLFHKAQAIGEALGLALRPGRVGGGSDGNFTAALGVPT
                     LDGLGLLGGDAHQRTEYVVVSEIPRRVALLAELLYAL"
     gene            348776..350371
                     /locus_tag="TCCBUS3UF1_RS01540"
                     /old_locus_tag="TCCBUS3UF1_3260"
     CDS             348776..350371
                     /locus_tag="TCCBUS3UF1_RS01540"
                     /old_locus_tag="TCCBUS3UF1_3260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="WP_041433658.1"
                     /db_xref="GI:752794226"
                     /translation="MEEKATQTPEKTFSMEEALQETEARLEKRVRPGQVLTGKVVLVG
                     SEGVAVDIGAKTEGIIPFNQLTEKVLPEEELKGLLKPGDEVRVQVLRVDPETGQILLS
                     RKKVEATEHWDHIQALYERGEPVTVTVKEKVKGGVVAELDGVQAFIPASQLDLRRTPN
                     LDEYVGQQILAKIIEFHRKKGRVLLSRRAVLEEEQKRAKEAFFQSLKPGQVVEGAVVD
                     VTDFGAFVNLGPVDGLVHRSEITWGRFGHPKEVIHKGQRVRAQVVSVDPAKERVNLSI
                     KALIPDPWTTVAEKYPVGTRVKGKVVGLTPFGAFVEVEPGLEGLIHISELSWTKRPKH
                     PSEVVKEGDEVEAVVLRLDPGERRLSLGLKQTQPDPWQLLVEKYPPGTVVKGRVTGVT
                     DFGVFVELEPGMEGLVHVSELDHQRVDNPAAHFKKGEEMEVVVLNIDPVEQRISLSRK
                     RLLPPPPPKAEEERPRRAKGKEARSKRKPTPRREERREYEYGAVAEYNLYDASAVPTA
                     STSVKLGDLYGDLLASLGLEEEK"
     gene            complement(350415..351677)
                     /locus_tag="TCCBUS3UF1_RS01545"
                     /old_locus_tag="TCCBUS3UF1_3270"
     CDS             complement(350415..351677)
                     /locus_tag="TCCBUS3UF1_RS01545"
                     /old_locus_tag="TCCBUS3UF1_3270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="menaquinol-cytochrome C reductase cytochrome B
                     subunit"
                     /protein_id="WP_014514738.1"
                     /db_xref="GI:504327636"
                     /translation="MYKWLDERLDLTGLYHKVLRKAFPVHHSFFLGEITLFAFIVLVL
                     TGVFLTLNFEPSIREVKLPDGRTVPAAYASVLYIDSLPFGAVIRSLHHWSAHVMIAAA
                     FLHMLRILLSGAYKKPRELNYLVGLALLGLAVVTAFTGYALPYDNYAVTATRIGYGIA
                     TSIPWIGTTLAQVMFGGEFPGSAQSIPRLYSLHVLWLPLLLLALIGGHLAIMMKQKHT
                     QPRYAEKVAPGKILGVPMYPQQLVMMGILFALYVGIMAIIAGAFLAHPIEAFGPPTPN
                     TPAVKPDWYFLWIYGILQIIPSSWEFHLFGAIIGPEFIGGVVVPGILALIALLLPFVD
                     TQKDKMRYLELPSEHPVRTSVILALLVFFLMSTLAGYKIDFQQQGSLLGNNAVLWTLV
                     LGGPLLTFLVSYTLMRIFYGKRAEKALE"
     gene            complement(351687..352316)
                     /locus_tag="TCCBUS3UF1_RS01550"
                     /old_locus_tag="TCCBUS3UF1_3280"
     CDS             complement(351687..352316)
                     /locus_tag="TCCBUS3UF1_RS01550"
                     /old_locus_tag="TCCBUS3UF1_3280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske (2Fe-2S) protein"
                     /protein_id="WP_014514739.1"
                     /db_xref="GI:504327637"
                     /translation="MDEREIRLRTSRRRLFLKTAIGTGIGLSLVSAFYVGASLRPKAE
                     VTPEKEPLKPGDLLVYAQGGGEPKPIRLEDLKPGDPFVLAYPMDPKTKVVKSGEAKNT
                     VLVVRYAPEALSPEVAQHAVEGIVAFSAVCTHLGCIVSQWVADKQAGLCPCHGGTFDF
                     AHGAKVVAGPPPRPVPQLPLKVENGVLVAAGEFLGEIGVKASAGQCRQV"
     gene            complement(352328..352810)
                     /locus_tag="TCCBUS3UF1_RS01555"
                     /old_locus_tag="TCCBUS3UF1_3290"
     CDS             complement(352328..352810)
                     /locus_tag="TCCBUS3UF1_RS01555"
                     /old_locus_tag="TCCBUS3UF1_3290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014514740.1"
                     /db_xref="GI:504327638"
                     /translation="MYRNDPIIPTFALILALGLFYTAYLDGLHIARLLGHTPEELSVG
                     QIGLMAFGAVLLLYGLIGLVSYWLEGIELRPGRHFPTPSTAPVAAGVILVLLLTALSG
                     FFVRLLVYSAQSGHNPTWLQGLIFGAISLVVAALLGVYKKFFGRDEAITEEEKSQFPW
                     "
     gene            complement(352820..353548)
                     /locus_tag="TCCBUS3UF1_RS01560"
                     /old_locus_tag="TCCBUS3UF1_3300"
     CDS             complement(352820..353548)
                     /locus_tag="TCCBUS3UF1_RS01560"
                     /old_locus_tag="TCCBUS3UF1_3300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014514741.1"
                     /db_xref="GI:504327639"
                     /translation="MVVDRIEVYLDGAAEPLAVLKEPPYRLNLDTKKLPDGEHTLRVV
                     THFRGGGQEIREIPFTVNNYPDILVLGLDEGGEVAGQVELRLAVGEPELPVEPIRFNP
                     LWYVVASVVVLGGIWSYFALSPAAEKIVAEVAPPAQESQAHGATGAQPAANVDPALLE
                     KGKAVYEAHCAACHQANGQGMPPAMPALAGNANLKDAQMILNIVKNGRGAMPPVGAAF
                     SEEEVKAVATYIRNSFGNSFGPVE"
     gene            complement(353632..354399)
                     /locus_tag="TCCBUS3UF1_RS01565"
                     /old_locus_tag="TCCBUS3UF1_3310"
     CDS             complement(353632..354399)
                     /locus_tag="TCCBUS3UF1_RS01565"
                     /old_locus_tag="TCCBUS3UF1_3310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_014514742.1"
                     /db_xref="GI:504327640"
                     /translation="MRLGFSPFNAELGYEEAFRLAAQLGMDLEVAYDLHEALPLPDPR
                     ALRATGEALGVGFTLHLPFVEMNPASLIPAVRQLSEDRLKRALEFGEALGAKVGVLHT
                     GQVPVRHPMALDLAREALEKTLAALLPLPFPIALENLALAEEDLIRGPEELQALLDRF
                     PQYGFCLDVGHALVELGPRGPFLYLEALSPRLLHLHLHDNHGRKDDHLPVGAGALPWE
                     KLAPHLQGFAGTAALEVGGGMEGVGRSRERLLRLLAP"
     gene            complement(354412..355608)
                     /locus_tag="TCCBUS3UF1_RS01570"
                     /old_locus_tag="TCCBUS3UF1_3320"
     CDS             complement(354412..355608)
                     /locus_tag="TCCBUS3UF1_RS01570"
                     /old_locus_tag="TCCBUS3UF1_3320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014514743.1"
                     /db_xref="GI:504327641"
                     /translation="MKKLLALALLLLPVLAQTEVSFWHSMDGPAGRLLSAFAQEFNAR
                     QGLYRVLPQYVGDYRDAETKLVAALRTGAQPVLFQAEISFFPRLVGEGRALALDPYLN
                     LDRAFLEDLFEPAWNYGLMEGRRYGLPLNTSTPVLFYNLDALRAKGLKAPRNWKEFEE
                     VAKALTSRQAKGFIFVTDPQAWLFEAMATSRGGSLVREGRPNFLSKEVVEALEMLWRM
                     NRAGLLSVRSMAESTFAQLDFVRTKGMMVMASIANWPAAENFSFAFTLGVAPVPRETG
                     GKVPLGGAQLVVLRGASEAQVRGALDFWRYLMEPSNVARWVEASYYVPVRKSAAPLLE
                     GFYRENPFRKVAFEQIAVAQERPRLPQFSAWASLLAEALEKSLKGGMAPQRALEEAQR
                     KAEAIR"
     gene            complement(355654..356844)
                     /locus_tag="TCCBUS3UF1_RS01575"
                     /old_locus_tag="TCCBUS3UF1_3330"
     CDS             complement(355654..356844)
                     /locus_tag="TCCBUS3UF1_RS01575"
                     /old_locus_tag="TCCBUS3UF1_3330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014514744.1"
                     /db_xref="GI:504327642"
                     /translation="MRRPFLAALPFFLLAQAQVTLPFWHTAGPPGNTVLEEAIRTFNE
                     GQRAYRIEARYVGDYREAGVKLLAALRSGGAPVLFHGELSFLPRLAQEGAALSLDPYL
                     NGLPRDLYPEMLRTVQVKGKTFGLPLGLSVPVLYYNKDAFRARGLRPPSTWAEVEEAA
                     AKLTSRTSKGLVVSTDIWSFNALVMSLGGSLVKDGLPAFTSKEVVEALEMLHRMVQRG
                     HAQPRNLAEAQFAVADFLRTKAFMGLGPTTALPVVLSQTSLPFAVGMAPVPRREGGAV
                     PLSGAALAVLKGASPEQARGAVAFWLHFLDPKRQAAWVRTTWYLPLRREAERELGEFL
                     KDPERQGVFAQAEIGRPWSQDPEMVVWYGFLEEALERSLKQGVKPQVALEEAQRKALA
                     VERR"
     gene            complement(356855..357631)
                     /locus_tag="TCCBUS3UF1_RS01580"
                     /old_locus_tag="TCCBUS3UF1_3340"
     CDS             complement(356855..357631)
                     /locus_tag="TCCBUS3UF1_RS01580"
                     /old_locus_tag="TCCBUS3UF1_3340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514745.1"
                     /db_xref="GI:504327643"
                     /translation="MRARSTIFTLFLEYAYPERRAPVRDLVAMMEALGFSEAAVRAAL
                     SRSAKRGWVVAERRGRTAYYALSDRVYWQVRQVRRRLYEPVAPWDGRFLLVLPEGPKE
                     RGERERFRREMALLGYGSLQSGIYLGAGVDLEATKELLGFYGLTATLFRAEHLGSPEE
                     VRKAFPLAQAEAHYRTLFPQEVPENPLLAFQALTRLVHGMRKVLFLDPLLPPELLPPG
                     YPGLAARERFFALRQALYARAEPFLKGFHLPLAALSPGAR"
     gene            complement(357631..359610)
                     /locus_tag="TCCBUS3UF1_RS01585"
                     /old_locus_tag="TCCBUS3UF1_3350"
     CDS             complement(357631..359610)
                     /locus_tag="TCCBUS3UF1_RS01585"
                     /old_locus_tag="TCCBUS3UF1_3350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_041433660.1"
                     /db_xref="GI:752794228"
                     /translation="MTVYLPDGKALEVQEGATARDVAQALGPRLAQKAVGAIVNGELY
                     DLLKPLPPGASVRILTEEDPEYQTLFRHTLAHVLAQAVKEHFQEKGYDPESVKLGVGP
                     VIEKGFYYDIDAPEPLSDEDLPALEARMRAILAKDLPLRRYTLSREAALARYQGKDPY
                     KAELIQELPEGEEISFYQQGDEAYGFTDLCRGPHVPSTGRIPPHFRLTHVAGAYWRGD
                     ERRPMLQRVYGVAFRTAEELKAYLWQLEEAKRRDHRRLGRELELFLIDPMVGKGLVLW
                     LPKGNTIREELIAFMREEQLRRGYQLVTTPHIGGLELYKTSGHYPYYAESQFPPMRLE
                     DREGSEEYLLKPMNCPHHIRIYAHKKRSYRELPLRIAEFGTVYRYEKAGELLGLTRVR
                     GFTQDDAHLFCTPEQVKEEFLGVLDLVLKVFATLGLKGFRARIGVRDPQSSKYVGEEA
                     KWALAERQIEEAAQEAGLDYTLEEGDAAFYGPKLDFVVKDALGREWQLGTIQVDYNLP
                     ERFQLTYVGKDGEEHRPVMIHRAPFGSLERFIGILIEHFAGDFPLWLSPVQAVVVPVS
                     EKQEDYAKEVVERLKEAGLRAEGDLRPERMQARIRDAEVQKVPYILVVGERERAEGTV
                     SVRRRHRGNLGTMPLATFLEGALREYRERKLEPVF"
     gene            complement(359629..360852)
                     /locus_tag="TCCBUS3UF1_RS01590"
                     /old_locus_tag="TCCBUS3UF1_3360"
     CDS             complement(359629..360852)
                     /locus_tag="TCCBUS3UF1_RS01590"
                     /old_locus_tag="TCCBUS3UF1_3360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014514747.1"
                     /db_xref="GI:504327645"
                     /translation="MWKGPREGRRSILPILDLRERNYRLAVVNGWLVWLGDTFLNPNI
                     VLSGFAAKLGAPGALIGLLPALLQAGGMIPQAFLAPYVARFPRKIVLYRQVAALRLLG
                     VVLMALSAFLLGAWPHLLLMGFLTGLLLNALFTGVSSLPFWEVVAKTTPKERRAALFS
                     ARNLVGGLLAFLAGFLVRGILALPLPFPLPYALLFALGALAFGTGWYLFGLTAEPAEA
                     PKEERIDLLLPLRSPGFRRFLRVRILLGLAGMAEPFYAVYAVRALGHGEELGLYLSLY
                     ALAFTLSNLLWARLAERGSKGVLLRGAGLACMAPLLALLLPPGLYGAVFLLQGTYLAA
                     LNLATTTYLLNLAPPEERSAFIGLGNTVAGVFAFATVLGGWVADALGFSALFLLAAAL
                     YALALWAGRKLPREG"
     gene            360818..361780
                     /locus_tag="TCCBUS3UF1_RS01595"
                     /old_locus_tag="TCCBUS3UF1_3370"
     CDS             360818..361780
                     /locus_tag="TCCBUS3UF1_RS01595"
                     /old_locus_tag="TCCBUS3UF1_3370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514748.1"
                     /db_xref="GI:504327646"
                     /translation="MLLLPSLGPFHILHPRYNAATVLALLDEARPPVLYLASLSEEAL
                     REGVWREEDPLLFHLLPWAEARGVPVVALDAEAHLKGEAEAFREALVQHPLGAPYLER
                     MQALDQELLGLLRTPLTPEVLGGEAFLARLQALYRAFAAAFGEGPATGFRQRRMAQVA
                     EALRGKEGAVVADLLDYALLAEAFPQALPQAHTPTEGERERALLDRAWQLREEDDWAG
                     LLEGLFAIGSPEALYLAAQVYLAAGEWREALALMEEVLRMDFHHPGYLPGYVLARFGQ
                     LLDLAGERERALRAYRGALALSWIPEEARAIALAGLRTPFRLGG"
     gene            361828..>362229
                     /locus_tag="TCCBUS3UF1_RS01600"
                     /old_locus_tag="TCCBUS3UF1_3380"
     CDS             361828..>362229
                     /locus_tag="TCCBUS3UF1_RS01600"
                     /old_locus_tag="TCCBUS3UF1_3380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514749.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433940.1"
                     /db_xref="GI:752794509"
                     /translation="MEVEVRRARHALYLRLAAVHAGPLGPALLGHPELAPLYPKAYAA
                     CGGAEGLACAGVGGEPRVCVVRRLAHLAKSALRGGRRRREQEKAMVEGLLLCMAHLQR
                     EFPPEFSPVLQATQEALRKDLRYLRGELSPEE"
     gene            complement(362233..362433)
                     /locus_tag="TCCBUS3UF1_RS01605"
     CDS             complement(362233..362433)
                     /locus_tag="TCCBUS3UF1_RS01605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433662.1"
                     /db_xref="GI:752794230"
                     /translation="MVYIALFALGAALVTLLFYLILNPRVLTTEGETFDLRFILFMLV
                     LIVLAAGTVALMLVLGRMYHLL"
     gene            complement(362446..363066)
                     /locus_tag="TCCBUS3UF1_RS01610"
                     /old_locus_tag="TCCBUS3UF1_3390"
     CDS             complement(362446..363066)
                     /locus_tag="TCCBUS3UF1_RS01610"
                     /old_locus_tag="TCCBUS3UF1_3390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514750.1"
                     /db_xref="GI:504327648"
                     /translation="MPALLERLSQDLEVLSGHLRAGLDEFGTLLCYLEGGRGGRTTLL
                     HAPYEEALPVLQALNGLSFRGRLLLALDPSPLSPTREEVPLSGPTRAPLEHLLERTRP
                     DRLLLAFPGEGLGLTYPGGKETQAGWGSLEAPGAALVLHVEAPTGLTYREVRAYGPWE
                     SPPLPLDLPQGEGPYLGGVGRALGIPTYGVGLVNLRASLEALLRLW"
     gene            363090..363812
                     /locus_tag="TCCBUS3UF1_RS01615"
                     /old_locus_tag="TCCBUS3UF1_3400"
     CDS             363090..363812
                     /locus_tag="TCCBUS3UF1_RS01615"
                     /old_locus_tag="TCCBUS3UF1_3400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="WP_014514751.1"
                     /db_xref="GI:504327649"
                     /translation="MRYLVLSDIHGNWPALEAVLQAAPPVDRVLFLGDAVGYYPDGDR
                     VLDWLMEVGAECVLGNHDAWLLALDRLPVEGAVLEILAWQRDRLSPEHLAFLGSWPWQ
                     KEVEGALLVHGSPCDPLEYLDDLEPARQAFACTEARLAFHGHTHLAGAFLQLSGPRPW
                     VRYQAFRQGGELLLPPKVRALINPGSVGQPRDGVPGAAFALWEGERVEFFRVAYPLEE
                     VEARLREEGFPPWLWERLRVGE"
     gene            363779..364588
                     /locus_tag="TCCBUS3UF1_RS01620"
                     /old_locus_tag="TCCBUS3UF1_3410"
     CDS             363779..364588
                     /locus_tag="TCCBUS3UF1_RS01620"
                     /old_locus_tag="TCCBUS3UF1_3410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_041433664.1"
                     /db_xref="GI:752794232"
                     /translation="MALGAAQGWGIVGHEAILELLPRIRASTLLFSGPEGVGRRLVAR
                     WYALGLNRGFPPPPLPEHPDLWEVAPKEGGLRGRAEVRLEEVEPLMDWFASHPRERVK
                     VAILDAAHLLTEPAANALLKLLEEPPSYGRIVLIAPSRDTLLPTLASRALEVPFGPVP
                     EAALRSLTQDPGLLAYAAGAPGRLKRALAEPERFRERLDKAAALGKAAPLARLSLLKE
                     LLAEEEGFFALYAAWRHRPEALLALEAAREALEAYVNPELVLARLALDLET"
     gene            364585..365352
                     /locus_tag="TCCBUS3UF1_RS01625"
                     /old_locus_tag="TCCBUS3UF1_3420"
     CDS             364585..365352
                     /locus_tag="TCCBUS3UF1_RS01625"
                     /old_locus_tag="TCCBUS3UF1_3420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514753.1"
                     /db_xref="GI:504327651"
                     /translation="MTVGVRFRTPVLRYFRFQGEPPPLEAFVVVRTSRGLEVGKVRTP
                     PRAEKEVGEVVRLATKEDLDKAARLRVRAEEALFYLRARLREEGVEAKILGCDFTLDG
                     RHLSVHYRAEERVNLRRFTRELSQRFDARVEFLAEGPREEAQYLGTLGACGMESCCST
                     WLQGFAQVSIKLARDQQLPLNPEKISGPCGRLLCCLAYEHPVYQELLAELPRKNARVC
                     TKEGVCGKVQKLNPLKGTVELLLEEGKVLEVSKEELA"
     gene            365349..365885
                     /locus_tag="TCCBUS3UF1_RS01630"
                     /old_locus_tag="TCCBUS3UF1_3430"
     CDS             365349..365885
                     /locus_tag="TCCBUS3UF1_RS01630"
                     /old_locus_tag="TCCBUS3UF1_3430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flavin oxidoreductase"
                     /protein_id="WP_014514754.1"
                     /db_xref="GI:504327652"
                     /translation="MRRYAPQGPLPAFYHFYPGVPAVVGVRLGERVNFCPAVWNTGLS
                     ADPPLFGVALSPKRYTHGLLLQARRFAASFHPHTQMALVHRLGSLSGREVDKGQAPHF
                     LGETGVPILEGAYAAYELELLEVHTFGDHDLFVGRVVGVWEEEALLDERGRPKPGLSL
                     LYYGRGLYGRPAEEAFAP"
     gene            365882..366148
                     /locus_tag="TCCBUS3UF1_RS01635"
                     /old_locus_tag="TCCBUS3UF1_3440"
     CDS             365882..366148
                     /locus_tag="TCCBUS3UF1_RS01635"
                     /old_locus_tag="TCCBUS3UF1_3440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514755.1"
                     /db_xref="GI:504327653"
                     /translation="MTQAEAFAQRVRRLALNRQGTEAQVFLPEGFLYLRADGFARFAQ
                     GPGAEVLSGFALARGELVLCFSDGSALTLRHRLGRLQRRVGYFS"
     gene            complement(366136..367059)
                     /locus_tag="TCCBUS3UF1_RS01640"
                     /old_locus_tag="TCCBUS3UF1_3450"
     CDS             complement(366136..367059)
                     /locus_tag="TCCBUS3UF1_RS01640"
                     /old_locus_tag="TCCBUS3UF1_3450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_014514756.1"
                     /db_xref="GI:504327654"
                     /translation="MNLDAAFLVALFLSTLRQTTPLLFTALGGMFSERSGVVNIALEG
                     IILFGALTAAVVVERLEAALGPGPHPWLPWVGVLAAMAVGGLVAWVHAVVSIRYRADQ
                     IISATAINLLALGAPSLVLTYFYGNATNSKEVTNRLPLWGPEGFALSPLVYLAFLLVP
                     LSWWVLFKTPFGLRLRAVGEHPEAADTLGVNVYRMRYIGVVLSGVLAGLAGAYLAIGF
                     LNQFVRGMSAGMGFIALAAMIFGKWHPLGILFSTLLFGLASALAIQLQGTEILPAVLV
                     QAFPYVVTVLVLAGFIGRSRPPSAVGKPYEK"
     gene            complement(367056..368873)
                     /locus_tag="TCCBUS3UF1_RS01645"
                     /old_locus_tag="TCCBUS3UF1_3460"
     CDS             complement(367056..368873)
                     /locus_tag="TCCBUS3UF1_RS01645"
                     /old_locus_tag="TCCBUS3UF1_3460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514757.1"
                     /db_xref="GI:504327655"
                     /translation="MGVLTDPRRLGVLVLLGGGVLLLLWYLAPWAVPHRSFGGEGLLL
                     SPFGHHLPQGNLPQGYRDGWLYPLFYASLAWLLLTLAVAWSKAGPKGLFWMGLLGLLL
                     FLLTYALFQGSVAQANALGERPILRRHSLGLGSYATLAYGLYLLLLARLFSPGGLAFL
                     VRRRGVVVPLFSLLLAALLGGVIVAVLKEPSGEVGSLREAVMLRLDLITYTYQLLFSP
                     LVNPSGFLQSLLLATPLVFTGLAVALGFRGGLFNIGAPGQLILGAIAAMLVGVYLPGP
                     RWLVLPLALLAAALAGGLWGALPGWLKARFGAHEVINTIMLNYIAASLFLFLISANEY
                     KFFGQTLHLPFKYPGYEARSYEVRPEARLPHWTELVAPGGELSFALPLAFLLGLLGYV
                     GVRRSPGHRVLSALLLGVAGYLVGGLLPGPAVAFGPDLTSVRLNGAFLLALLALFFFH
                     FYVFRTVGGYELRALGLAPKAAEYGGVLAGRKVVWVMFLAGALAGLAATHYVLGGGID
                     EYRLKQSLPYSVGFDGIAVALMGQNTPLGVGLAAWLFGILLTGGLQVNLQLGISRELV
                     AVLQALIVLFIAAGGFLPRYFTDPLRAAEVELKAEEVKR"
     gene            368969..369631
                     /locus_tag="TCCBUS3UF1_RS01650"
                     /old_locus_tag="TCCBUS3UF1_3470"
     CDS             368969..369631
                     /locus_tag="TCCBUS3UF1_RS01650"
                     /old_locus_tag="TCCBUS3UF1_3470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylmenaquinone methyltransferase"
                     /protein_id="WP_041433666.1"
                     /db_xref="GI:752794234"
                     /translation="MFSEIAPRYDLLNRLLSFGADQRWRARAVALALEGRPRRVLDLA
                     TGTGDLALLLKAKAPEAEVVGADFAPPMLEIARRKAQQRGLGVRFLEADALALPFPEG
                     HFDAVTIAFGFRNFADYPRALAELHRVLAPGGRLVLLEFPPPPKGVFGLVYRVYFQRV
                     LPFVGGLISGSFGAYRYLPESVEAFPSPEALKALMEKAGFAVRYELLTFGVAAIHLGV
                     KP"
     gene            complement(369628..370080)
                     /locus_tag="TCCBUS3UF1_RS01655"
                     /old_locus_tag="TCCBUS3UF1_3480"
     CDS             complement(369628..370080)
                     /locus_tag="TCCBUS3UF1_RS01655"
                     /old_locus_tag="TCCBUS3UF1_3480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="WP_014514759.1"
                     /db_xref="GI:504327657"
                     /translation="MRLLVLCTHNSARSQMAEAWLKHFARELGVALEVHSAGTEKSFV
                     KEEAQQVMAEVGLSLEGHTSKTLEEVPDPWNFDLVLTLCHEAEAACPAYPAKTARRHV
                     PFPDPTGKPLAAWREVREGLRRLARFLVERLREGDLPSEAELREAARP"
     gene            complement(370126..371811)
                     /locus_tag="TCCBUS3UF1_RS01660"
                     /old_locus_tag="TCCBUS3UF1_3490"
     CDS             complement(370126..371811)
                     /locus_tag="TCCBUS3UF1_RS01660"
                     /old_locus_tag="TCCBUS3UF1_3490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_014514760.1"
                     /db_xref="GI:504327658"
                     /translation="METTWDLTPLFPSLESPEFQGAWEDLRRQIAHLKGLLEGETPLD
                     EVLAALDALAEKTTPLSAYLYARFSANTEDEAALAKLSELEMLLLDYERLRPRLTRYL
                     ALQEPEEAGPYRILVEEARWEALHLMPEGEEVLSAELSLSGRQAWAKLHENLTSQITA
                     TVDGEELPITQVRNLYFRPEEAVRKKAYEAELRAWERHEVPLAYALNGVKGEAGVLNR
                     RRGYRDDLEPTLAQNRITRKALWAMQEAVRESLPLFRRYYLLKARALGKERLDWWDLF
                     APLGKGRRWTLEEARGFLREKLAALAPNAAKVAEAAFAERWMDLLPRKGKVGGAYCMP
                     RGGGKSLILANYEESFEAVSTLAHELGHAYHNFALARVPASLRHVPMTLAETASIMNE
                     TLVVEAALQEASAEEGLEILDAYLQGAAQVVVDIHSRFLFESWVFAKRKERELSPREF
                     KALMLKAQEEAYGEALATRHPYMWAVKGHYYGADFYNYPYTFGLLFGLAVYGQAKEDP
                     AFATRYEDLLAASGLYPAKELAARFGFDLESVDFWRKGLKVLGEKVEALEARL"
     gene            371862..372269
                     /locus_tag="TCCBUS3UF1_RS01665"
                     /old_locus_tag="TCCBUS3UF1_3500"
     CDS             371862..372269
                     /locus_tag="TCCBUS3UF1_RS01665"
                     /old_locus_tag="TCCBUS3UF1_3500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_041433941.1"
                     /db_xref="GI:752794510"
                     /translation="MEGFPVSLPVQVRFCDLDALGHVNNAVYLTYFELARTAYFARLE
                     RDWIARGHFILARAEVDFKRPIHLEDPVEVGVRVVRLGRSSFEMEYQVVAGGEVAATG
                     RTVQVWLEEGRPAPLPEAIRARIQALEGRPLAP"
     gene            complement(372258..374489)
                     /locus_tag="TCCBUS3UF1_RS01670"
                     /old_locus_tag="TCCBUS3UF1_3510"
     CDS             complement(372258..374489)
                     /locus_tag="TCCBUS3UF1_RS01670"
                     /old_locus_tag="TCCBUS3UF1_3510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannonate oxidoreductase"
                     /protein_id="WP_014514762.1"
                     /db_xref="GI:504327660"
                     /translation="MRDVLEVLEFPRVRALLAERAQTPLGRELALGLGPLSREEAETR
                     HQLTQEAQSYPYALPPAGELREAYRKALAGGRLSGPELLRAAQALEGAMALKAELLPL
                     ENALSRVAEGIGDHAPFLGRVRKALDEEGAVKDEASPRLLAIRRELKPLRQEILDRLY
                     ALMDRQREAFQDRFVAFKRERYCVPVKAGMAHKVPGILLDESESGATLFVEPLSVVKL
                     NNRLQALRLQEEEEVGRILRELSERLAQDPGVPGTLEALGLLDLVQAQAALAKDLSLT
                     RPRFGEAYRLQGAFHPLIPHPVRNTFTLDEKTRLILISGPNMGGKTALLKTLGLAVLM
                     AQSGLFVGAERALLAWPDRVFADIGDEQSLQENLSTFAGHLQRLKAMLLEATAQSLVL
                     IDELGSGTDPEEGAALSQAILEALLERGVKGMVTTHLSPLKAFAQGGEGIQNASMRFD
                     LERLRPTYELVLGVPGRSYALAIARRLSLPEEVLRRAEALQGGNRLEDLLERLEGERL
                     AMEEERRRLAAELAQAEALRARLEAREARYQEERAERLRALEEEVRGRLLQVEAELKA
                     LKEKARSEGKRDALRELMALKEKYAKKAPPPPPPPGLSPGALVEVPSLGKRGRVVELR
                     GEEALVQVGPVKLNLKAKELKPLPGEEAPKPLLAKPRREAKEVDLRGLTVEEALLEVD
                     DALEEAKALGLSTLRLLHGKGTGALRQAIREFLRRDKRVEGFADAPPHEGGHGVTVVA
                     LRG"
     gene            complement(374515..374850)
                     /locus_tag="TCCBUS3UF1_RS01675"
                     /old_locus_tag="TCCBUS3UF1_3520"
     CDS             complement(374515..374850)
                     /locus_tag="TCCBUS3UF1_RS01675"
                     /old_locus_tag="TCCBUS3UF1_3520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003047397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514763.1"
                     /db_xref="GI:504327661"
                     /translation="MRLKRFSGRVRRVVKGTGQQATEKLWQLAEDLRGEDPKAPRFRE
                     RLLTLAQLAKERWENLSPEERQRLFHLLKGLVLLLPLGRLGRLGSLLKRAASLGDPDL
                     LALLLRLKR"
     gene            complement(374858..376570)
                     /locus_tag="TCCBUS3UF1_RS01680"
                     /old_locus_tag="TCCBUS3UF1_3530"
     CDS             complement(374858..376570)
                     /locus_tag="TCCBUS3UF1_RS01680"
                     /old_locus_tag="TCCBUS3UF1_3530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="maltodextrin glucosidase"
                     /protein_id="WP_014514764.1"
                     /db_xref="GI:504327662"
                     /translation="MNRHDLEHVHPPFPELGEVVELFLETRAREGVLLYEKDGELHQE
                     PLTRVPGGLRARVAVHASPFRYAFRLPQGYLGSHGLEKTLPRYDRFFHLLAGPLPPPW
                     ALGAVYYQIFPDRFRRGRPGLAPKEGAWRLGGKPIRTKAWHEPPGPEGAHEFYGGDLW
                     GILEALPYLEALGVEVLYLTPIFQSPSSHRYDTEHYLRVDPHLGGEEALQALYAALEA
                     RGMRLVLDGVFNHVGATHPWFQKALQDPESPERGMFTFYPDGTYASFWGVKSMPKLDY
                     ASPLVQERFVFGKEAPIRRWLRLAHGWRLDVAHSLGEGGTNRKNAHWLRALARAAKEA
                     REEALVLGELSYDPTPTLRAHTLDGAMHYAGFAHPVMEWLSGRDVQGRAVALGAEEAW
                     QALWDHYQALPLQLRPAMYTFVSSHDIPRALWRLRGDEARFKLAYALLFAFPGSPAIY
                     YGDEVGLSQANPHSLWRGDPYCRAPFPWDEGAWKREILSFVKRLVALKKRHPALRLGG
                     LWPLKAPKGVLAFRRRYGGEEVWAFFAPQGARLRLPRGVDLLAGEEVGGEVEASHLLF
                     QPLS"
     gene            complement(376567..377886)
                     /locus_tag="TCCBUS3UF1_RS01685"
                     /old_locus_tag="TCCBUS3UF1_3540"
     CDS             complement(376567..377886)
                     /locus_tag="TCCBUS3UF1_RS01685"
                     /old_locus_tag="TCCBUS3UF1_3540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014514765.1"
                     /db_xref="GI:504327663"
                     /translation="MRRLAGFLLLGLLLYGVYWFAAHRLFDAASYRKQVAFGSVFVPY
                     GWAYALGLLLGLVLLVLLYSLVYTALANRLQGRKRSPWPLFGQGLTHLFLWVLILLVY
                     YPVVQVVAASFDPTNNLFSFRRPDTGFLLLDAKVIPYLPEPSLENYAKLVEGVVLYPY
                     QVALLLLAGLSLLGVGVMGLLRRLLAEEGWVNLWQGRFLLLLTLSVFALALLLSPRQF
                     TGQGTEAKFLLWVRNTFLISGLTGLLAVLLTATAGYAFARFRHLPGRYPMLLFFIFVQ
                     MFPGFLALVAIYYLLSRLDLLNTFTGLVLAYSGGIISFGTWVYKGYLESISPSLEEAA
                     MVDGASKWQVFTQILLPLSAPMFVFIFLLQFVGTYSEFVLANLVLTGVESWNVGVGLR
                     SFTTGQFQTKWGVFAAASVLGSLPILFLFYGFQQYFVSGYTAGAVKE"
     gene            complement(377887..379215)
                     /locus_tag="TCCBUS3UF1_RS01690"
                     /old_locus_tag="TCCBUS3UF1_3550"
     CDS             complement(377887..379215)
                     /locus_tag="TCCBUS3UF1_RS01690"
                     /old_locus_tag="TCCBUS3UF1_3550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014514766.1"
                     /db_xref="GI:504327664"
                     /translation="MRHPPGLKGFLLALALLLGLLVLATGVGILGYLALEARYALPGW
                     TILGLALLVLVPGAILLTRLFPWLSDWYYFLPALSFLLVFTLYPIGLTVYLAFTDYSG
                     ARNGFPDRSTETRVLKQEGAELVLEAPVEEALRCQPCQGEPVEVYAEGHRMRARILEA
                     EGPTLLLDRTPPFPAAFVAKVNAFHFVGLRNFAFILSQAGQALLPVFLWNVVFAGSTV
                     LLNALLGLVLGLILHNKALKLRNFYRTVLIVSWALPGVITVQVWVALLNYNFGAINRL
                     LGVLGVYPIPWLNDPDWAKVAILLVNLWLGFPYMMTATLGALSTIPDELYEAARVDGA
                     TPWQALWGITLPLLEKPMVPILLSSFAFNFNNFYIIYLLTGGGPAQEGRLATAQATDI
                     LISWAYKTAFSAEGQSAYGLGAAISLIIFAITVAISLVNFRATGALREVR"
     gene            complement(379274..380470)
                     /locus_tag="TCCBUS3UF1_RS01695"
                     /old_locus_tag="TCCBUS3UF1_3560"
     CDS             complement(379274..380470)
                     /locus_tag="TCCBUS3UF1_RS01695"
                     /old_locus_tag="TCCBUS3UF1_3560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_014514767.1"
                     /db_xref="GI:504327665"
                     /translation="MKKALAALALGLSLALAQGKITVWTHFGGPELEWLKAQAQAFEK
                     AAGTKVEVVEVPFGDIKQKFILGAPQGQAADLVVTIPHDWLGEMAQAGVLEPMGKYVT
                     QGYLADLQGVAVEAFTFGGRLFGLPAFAESVALIYNKKYVKEAPKTWEEFLALARQHT
                     TGATFGFLYNIGDPYFNFGFFRAFGADNVFAKDAKGNLDPSKLLLGGEVGERALSFIK
                     DLRFRHNLVPEGVDYGVADGAFKDGALAMIINGPWALGDYKKAKIDFGIAPFPTPPGA
                     KNPWGPFLGVQGVVVNAYSKNKTAAVNFAKTLITGRNLVSFNQAGGRIPVSKSAAKTL
                     EKDPVVAGFSRVFALGTPMPNIPEMGKVWGPWGNAINLAIQRPDANVKKIVEDMVAEI
                     RKAIGR"
     gene            complement(380563..381594)
                     /locus_tag="TCCBUS3UF1_RS01700"
                     /old_locus_tag="TCCBUS3UF1_3570"
     CDS             complement(380563..381594)
                     /locus_tag="TCCBUS3UF1_RS01700"
                     /old_locus_tag="TCCBUS3UF1_3570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514768.1"
                     /db_xref="GI:504327666"
                     /translation="MNLLSPHIALYRLYDLADEIDLSRLSTPRLRLSRPRLGAVRFQS
                     PPAQLELGARSVEGLSGLLTARLYEFGVAALSFRIHLGERLPWEAFVERALALPELPF
                     WEGFFLAELAALEPYLEGALLRPEEKRLSEEFTVYHALGLEGEKAHAPSVDLTPLWMG
                     AKEEFAPEVRREMERYRYSYSTEDLALLGFDRVLILDSEGIWDVADLVEFVHAQLLEL
                     SYYDRVLTEELEAVPEVLRHRGLWGYGRLQRLRRRLMARHAEIADVRARMEGALRITE
                     DLFYAKIYRAALELYGAHELERSVEEKLRVLEATYEMVTEEVAHLRTQAVEMAILALI
                     AFEVVRALH"
     gene            complement(381591..382202)
                     /locus_tag="TCCBUS3UF1_RS01705"
                     /old_locus_tag="TCCBUS3UF1_3580"
     CDS             complement(381591..382202)
                     /locus_tag="TCCBUS3UF1_RS01705"
                     /old_locus_tag="TCCBUS3UF1_3580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="WP_014514769.1"
                     /db_xref="GI:504327667"
                     /translation="MRLVLATSNPGKVRELKEGLAPLGWTLLSLADFPLRMPKEEGAT
                     FLDNALLKAAHVAKATGLPALADDSGLEVYALGGEPGVYSARYGGRETDRERNVYLLE
                     RMRHLKGEERKARFVAVLVLAYPDGHVERYEGSVEGYILEAPRGEGGFGYDPLFLVPE
                     AGKTFAEMSLEEKARYSHRGKALQALLKAYEHGPPPREVSKLE"
     gene            complement(382208..382852)
                     /locus_tag="TCCBUS3UF1_RS01710"
                     /old_locus_tag="TCCBUS3UF1_3590"
     CDS             complement(382208..382852)
                     /locus_tag="TCCBUS3UF1_RS01710"
                     /old_locus_tag="TCCBUS3UF1_3590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase"
                     /protein_id="WP_014514770.1"
                     /db_xref="GI:504327668"
                     /translation="MARKPLIDQLHHEDAWRLFRILAEFVEGFEALAGIGVPLVSVFG
                     SARFGEGHPAYALGYRLGRALAEAGYGVVTGGGGGVMEAANRGAFEAGGVSVGLNIEL
                     PHEQKPNPYQTHALSFRYFFVRKVLFVRYAHAFVFLPGGLGTLDELSEVLVLIQTEKV
                     HPFPVFVLDRAYWQGLLGWMEFLKAQGAIDPQDLSLLTPMETPEEVVAALKGVS"
     gene            complement(382889..383662)
                     /locus_tag="TCCBUS3UF1_RS01715"
                     /old_locus_tag="TCCBUS3UF1_3600"
     CDS             complement(382889..383662)
                     /locus_tag="TCCBUS3UF1_RS01715"
                     /old_locus_tag="TCCBUS3UF1_3600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_014514771.1"
                     /db_xref="GI:504327669"
                     /translation="MKDPRRPIGVFDSGVGGLTVLEALRQALPQEDFLYFGDTARVPY
                     GGKPLPMVRRFAWEIAGFLLRQGVKAIVVACNTASSAALPDLAEDLSVPVFGVLEPAA
                     EVARGFARVGLIGTEATVESRAYERHLPLAWAKACPLFVPLVEEGLWDDPVALLVARH
                     YLEEAPQDLEALILGCTHYPFLKGTLKKVLPGVKLIDSAEATARKVAETLAREGLLNP
                     EGRGRVAHFVTGDPESYRNLAERLGVKVERLRRVSLEEL"
     gene            383753..384931
                     /locus_tag="TCCBUS3UF1_RS01720"
                     /old_locus_tag="TCCBUS3UF1_3610"
     CDS             383753..384931
                     /locus_tag="TCCBUS3UF1_RS01720"
                     /old_locus_tag="TCCBUS3UF1_3610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633314.1"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="WP_014514772.1"
                     /db_xref="GI:504327670"
                     /translation="MRLVTSESVTEGHPDKLADRISDAILDALIAQDKKARVAAETLV
                     TTGLVFVAGEISTEGYVDIPGLVRKTVREVGYTRAKYGFDADTCAVLTAIDEQSPDIA
                     GGVNLSYEWRVLKSTDPLDRTGAGDQGLMFGYATDETPEFMPLPITLAHRLTMRLAEV
                     RKTGLLPYLRPDGKAQVTVVYDGDKPLYVKTVVVSAQHSPEVDQDQLREDLIREVVRQ
                     AIPAEYLKEGETEYLINPSGRFILGGPHADTGLTGRKIIVDTYGGAVPHGGGAFSGKD
                     PTKVDRSASYYARYMAKNLVAAGLARRALVELAYAIGKARPVSLRVETFGTGLLPDEK
                     LTEIAKRVFDPRPLAIIEELDLLRPIYTPTSAYGHFGRHGFPWEETDRAEALRREAGL
                     "
     gene            complement(384979..386019)
                     /locus_tag="TCCBUS3UF1_RS01725"
                     /old_locus_tag="TCCBUS3UF1_3620"
     CDS             complement(384979..386019)
                     /locus_tag="TCCBUS3UF1_RS01725"
                     /old_locus_tag="TCCBUS3UF1_3620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_041433942.1"
                     /db_xref="GI:752794511"
                     /translation="MRPTLELLDPLHPLRRRTALWLLPLGGVLALVALGTSLATGLDP
                     VDRVLLPLLAVGFFGLALVLWRLPRAASWVLPAAHALVALYLLSTLAYQLLFRPNPMG
                     LSPAAFWVPFVYFSGFLFFQSQRAVRLALLYLGLLLFLSLLGGLRGHFQPAHLNALAQ
                     FFGANLAYVGLLYMLVRIKEGYMEAQLDAYTDFLTGLRNRRYLELALERELFRVQRYG
                     RPLSLVVLDLDGFKAVNDTHGHEAGDRVLKALATCLEGHIRQSDRAVRLGGEEFAVLL
                     PETDLAHALALSERLRQAVARLKVPPAGPLTASFGVAQASPTDSPLSLLKRADEALYR
                     AKRQGKNRVEVG"
     gene            complement(386093..387985)
                     /locus_tag="TCCBUS3UF1_RS01730"
                     /old_locus_tag="TCCBUS3UF1_3630"
     CDS             complement(386093..387985)
                     /locus_tag="TCCBUS3UF1_RS01730"
                     /old_locus_tag="TCCBUS3UF1_3630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine decarboxylase"
                     /protein_id="WP_014514774.1"
                     /db_xref="GI:504327672"
                     /translation="MKTARRFSPKEAEEIYLVPYWGAGFFRVGRNGELEVTPLGPEGP
                     AASLLEIVEALRDEGRPLPLVLRFPQILEARVRELNEAFQRAMEKYGYTGGYRGVYPV
                     KVNQRRLVLETVARAGRPYHYGLEAGSKAELALILAQNLSPEALITTNGFKDDDFIRL
                     ALMGRKLGRNVVITLEKFAELPRVVRLSRELGVRPQIGIRYKLKAKGAGQWEASGGEN
                     AKFGLTTPEIVRAVEILKEEGLLDTLVMVHAHIGSQVTDIRKIKAAVREAAQTYVQLR
                     KLGAPLTYLNLGGGLAVDYDGSKTNFYASANYTLPEYAEDLVYVTKEVVEAQGEPHPT
                     LVTESGRAVTAYHEVLVLEVIDVITPPGEERPQAPSEGAHPLVKELWEGLQGLSPKNF
                     REVYHDAFADKETLQTLYDLGLVSLKDRALGEEIFYHIARRVYAIVRELPYAPDEFED
                     LEKLLADKLICNFSIFQSLPDAWAIHQLFPIVPLSRLHEPPTRQATLVDISCDSDGKI
                     DRFIDLHDVRQSLPVHAVRPGEPYYLGVFLVGAYQDVLGSSHNLFGQVGEAHVAVDEE
                     GFAIERFVPGETAEKVIEKMGFTARELFQGVERLVRQSRLSPAEKGAFLERYVRELQG
                     YTYLED"
     gene            complement(387982..388548)
                     /locus_tag="TCCBUS3UF1_RS01735"
                     /old_locus_tag="TCCBUS3UF1_3640"
     CDS             complement(387982..388548)
                     /locus_tag="TCCBUS3UF1_RS01735"
                     /old_locus_tag="TCCBUS3UF1_3640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514775.1"
                     /db_xref="GI:504327673"
                     /translation="MLLEGLRGYRGYPGGFRAYRRAFPTVELSWWHRVGDPRTIGRLK
                     ALAPTGFRFSVHGHKHLSYRPSGEERRVLRRFLRRFRLFGPKAGAVRLEVPEGVEPEA
                     FASWLDLLEEVLKEVGPVALAFQVAEALKPLVRGRGYALVNEAGGPFLYLVDPEGPLP
                     EGEGYLYRRHPSQAAPSALHSRAEVDPG"
     gene            complement(388529..389257)
                     /locus_tag="TCCBUS3UF1_RS01740"
                     /old_locus_tag="TCCBUS3UF1_3650"
     CDS             complement(388529..389257)
                     /locus_tag="TCCBUS3UF1_RS01740"
                     /old_locus_tag="TCCBUS3UF1_3650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_014514776.1"
                     /db_xref="GI:504327674"
                     /translation="MGTERLELAGLPVLAEIPARPKALLLALHGLQGSKEHILSLLPG
                     YLEAGFLLLASDAPRHGERPGPPPSAKDPFYVESVYQVALGFAEEALGVAEEAQRRFG
                     LPLFLAGGSLGAFVVHLLLAQGFRPRAALAFIGSGFPMKLPQGQRVRDPRVQALYQHP
                     PALRGEAYGGVPLLHLHGTEDLIVPLARMEETLKALRPHYPEGRLARFVEEGAGHTIT
                     PLMARMGRAFLEGWLEGGLAPGGA"
     gene            complement(389260..390192)
                     /locus_tag="TCCBUS3UF1_RS01745"
                     /old_locus_tag="TCCBUS3UF1_3660"
     CDS             complement(389260..390192)
                     /locus_tag="TCCBUS3UF1_RS01745"
                     /old_locus_tag="TCCBUS3UF1_3660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_014514777.1"
                     /db_xref="GI:504327675"
                     /translation="MDRPLLIFSGQSNRPLAQAIAEALGLPLGRSTTVRFANDNLFVR
                     FEESLREGDVFLVQSLTPPVQDHLMELLMMIDAAKGASAARVTAVIPYFSYARSDKKD
                     APRISIAARLIADLLQTAGADRVLTMTLHSPQVHGFFKIPVDHLSAEPVIANHFATRV
                     DLENAVVVAPDAGDIKRASSLARRLGLPLAFIDKERVSDTEVRVRMLVGEVEGKTALI
                     VDDEISTAGSLVEAVEALLQAGAKEVYAAATHGVYVGPALERIAKSPVREVAATDTCL
                     PKEGPKLKTLTVAPLFAEAIWRIHRGESVSSLFT"
     gene            complement(390228..391358)
                     /locus_tag="TCCBUS3UF1_RS01750"
                     /old_locus_tag="TCCBUS3UF1_3670"
     CDS             complement(390228..391358)
                     /locus_tag="TCCBUS3UF1_RS01750"
                     /old_locus_tag="TCCBUS3UF1_3670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="WP_014514778.1"
                     /db_xref="GI:504327676"
                     /translation="MDLPRVQEALREEGVDGWLLFSFGRGNPLALEVLSLGHLHLTRR
                     FAYLLPKEGEPLLLCHAIEESLFPPLPGRRRTYHSWQGLLEGLSQALRGLRRIALEYV
                     PGGQIPYLSRVDGGTLDLLRGMGLELVSSWPLLLLFQTWGEEKLQRHRRAAKGLVAAK
                     EEALAFLKAHPRATEREVQAVLVSSLRASSLVFDHPPMVAFGPNAANPHHEPGEKRLE
                     EGEVVLLDLWAKEPGGVYADLTWMAGLGPLEAAHRAFQAVAKARDEALRFVAERYREG
                     RFPLGFEVDRVARGVLEAEGYGAYVRHRTGHNLGEEVHGSGPHLDDLETHDFRPLVPG
                     LAFTVEPGVYLPGFGVRTEVDVYLHREGPEVTTPLQREITPL"
     gene            391440..391817
                     /locus_tag="TCCBUS3UF1_RS01755"
                     /old_locus_tag="TCCBUS3UF1_3680"
     CDS             391440..391817
                     /locus_tag="TCCBUS3UF1_RS01755"
                     /old_locus_tag="TCCBUS3UF1_3680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514779.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis protein HemY"
                     /protein_id="WP_014514779.1"
                     /db_xref="GI:504327677"
                     /translation="MVETQEVIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGF
                     QYGMAVDERELEGDTFVEMHGVRLVVDPMSLPYLVGSEIDWVESLMGGGFTVHNPNAA
                     STCGCGHSFRTKDQEGEARTCGH"
     gene            391944..393812
                     /locus_tag="TCCBUS3UF1_RS01760"
                     /old_locus_tag="TCCBUS3UF1_3700"
     CDS             391944..393812
                     /locus_tag="TCCBUS3UF1_RS01760"
                     /old_locus_tag="TCCBUS3UF1_3700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018460562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014514781.1"
                     /db_xref="GI:504327679"
                     /translation="MRKLGKLAVLGLTALGLALAGPQDNSLVIGASQEPRVLAGDFLN
                     VISNQAIKSEIQQYLFAPLIGFNADSQNFPVLATEVPTQQNGRLRVRDIGGGKKRLEM
                     DLTIRPDARWSDGRPITTEDVAFYYEVGKAKGMPVLNPDYWDRVQLQVRDVRNFTVIF
                     EPAYYYDTYGSPIGYAPKHVMGPEWEKVKAAARNLDPDKDAQRLNELYRNFFLKFSTP
                     AELNKGAMVYSGAFTLKRWVPGNSIEMERNPNFPIKPEGGESRYVQKVVYRFIQNTNS
                     LLVAVIGGSIDATSSVALTFDQGRSRQLTSRAPGRFDIWFVPGAIWEHIDINKFENCQ
                     AVRDLGLNDVRTRRALLHAMNREGLVKAFFDGLQPVAHTWIAPVNPLFNPNVRKYEFD
                     LQKAEALLAEMGWRKGPDGILQRTVGGRTVRFEIEFVTTAGNAIRERTQQFFAEDLKK
                     IGIAVKINNAPSAVVFADDYIQRASECKWTGMFEFAWVSNLQEDGGLFQYKNLNTGAI
                     MVPTKENNYQGQNIGGWRNDEFDRLTSQAVLEFDEAKRKALFARAQEIWAEELPALPL
                     YFRANPYVVRKGLVNYVASAYSGGYGYPGWNAWEIGWESRGAVKKWDQAKYALSVK"
     gene            393888..394898
                     /locus_tag="TCCBUS3UF1_RS01765"
                     /old_locus_tag="TCCBUS3UF1_3710"
     CDS             393888..394898
                     /locus_tag="TCCBUS3UF1_RS01765"
                     /old_locus_tag="TCCBUS3UF1_3710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011173671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014514782.1"
                     /db_xref="GI:504327680"
                     /translation="MFAYTVRRLLQMVPLLLAASVVIYALLALQPGDPLDELRRQNPR
                     MTAEQFEALKRAYGLDQPIHIRYFKWLSRAVQGDLGYSRTYGIPAAEYIFVQRLPKTL
                     LLSGLALTLALLVAIPVGVFSAVRQYSLADYAITFLSFVGFSMPVFFLGILLLYLFAI
                     WLPDHIPGFPRFPTGGVPGILWEDVRSGNIGLGQFLGQWAWHLILPVLALSSLQMAEW
                     TRFMRASLLEVLSQDYIRTARAKGLAERVVLYKHALRNALIPIVTLVGLAIPGVLGGA
                     TITETIFSYPGMGRAIFDALVEKDYNVAMAALAFLALMTALFNLLADLAYAVVDPRIR
                     YS"
     gene            394908..396095
                     /locus_tag="TCCBUS3UF1_RS01770"
                     /old_locus_tag="TCCBUS3UF1_3720"
     CDS             394908..396095
                     /locus_tag="TCCBUS3UF1_RS01770"
                     /old_locus_tag="TCCBUS3UF1_3720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019551432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014514783.1"
                     /db_xref="GI:504327681"
                     /translation="MATATASPKPRTFLGLFWRRLRRHKMAMAGLVVIVLLILMALLA
                     PWIAPYDPTAQPTGEDVGQYYFNPPSREHLLGTDDLGRDVLSRIIYGSRISLLVGFAV
                     ALSSVILGTIMGTLAGYFSGRPLRFYLGPLRREREGFYPWGFALWRVVSWFLYYGVLY
                     LVVSIAWALARDGIQAGSLGSYLGFGLTLALALWAAWYGLWGQIRLDLDILISRLIDF
                     MLTIPTLPLLLVLSALLRDPGVKVGQWAQGVFGDAASVFIIITILVLFGWLGTARLVR
                     GNILSLREQDYATAAQALGATDGRIMFRHLVPNTIAPLVVQATLQVGGAILTEAALSF
                     LGFGIQPPVATWGNMLTNAQEYIFTAPWLALPPGFMIFITVLAFNYLGDGLRDALDPR
                     SRL"
     gene            complement(396140..396901)
                     /locus_tag="TCCBUS3UF1_RS01775"
                     /old_locus_tag="TCCBUS3UF1_3730"
     CDS             complement(396140..396901)
                     /locus_tag="TCCBUS3UF1_RS01775"
                     /old_locus_tag="TCCBUS3UF1_3730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_014514784.1"
                     /db_xref="GI:504327682"
                     /translation="MRRILILAEYDGTGFAGLQRQRPGLRTVQGELEGALARIGAIPK
                     AVAAGRTDAGVHALAMPFHVDLPGRIPTERIPEALNRLLPEDLKVLRAQEVAQDFHAR
                     KDALWRAYRYRVLLRPHPSPLLRHRALWLRHPLDLEAMEEALPLLLGRHNFLGFAKEE
                     VREGTRELLEARLERVEGEAGPELRFYFRGTSFLRGQVRGMVGTLLEVGLGKRPPESL
                     KAILETADRRLAGPSAPAQGLYFLEAAYPREKLLP"
     gene            complement(396911..397969)
                     /locus_tag="TCCBUS3UF1_RS01780"
                     /old_locus_tag="TCCBUS3UF1_3740"
     CDS             complement(396911..397969)
                     /locus_tag="TCCBUS3UF1_RS01780"
                     /old_locus_tag="TCCBUS3UF1_3740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_041433668.1"
                     /db_xref="GI:752794236"
                     /translation="MERAPLLKLEGVRKRFGEHEVLKGIDLEVYPGEILALLGPSGCG
                     KTTLLRVVAGLESPEEGRVVLEGREITPLPPERRGIGFVFQDYALFPHLTALGNVAFG
                     LKGKDRWERARKALERVGMTLFQDRRPGELSGGQQQRIALARALAPGPKLVLLDEPFS
                     SLDASLRAATREEVRKILKETGTTALLVTHDQEEALSFADRLGVMRGGRLEQVGTPEA
                     VYLRPRTPFVAQFLGRTNLLPGEGKGRQAETCLGPVPLAEPAFGPLLLSLRPEALRLF
                     PPGAGPGPGALGVVVAREFKGHDLTYRVRLLAPERELLVQEGPESPFRPGDQVWVGVA
                     GTGVALEGPPPRTPVGTD"
     gene            complement(397948..399498)
                     /locus_tag="TCCBUS3UF1_RS01785"
                     /old_locus_tag="TCCBUS3UF1_3750"
     CDS             complement(397948..399498)
                     /locus_tag="TCCBUS3UF1_RS01785"
                     /old_locus_tag="TCCBUS3UF1_3750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_014514786.1"
                     /db_xref="GI:504327684"
                     /translation="MLQRRLSHFPGLLPFLVPALLTGGGVALPLLYLLLRALEAEGAA
                     LGEILFRPKNLELLGNTLGLLLGVLLLTTLLALPLAFLTTRTDLRGKRLLSVLLTLPL
                     ALPGYVGAYVLLAATGPGGLLPLPRPEGYWGALLVLSLLTYPYLFLSLRAAFLGLDPS
                     LEEAARTLGLGPWRAFFQATFPQLLPALLSGYLVVGLHVLGDFGTVSLLRYETFSYAI
                     YLQYNAAFDRVYAAWLALFLLGLTGGLLLLEGWLLRRPSLARTGKGAGRRARAIPLGP
                     WAPLAYLLVLLPLLLALVLPFSALFHLASRFPREGFLGLGEAFLHSALAAGPAAFLAV
                     GMALPLAYLAVRHPSPASRALERLAYLGYAIPPLAFALAWIFFSLRSLPFLYGTLPLL
                     VLVLGFHFLAESLGPIRGALHQVPRRLEEAARTLGETPTGAFFRVTFPLLWRGAVAGG
                     ALAFIGAVKELPLTLLLAPMGYATLSTRVFSYTQEAMFAEAAPFALLIALLSAAFVGV
                     LLWSERRF"
     gene            complement(399500..400495)
                     /locus_tag="TCCBUS3UF1_RS01790"
                     /old_locus_tag="TCCBUS3UF1_3760"
     CDS             complement(399500..400495)
                     /locus_tag="TCCBUS3UF1_RS01790"
                     /old_locus_tag="TCCBUS3UF1_3760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_014514787.1"
                     /db_xref="GI:504327685"
                     /translation="MRRRQLLTLIGTAALGLSLAQQPTLVIYSGRGQSLVEPLVRQFQ
                     EETGIRVQVRYGTDAQILATLQEEGSRSPADLFWANTAGALGQAAAKGLLRPLGATLL
                     KQPLAFVPTSQAWVPVTVRLRVLAYNPQRFKPEELPQSLLDLPRFAQEKGLLGRVGWT
                     PTYSSFQDMVAGIIALHGEAKAREWLLAMKALNPKAYASNPAMLEAIRAGEIDLGSTN
                     HYYVVRFRRAGYSLGLHHFKEGDVGNLALVTGAGILKTSKNLVAANRFLTHLLSAKGQ
                     QYFVGNVGEYPLVKGVVADANLLPLEEALKKSPRLDFEKLPLEQALKLLRELGIL"
     gene            complement(400571..401347)
                     /locus_tag="TCCBUS3UF1_RS01795"
                     /old_locus_tag="TCCBUS3UF1_3780"
     CDS             complement(400571..401347)
                     /locus_tag="TCCBUS3UF1_RS01795"
                     /old_locus_tag="TCCBUS3UF1_3780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloenzyme"
                     /protein_id="WP_014514788.1"
                     /db_xref="GI:504327686"
                     /translation="MLFLFVDGLGLGETLESLFPLLLELDPKPLDATLGVEGLPQSGT
                     GQTALLTGANAPRLLGYHQGPFPSPRLRPLLRQSLYAWARAQGLKVLHANAYRPEYLR
                     RATEGRRLLLSAFAQAARLAGLPLLPLGHPLALPPAFWEDPYGMGARAAALARAFPLV
                     VLEYWALDLAAHRFPETLPQRFQELSLFLKGFLAEGGTLLLTSDHGNAEEPWHPQHTR
                     NPVPLVYTGQGPEGPQDLTGVLPWLQTIITSKLRKSDRNT"
     gene            401450..401878
                     /locus_tag="TCCBUS3UF1_RS01800"
                     /old_locus_tag="TCCBUS3UF1_3770"
     CDS             401450..401878
                     /locus_tag="TCCBUS3UF1_RS01800"
                     /old_locus_tag="TCCBUS3UF1_3770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_014514789.1"
                     /db_xref="GI:504327687"
                     /translation="MPVRKAQAVWEGGLRSGKGVMRLQSQAFEGPYSFPSRFEEGPGT
                     NPEELIAAAHAGCFSMALSAALEREGFPPKRVATEARVHLEMVEGRPTLARIELVTEA
                     EVPGISPEKFQEIAQAAKEGCPVSRALAGVGEIALEARLL"
     gene            complement(401883..402617)
                     /locus_tag="TCCBUS3UF1_RS01805"
                     /old_locus_tag="TCCBUS3UF1_3790"
     CDS             complement(401883..402617)
                     /locus_tag="TCCBUS3UF1_RS01805"
                     /old_locus_tag="TCCBUS3UF1_3790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514790.1"
                     /db_xref="GI:504327688"
                     /translation="MGGVNGAGHEALKALYGLQEKDLEIDRLQKEVESLPEELLAVKA
                     QVEALEEELEDLLERQAELRKEYNRHSLDIEDLTAKEKQAEAEQRQAQSAREQTQYEN
                     RIQQIKDRIRELLELSTPLMEAMENLEAEIARVEEELSALRPRLEELLAANRDRVEAL
                     KAEVERRLAERAALAQGVPAAVLKEYEAIRRARKGMGIVRMTRQGQAFRCEGCNVVLP
                     THVAQKVVQGQLTRCPSCGRLLWKGE"
     gene            complement(402605..403237)
                     /locus_tag="TCCBUS3UF1_RS01810"
                     /old_locus_tag="TCCBUS3UF1_3800"
     CDS             complement(402605..403237)
                     /locus_tag="TCCBUS3UF1_RS01810"
                     /old_locus_tag="TCCBUS3UF1_3800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014514791.1"
                     /db_xref="GI:504327689"
                     /translation="MRVFRLTLGPLEENAYLVEGPEGALLIDPGDEPERILGLLEATG
                     LTPKAILLTHAHFDHVGAVAPLVERLALPVFLHPLDLPLYRHAAEAARSWGLAIPQPP
                     LPVEPLAEGGQAFGLEVWHLPGHSPGHVAFLYRKEEGPPQVFSGDLLFRGSIGRYDLP
                     GASREALFRSLKRLLTLPPETQVYPGHGPPTTLGLEARANPFLKGLEWEA"
     gene            complement(403234..403926)
                     /locus_tag="TCCBUS3UF1_RS01815"
                     /old_locus_tag="TCCBUS3UF1_3810"
     CDS             complement(403234..403926)
                     /locus_tag="TCCBUS3UF1_RS01815"
                     /old_locus_tag="TCCBUS3UF1_3810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="WP_014514792.1"
                     /db_xref="GI:504327690"
                     /translation="MELPQGAVLVDTRPRAAYEAGHLPGARHLDLSAPRLRLREEGEL
                     KALEAGLTELFQTLGLESPVVLYDEGLTSRLCRTAFFLGLGGLEVELWTEGWEAYATE
                     KEEPKPERTQVEARLRRDWLLTADEAARHPLLLDVRSPEEFQGKVHPPCCPRGGRIPG
                     SRNAPLEVFLEPGRVLERLGLAPGQEVGVYCHSGARSAVAFFVLRSLGVRARNYLGSM
                     HEWLGEGLPTEP"
     gene            404025..404489
                     /locus_tag="TCCBUS3UF1_RS01820"
                     /old_locus_tag="TCCBUS3UF1_3820"
     CDS             404025..404489
                     /locus_tag="TCCBUS3UF1_RS01820"
                     /old_locus_tag="TCCBUS3UF1_3820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp20"
                     /protein_id="WP_014514793.1"
                     /db_xref="GI:504327691"
                     /translation="MALVRRETRPAEITPFRTWGPFSLLEEANRLFEEVLGEFARPGV
                     AYVAPADLYETDEALVLEMAVPGLAPEDLEVSLEGQKLTVRGQVKPAEEAKARRYYLQ
                     EIPHGSFVRSFSLPVEVKAEEAKAEFRHGVLRLTLPKVAEARAKRIPIEVVR"
     gene            complement(404516..405586)
                     /locus_tag="TCCBUS3UF1_RS01825"
                     /old_locus_tag="TCCBUS3UF1_3830"
     CDS             complement(404516..405586)
                     /locus_tag="TCCBUS3UF1_RS01825"
                     /old_locus_tag="TCCBUS3UF1_3830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_014514794.1"
                     /db_xref="GI:504327692"
                     /translation="MGLPPRKDSLKWSAYPEDVLPLWVADMDFPVAEPIRKAIAERAE
                     GFLGYPPREGDEGLRDLLLEGSGLEGEVAFMPGVVVGLYAAVAAFTAPGQGVLTQVPI
                     YPPFLAAIREQKRTVLANPLQETEAGYRLDLQGLERLAYASRLLLFCHPHNPTGRVFT
                     EEELAALAAIARKHDLIVVSDELHAPLTYEGGHLPLARLLPERTLTLLGPGKAYNLAG
                     LPIGAAVGPKPLVEALRRHLPHTFPNVLAMAAWKAALKEGGAWLGETLKRLKANRDRV
                     AAWAQEVGLGHFPPEGTYLAWLKTPIPRAGAFFLREARVALNPGESFGEGYERFVRLN
                     FATYPEVLEEALARMARALNKA"
     gene            complement(405612..406547)
                     /locus_tag="TCCBUS3UF1_RS01830"
                     /old_locus_tag="TCCBUS3UF1_3840"
     CDS             complement(405612..406547)
                     /locus_tag="TCCBUS3UF1_RS01830"
                     /old_locus_tag="TCCBUS3UF1_3840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N7)-methyltransferase"
                     /protein_id="WP_041433943.1"
                     /db_xref="GI:752794512"
                     /translation="MLVRPALLPSWPPSPSDLFGREGPLVLEVGFGDGRFTAELAQTH
                     PGWLILGAEVSAASVLRALKRLRRAGLANVRLYHGEGPFALRNLVPPRGLHQVIVNFP
                     DPWPKKRHQRKRLLQEGFFRRLSTRLEEGGSLRLTTDHEAYFRFALEEAERTGLYRIH
                     VEPPPEAHLRTKYALKWKEAGRPFFHAVFTKVAEDPTPWPPTRRYPMAHALLAGDLPE
                     SLPLGKEPIPFPGGVAVFLEVARGETGFYILTHVEEEELTQDLLLEVRPSAHGIYAGA
                     SRFASPLLTEGVKAAVRALVARLTALGLEVVQDHT"
     gene            406621..407214
                     /locus_tag="TCCBUS3UF1_RS01835"
                     /old_locus_tag="TCCBUS3UF1_3850"
     CDS             406621..407214
                     /locus_tag="TCCBUS3UF1_RS01835"
                     /old_locus_tag="TCCBUS3UF1_3850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514796.1"
                     /db_xref="GI:504327694"
                     /translation="MSLFGNLRSLPLEELLQLLAQKEGALEIWNVRGVPATTLYLKPG
                     RLRSLDQGGKPLDPVDAKAALQALLLAREGSFEFCPGARPPHAFRLNWPLERLLLGLI
                     TFSDELAHLRPHLPPPRAVFRVERPAPGPGGLEGQAFWEKALPHLRQGTTPEALARLL
                     GMPLDLVRYRLYQLEGQGLVRRTGQVKGLGRSGGVGS"
     gene            407211..408173
                     /locus_tag="TCCBUS3UF1_RS01840"
                     /old_locus_tag="TCCBUS3UF1_3860"
     CDS             407211..408173
                     /locus_tag="TCCBUS3UF1_RS01840"
                     /old_locus_tag="TCCBUS3UF1_3860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_014514797.1"
                     /db_xref="GI:504327695"
                     /translation="MRGPALPRVLVAEDDPGQRFLLARAMAPLGVEVWQAPNGQEALG
                     LLRQGLPHVVLADLHMPLMDGLELTRRLKALDPLLPVILLTADAEREVRLQGIQAGAD
                     DFLHKPVDLTELRLRVGGHLERRRLQEKLEDLERALLALVRAVEAKDAYTAGHGERVA
                     TYALYAAGELGAGEEELADLRLGALLHDVGKIALPDPILRGGYPLTEAEWRAIREHPV
                     KGDEILKPLRAHPRLRPYVRWHHERLDGSGYPDGLTEVPPLVQAVAAADIYDALTSGR
                     TYRQALRPEEALEALEAEVRQGRLSREVVRAFRSGMARNRFRLT"
     gene            complement(408170..409957)
                     /locus_tag="TCCBUS3UF1_RS01845"
                     /old_locus_tag="TCCBUS3UF1_3870"
     CDS             complement(408170..409957)
                     /locus_tag="TCCBUS3UF1_RS01845"
                     /old_locus_tag="TCCBUS3UF1_3870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="WP_014514798.1"
                     /db_xref="GI:504327696"
                     /translation="MFRNLRAYLDALERRGELKRVRVPVSAELEITEIADRMVKRGGP
                     ALLFEQVVGKDFPVAIGLFGTRERTAFALGVKDLDELARKVEHLLALHPGKGGLSALL
                     GLLPKLPLLKGFFPRRVGRAPVQEVVYRGEAVDLSRLPVLRCWPLDGGPFLTLPLVIT
                     KDPETGELNLGMYRMQVLDRRSTAMHWQLHKVGRRHLEKARKLGKRLEVAVALGGDPV
                     LTYAATAPLPPLPGVSEFHLAGFLRGAPVELAQGVTVDLPVPAEAEFVLEGYIDPEEP
                     PVVEGPFGDHTGFYTPPDLYPRFHVTALTHRRGAIYPATIVGVPPMEDAYLIEASERL
                     FLPPLRLILPEVADYHMPPEGVAHNWVNVALKKEYPGQAYKVAYGMLGLGQMMFAKVI
                     VAVDAGVPVRPGWAALLKALEHALPGRDTLLLRGPIDVLDHSSRGFAFGGKLLIDGTR
                     KLPEEGGEVAFTPRAHPDLPQDLEVLAQRQWPGLWGATLAKRRPHQAWEVAERLLGTP
                     QSAGIRLLLLADHDTALTPEELLWAVLNNIDPERDARVLPGAEGPVLVLDGTRKLPEE
                     GFARVWPERIRMDPGVQALVEARWAEYGL"
     gene            complement(410000..410329)
                     /locus_tag="TCCBUS3UF1_RS01850"
                     /old_locus_tag="TCCBUS3UF1_3880"
     CDS             complement(410000..410329)
                     /locus_tag="TCCBUS3UF1_RS01850"
                     /old_locus_tag="TCCBUS3UF1_3880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514799.1"
                     /db_xref="GI:504327697"
                     /translation="MRGGWAEEAALAHLLAQGYRLLGRNRRTPFGEVDLLLEKDGVYV
                     VVEVKQRRTGRFGTPLEAITPRKVARLLACARHLLGRDDLPVRLEAVLVHGTPEAFRL
                     EHLPLEV"
     gene            complement(410326..411651)
                     /locus_tag="TCCBUS3UF1_RS01855"
                     /old_locus_tag="TCCBUS3UF1_3890"
     CDS             complement(410326..411651)
                     /locus_tag="TCCBUS3UF1_RS01855"
                     /old_locus_tag="TCCBUS3UF1_3890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514800.1"
                     /db_xref="GI:504327698"
                     /translation="MILDDRYPVLETLEERDGITLYRVEGGVVFFFQVHTPEGRERFY
                     RYRTALRRLEELGLLEAVVSAKPGRYYAFFPEKPLAPKPPPRAALEALAPLGFGREHL
                     AMAEEGVAYLSPWPLGKPARSPRPRPGFLVGVAPGLLLAALGLWLLSQGLYRYFNPPE
                     YTVPNLVGKSAREAFLLLKDTGLVLEVAEGNDPSRPKEEVLAQDPPPGTRLRAGRTVR
                     LTLNQARLNPLPNLTGLRREEAEARLKELGYRLEGLAQVESQEPLGRVLATFPPAGTP
                     LAPGGGVRLLLSRGAGPGPTLPLPKLTGLSRQEALFLLNAAGLQAEVVEVPSGAPPDL
                     VLAQDPAPGTPMPPGSGVRLRVAVRGEVALPSAPPEPETRAVSFSLDLPAEAQGRRVR
                     LVLLDARGEHVLYEGEGQEGLRLEGSYQAQGEARFRLYLDGDLFQEWSP"
     gene            411710..412252
                     /locus_tag="TCCBUS3UF1_RS01860"
                     /old_locus_tag="TCCBUS3UF1_3900"
     CDS             411710..412252
                     /locus_tag="TCCBUS3UF1_RS01860"
                     /old_locus_tag="TCCBUS3UF1_3900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridine nucleotide-disulfide oxidoreductase"
                     /protein_id="WP_041433670.1"
                     /db_xref="GI:752794238"
                     /translation="MWDVLVVGGGPAGLSAALFLARAGLKVLVLDGGRSQVAQVSQVP
                     NYPGLLDEPSGEELLARMREHARRYGAEIREGVVKGVRDLGGVFEVETGEGLVEAERL
                     LLCTHKDPTLPSLLGLARKGNFVDTDEGGRTSYPRVYAAGVARGKVPGHAIVSAGDGA
                     YVAVHLVSDLRGEPYKDHAK"
     gene            complement(412253..413023)
                     /locus_tag="TCCBUS3UF1_RS01865"
                     /old_locus_tag="TCCBUS3UF1_3910"
     CDS             complement(412253..413023)
                     /locus_tag="TCCBUS3UF1_RS01865"
                     /old_locus_tag="TCCBUS3UF1_3910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011172461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014514802.1"
                     /db_xref="GI:504327700"
                     /translation="MGLFAGKGVLVTGGARGIGRAVAEAFAREGALVALCDLRPEGKE
                     VAQGIGGFFVQADLAEERDRVRFVEEAAQALGRVDVLVNNAAIAAPGSALTVRLPEWR
                     RVLEVNLTAPMHLSALAAREMRRVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLT
                     RSLALDLAPLGIRVNAVAPGAIATEAVLEAIALAEDPERTRRDWEDLHALRRLGRPEE
                     VAEAVLFLASEKASFITGAILPVDGGMTASFMMAGRPV"
     gene            complement(413028..414152)
                     /locus_tag="TCCBUS3UF1_RS01870"
                     /old_locus_tag="TCCBUS3UF1_3920"
     CDS             complement(413028..414152)
                     /locus_tag="TCCBUS3UF1_RS01870"
                     /old_locus_tag="TCCBUS3UF1_3920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_014514803.1"
                     /db_xref="GI:504327701"
                     /translation="MRLYQLDSYATHFQARVERAWSDARGHYAVLSQTLFYPESGGQP
                     ADTGVLRGGFGEVRVLHAYEEEKAFGNVVHVLERPIPEGEAVEGEIDWPRRFRHMQRH
                     TAQHLLSQALLRAGGYHTVAVSLDSAVCTVDLEEEAEEEKIRQAEALANFAVYADHPV
                     EAFFVTEEELGHYPLRRPPKVQGQIRLVRIGDFDLAACGGTHLKTSAQAGPIKVLKWE
                     RYKGGSRVYFTAGWEALEDYHAKHALLSRLALGFSTNPLDLEKPVRRLQEELQALKGE
                     NLALKEALVEALLPRALEAGTLLVPGPALGELAKRLLAWKERTFLLLSPEGRFALLGP
                     GREAVLERLKALGAKGGGKEVVQGALPRERVAEALAGPLG"
     gene            414172..>414327
                     /locus_tag="TCCBUS3UF1_RS01875"
     CDS             414172..>414327
                     /locus_tag="TCCBUS3UF1_RS01875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718161.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_041433944.1"
                     /db_xref="GI:752794513"
                     /translation="MAPLEREAYGPWRAQALRTLRPAAGDFREGDGDWASFKAHQAGA
                     LGLKGLLR"
     gene            414430..415155
                     /locus_tag="TCCBUS3UF1_RS01880"
                     /old_locus_tag="TCCBUS3UF1_3940"
     CDS             414430..415155
                     /locus_tag="TCCBUS3UF1_RS01880"
                     /old_locus_tag="TCCBUS3UF1_3940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridine synthase"
                     /protein_id="WP_041433672.1"
                     /db_xref="GI:752794240"
                     /translation="MRGERLDRLLARLGLGSRKEVARLVRGGRVRVAGEEVRDPGCHV
                     PPGATVELDGKPLRVRRHHHVLLHKPAGYVTSRTEGPSVYALLEGFPTRDLSPVGRLD
                     KDTEGLLLFTTHGELLHRLTHPRHKVAKRYLVHLLHPATEADRQAFAEGLVLEGERLL
                     PALLAWGEDPTRVELTLLEGRFHQVKRMFAARGNRVLYLKRLALGPLGLEGLARGEAR
                     YLTPEEEAALYRAVGLWGEDAQG"
     gene            complement(415129..415602)
                     /locus_tag="TCCBUS3UF1_RS01885"
                     /old_locus_tag="TCCBUS3UF1_3950"
     CDS             complement(415129..415602)
                     /locus_tag="TCCBUS3UF1_RS01885"
                     /old_locus_tag="TCCBUS3UF1_3950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514806.1"
                     /db_xref="GI:504327704"
                     /translation="MKPPIWLWFLLPLGVLLWSAQGLFSAYAGYRQAIEAVRALERES
                     EALARGLPAALAEAPVKAEALPALYEELVRLAEGKGLALKRLQPEREAVQVGEVRAWS
                     LGLTLEGPYLGVLAYLEALPKADKPLWVAGYALSPVPETRGERLTLDLTLRILAP"
     gene            complement(415599..416789)
                     /locus_tag="TCCBUS3UF1_RS01890"
                     /old_locus_tag="TCCBUS3UF1_3960"
     CDS             complement(415599..416789)
                     /locus_tag="TCCBUS3UF1_RS01890"
                     /old_locus_tag="TCCBUS3UF1_3960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011174200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein F"
                     /protein_id="WP_014514807.1"
                     /db_xref="GI:504327705"
                     /translation="MRFLYEATDERGERVYRGVLEAQNPQEARKRLREMGLYPLRLEP
                     GRRPPRGRVPLPELVLFMEELATLVGAGVPVAQALHTLSLESRHALLKEAARGVRERV
                     EGGESLAQAMGHYPEVFPPLVRALVAAAEVGGALEVVLRRIAEYLDKSHDLREKVRTA
                     LLYPSFVVVVLVLVVAVLLLFVIPVFARLYGAAGAELPWPTRFLIGTSLFVRQNALWI
                     LLFLLALAYFLRAYHRTPGGARLLDGLSLRLPLVGPILHKAAMARFARTLATLYEGGV
                     LITQALEATRNVLGNAALAEALDRVLERVVRGESLSAAMSREPLFLPILVRLALVGEE
                     AGNLERMLYQVAFHLEREVDYGVKRLSSSIEPALTVLLGGIMLLVALALYLPLFDLSR
                     ILRR"
     gene            complement(416793..418442)
                     /locus_tag="TCCBUS3UF1_RS01895"
                     /old_locus_tag="TCCBUS3UF1_3970"
     CDS             complement(416793..418442)
                     /locus_tag="TCCBUS3UF1_RS01895"
                     /old_locus_tag="TCCBUS3UF1_3970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014514808.1"
                     /db_xref="GI:504327706"
                     /translation="MPRPKLGELLLRLGYLTEEQLQGALEEQARTGDLLGQILLRRGY
                     VREEDLVRALADQQKAPLVRVGELSPDPKALALLDPRFAREKRVLPFRVEGNRLHVAM
                     AHPSDLALLDELRFLTGKEIQPYLAPDREILEALDRLLAEEARPRQPEEAQASPPAEM
                     DLTLEAMPAVRLAQALLERAIALLASDLHLDPGETQLVVRARVDGVMQELERLPKDLE
                     APLSARYKVLAGMDIAERRRPQDGHFSFAFEGKRYEVRVASVGSLHGEKLTLRIIYPT
                     GVRLGLLELGMLPEELALFQRLIRRPHGILFVTGPTGSGKTTTLYAALEQLYTKDKTF
                     VTIEDPVEFPLEGVVQIPVQPKIGLTFAEALRSVLRLDPDVILVGEVRDGETLDTALR
                     AALTGHLVLATLHANDALAAVTRLLEMGAERHLLASTLIGTVAQRLVRRVCPQCARPA
                     PLSEEARLFFGTEAPEEELRGEGCPYCRGTGYRGRVGLYEVYAPDREALYQLGQGAGE
                     GDLRQLAALRGHRDLRQVGLLQVRAGTTTGEELLRVLGLWE"
     gene            complement(418420..419613)
                     /locus_tag="TCCBUS3UF1_RS01900"
                     /old_locus_tag="TCCBUS3UF1_3980"
     CDS             complement(418420..419613)
                     /locus_tag="TCCBUS3UF1_RS01900"
                     /old_locus_tag="TCCBUS3UF1_3980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433945.1"
                     /db_xref="GI:752794514"
                     /translation="MHLLFPRRDRILRLKEGAVEVIPAPDLVDEEGKPRYERLWYHLR
                     GLEARGGYLGLGPEFALLRLQPFPSLQGFPLEEAVLAEAERSPLFAGEELLADYLLVA
                     PEDERRVRVLYGAMPRRRAAWLYRLRPARVEPLPLLLWRYALGQSRGTSVLVLENLAH
                     TLALFEGGVLKGFRYLTSGADEGSERLTEEVVRSLALFGHPGKVEEAWVLGLPTPPPL
                     PPGLPAQRVEQLAPLNLAEAALAKELSLDLRPRRKALGEGLPREAQVAVFLAALFFAM
                     GLVGKGVLENLKAAEARRAEALRQQVELLRAQTFQPARPRGLSLEEILRVAAERPENL
                     WLTTLTAEENRLFLAGKALDPYAPLLLARRLGGRPGPIQASSEGERGPRVYTWEVEVA
                     KAEAR"
     gene            complement(419632..420177)
                     /locus_tag="TCCBUS3UF1_RS01905"
                     /old_locus_tag="TCCBUS3UF1_3990"
     CDS             complement(419632..420177)
                     /locus_tag="TCCBUS3UF1_RS01905"
                     /old_locus_tag="TCCBUS3UF1_3990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514810.1"
                     /db_xref="GI:504327708"
                     /translation="MTARGVSLIELAVVLALAGILALALSSLLLAGVRSQQETPLLQA
                     QALAQDLRDRLGADLRNTTSTGVIALLGQSPTATSFIAEVQVGTGKVCVQYRLQASVL
                     ERRSWTGSCTSPTGTFSKALDPALLPFAAFCYDDPNAPGTVALMDAPCTLADLNGKGL
                     TLRLSGRDYPFPPLVISLRSG"
     gene            complement(420178..420906)
                     /locus_tag="TCCBUS3UF1_RS01910"
                     /old_locus_tag="TCCBUS3UF1_4000"
     CDS             complement(420178..420906)
                     /locus_tag="TCCBUS3UF1_RS01910"
                     /old_locus_tag="TCCBUS3UF1_4000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514811.1"
                     /db_xref="GI:504327709"
                     /translation="MRKGFTLVEAAVALLLVGAVVYMVLALSQTLRAGTATGPQEEVL
                     QAAETLLEAGVAAPTCPTSASVTLAGKAYRICRQMAGVSLSPPSNTTLQAFTYRFEDV
                     AQGESFFLTQISWEGSPPPPPPSPNFSASCRKVSPNRLRMEISNTGATISTKVLSLSW
                     NGEGKRRLKEIYQGSTTLWSDNKGVKKGSQVSLSQSLTFGNATLDFTFDKNFKTGSYT
                     FTLQLFVGQGNNQTPYTVSCSVGW"
     gene            complement(420903..421343)
                     /locus_tag="TCCBUS3UF1_RS01915"
                     /old_locus_tag="TCCBUS3UF1_4010"
     CDS             complement(420903..421343)
                     /locus_tag="TCCBUS3UF1_RS01915"
                     /old_locus_tag="TCCBUS3UF1_4010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514812.1"
                     /db_xref="GI:504327710"
                     /translation="MGRRGYLVLTLALALVFFGILLLPSTLLARLNAERTLTSQSALQ
                     ALYLAEAGAWEAIARLDSQNGPGQAVQVCRTAGASCTPASPEYVGCYTYSTTQPTDCT
                     APSLPSGGTVTLWGFGKTKGGSVRWVRVSYDTANQTVLSWEVLP"
     gene            complement(421346..421795)
                     /locus_tag="TCCBUS3UF1_RS01920"
                     /old_locus_tag="TCCBUS3UF1_4020"
     CDS             complement(421346..421795)
                     /locus_tag="TCCBUS3UF1_RS01920"
                     /old_locus_tag="TCCBUS3UF1_4020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein G"
                     /protein_id="WP_014514813.1"
                     /db_xref="GI:504327711"
                     /translation="MRQGFTLIELALVLLIVGVLVAVAVPRFLDLSLQAERAAAQKTL
                     LALNSTVRILTVRLGRPPTLDEVWEALDSPYKKDVWEEPFLKRNPYGSYNYQIVLRYR
                     PGREYCMDGYNPLGGLAEAGSPNEPRAQIVVFRPYTSGHGDYYQGEF"
     gene            complement(421806..422237)
                     /locus_tag="TCCBUS3UF1_RS01925"
                     /old_locus_tag="TCCBUS3UF1_4030"
     CDS             complement(421806..422237)
                     /locus_tag="TCCBUS3UF1_RS01925"
                     /old_locus_tag="TCCBUS3UF1_4030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="general secretion pathway protein GspG"
                     /protein_id="WP_041433674.1"
                     /db_xref="GI:752794242"
                     /translation="MAKEGITLVELAVAIGIVAMILALAVPRYTDLKGMAQKAQRQEV
                     LRNLRSTYAIYVAQHRTVPTWNALKTLMGEPTNLRLSSSCPSGTTVAYWDHNENAACN
                     VGERLAYLYADEACTLFLIGLSSTTVTVSIRCLRGHPETLD"
     gene            complement(422219..423664)
                     /locus_tag="TCCBUS3UF1_RS01930"
                     /old_locus_tag="TCCBUS3UF1_4040"
     CDS             complement(422219..423664)
                     /locus_tag="TCCBUS3UF1_RS01930"
                     /old_locus_tag="TCCBUS3UF1_4040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligase"
                     /protein_id="WP_014514815.1"
                     /db_xref="GI:504327713"
                     /translation="MRPSTPPSVHPVLEGGMLLGLWAALVALNPWGKEFTAIWNSPRE
                     VSMGTFVFAALLGLLLRRNNLPDPPKRNVSAPLWASVSFLAFGLAATVYSPQPIWSWT
                     GYPSVGDGLRFWALGIAFAWSTYLALETGLLKPRLLVAALLLALGTHALAIFPQLFDW
                     KLDYTQTSGQTYVRCFDLERSFCQENPNATASGIHRSHMPIGLTSHRGHAAGALALLS
                     LFVAGLYVQRPNPKLLFLFALGALALWFTQTRGGWMALWGILLFLVLAFSVKRSALAP
                     LAWHLLGIGLLTYGVYWGAGKLLPTEMRSFGELGASFDKVNTYTSGRLDLWQKALTAF
                     PIRPLLGWGFDGYARAYPYGVDWNGKDRPLLPQGLKPPVQVVLGEDRLIYLEDRHGLR
                     ILAPAPYAKAHNLFLDLLLSVGILGGISYLLWLGLAIKQATWPKFPLLLVLLGYLLFG
                     FTWYDSIHVTPIALLALGASFASETVWLKKE"
     gene            complement(423667..424062)
                     /locus_tag="TCCBUS3UF1_RS01935"
                     /old_locus_tag="TCCBUS3UF1_4050"
     CDS             complement(423667..424062)
                     /locus_tag="TCCBUS3UF1_RS01935"
                     /old_locus_tag="TCCBUS3UF1_4050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514816.1"
                     /db_xref="GI:504327714"
                     /translation="MKAKGFTLIELAIVIVIIGILVAIAVPRFVDLSGDAKDAAVQAT
                     ASSVRSAYAIYVAQNKDYPDYCSDVLNGLEGVNIGSGSSSVTLAGNVVVSCANANPAA
                     GNADISVYATGAKTYNSATNALKVNLRFK"
     gene            424219..425352
                     /locus_tag="TCCBUS3UF1_RS01940"
                     /old_locus_tag="TCCBUS3UF1_4060"
     CDS             424219..425352
                     /locus_tag="TCCBUS3UF1_RS01940"
                     /old_locus_tag="TCCBUS3UF1_4060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="vancomycin resistance protein"
                     /protein_id="WP_041433676.1"
                     /db_xref="GI:752794244"
                     /translation="MRVGLAWALAFLLGGMGAKGSPMEALLVLQEEAIEEGRLLTYTG
                     VQRYPVASEGELLALLKRLARPPRPPRFILQDGRWRGVEKKGLSFDEAEVLAAYRQAL
                     AAGQGSFRLPVRYTPPQPSLKALYALGVREHLATGETDFRGSSRARLHNLLLASSKLD
                     GLLIPPGPFSFHQALGPVSEEAGYREAFVIVGDRTEQGIGGGVCQVSTTLFRAFFFAG
                     LPILERHAHSYQVAYYKPTGLDAAVIAPHKDLRVLNDTPGHLWVQRSVVGTRLRFHLF
                     GTKDREVRWEGPFVSERKPPLPPKEVLDPSLPPGVRQQVDFAAEGARVEVRRTVRYRD
                     GRVREERLLSLYRPWGAVYRVGPTPPAKAPPSPPAGGGGARSP"
     gene            complement(425288..425551)
                     /locus_tag="TCCBUS3UF1_RS01945"
     CDS             complement(425288..425551)
                     /locus_tag="TCCBUS3UF1_RS01945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433678.1"
                     /db_xref="GI:752794246"
                     /translation="MQSFKLHLLRLAREGVVEVPGLPVRAYALREEEARSGQGVFYVV
                     LEGELVIDLPEGRYLHLKRGEGAKVSEPHRLLPVEKAVLLQVG"
     gene            complement(425551..427986)
                     /locus_tag="TCCBUS3UF1_RS01950"
                     /old_locus_tag="TCCBUS3UF1_4070"
     CDS             complement(425551..427986)
                     /locus_tag="TCCBUS3UF1_RS01950"
                     /old_locus_tag="TCCBUS3UF1_4070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_041433679.1"
                     /db_xref="GI:752794247"
                     /translation="MVVVESPAKAKSIQKMLGAGYEVRASRGHVADLPERELGVDVER
                     GFAPTYEVKKDKKPVVEELKRAAQGRRLLIATDPDREGEAIGWHLARLLGRDPQEPLR
                     VEFHEITPKVVREAVARPRPIDQNLVDAQQARRVLDRLLGYNLSPLLSLEFRKRALSA
                     GRVQSVALRLVVEREEAIEAFRPEAYWTLEGRFAVEGQELAASLHEVEGRRLWTGQGD
                     KEGRLHLQSEAEAQALAEAMRGLPFRVAQVETKERRKAPPPPFTTSTLQQAASSRLGY
                     TASRTMRIAQRLYEGVDLPEGTVGLITYMRTDSVRVSPEALQAAREAIAQAFGPAYLP
                     ESPRVYKNRREGVQDAHEAIRPTDPRRTPEGVRPYLSEEEYRLYDLIWRRFLASQMRE
                     ALYDQTVVLLQDQGEKPRFTFRAAGSVLRFEGYLKAWGREGEEEEEAPVPAVAQGAEA
                     RLLGVRPEGHTTEPPPRYTDASLVKAMEELGIGRPSTYAPTLETLEKRGYVERKGRTL
                     LPTLLGRQVTRYLKERFPQVVAYEFTARMEDRLDQIEEGKAPWPQVVWEFYEPFLGEL
                     AQVPKKACPRCGRPLELKVSRFGQFLGCTGYPGCTYTEPLEKKEAEAIGEVCPRCGRP
                     LLRKEGRYGSFIACSGYPECDYTRDDGKATGHTCPKCGGRVLEKRSRRGKPYYRCESC
                     DFLSFYPLLDKPCPACGWPLAGKGEGACLNPSCPAHDPRLQPSPREERTKASGKGGKP
                     KGKARASSPKPPQDWGDLIPFLPELPPEERQAVEALAQGEALSEEGAKLAKRALFKLR
                     MRKGRARKEVAPT"
     gene            complement(428110..429438)
                     /locus_tag="TCCBUS3UF1_RS01955"
                     /old_locus_tag="TCCBUS3UF1_4090"
     CDS             complement(428110..429438)
                     /locus_tag="TCCBUS3UF1_RS01955"
                     /old_locus_tag="TCCBUS3UF1_4090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybutyrate CoA transferase"
                     /protein_id="WP_014514820.1"
                     /db_xref="GI:504327718"
                     /translation="MSYRKKLTSPEDAVGLIRSGMRVFVSGNAATPTPLLKALAARKD
                     ELENVELVHLLQMGEDPFAAPEMEGHFRRRSLFVGPADREAVNQGRADYVPITLHQVP
                     WLFKRRVLPLDAAIVQVSPPDEHGFCSLGVEVIATKAALEAAPIVIAMVNPRMPRTLG
                     DTFVHVSRFSAIVELDWPLPELKREGFGEVERKIGEHVASLIEDGATLQMGIGAIPDA
                     VLASLTGRRDLGVHTEMISDGVLEAFEKGLITGARKTLHPGKVIGTFVLGSERLYRFV
                     HDNPLFELHPTDYVNDPFVVAQNRKMVAINSAIEVDLTGQVVADSIGTRIYSGFGGQL
                     DFIRGAARSEGGKPIIALPSTAKGHSRIVPYLKPGAGVVTTRADVHYVVTEWGIAELF
                     GRSLRERALALIGVAHPDFREELMKAAWERKLLPRSYPGASLPAKDEPRS"
     gene            complement(429435..430496)
                     /locus_tag="TCCBUS3UF1_RS01960"
                     /old_locus_tag="TCCBUS3UF1_4100"
     CDS             complement(429435..430496)
                     /locus_tag="TCCBUS3UF1_RS01960"
                     /old_locus_tag="TCCBUS3UF1_4100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="WP_014514821.1"
                     /db_xref="GI:504327719"
                     /translation="MDFGLPKERARLKTLPPFGEEVREGRVALTPQGVRELSARGHRV
                     YVERGAGEAAGFPDAAYEEAGARLVSREEAFRRGEVVLKVARPTQEEVALLRPGAAVM
                     AFLHLAVAESALVEAMAAKGLTAIGYELVGNEGKRPVLKAMSEIAGRLAPQLAGRLLE
                     APTGPGVLLSGLPGIPPADVVILGAGTLGRAAARAFLGAGASVYLLDKDLPALEKAAR
                     EAPGAVTALVTQSRLERYVGFADVLVGAVAVPGEKTPVLLSRELLARMRKGAVLLDFA
                     IDQGGIAETSRPGVYQELGITHFCLPNVPALVPRTASHALTATLLPFLLQLEDDPLRV
                     PELRQGAYLLLGQKGGHLE"
     gene            430585..431061
                     /locus_tag="TCCBUS3UF1_RS01965"
                     /old_locus_tag="TCCBUS3UF1_4110"
     CDS             430585..431061
                     /locus_tag="TCCBUS3UF1_RS01965"
                     /old_locus_tag="TCCBUS3UF1_4110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514822.1"
                     /db_xref="GI:504327720"
                     /translation="MEALADWLFVAFWVAGVGLTLLPFVPATLIILLGAFLHELLLGF
                     RELSVGAWLALGVLALLAMTLDNVAALLGARRYGAGRAGLWGAFLGGVLGLFLGVVGV
                     LVLPFLLAWLLEYLSGRRPDEALRAAWGTLVGLLGGVVAKTLVHVAMGLLVLRAIF"
     gene            431085..431318
                     /locus_tag="TCCBUS3UF1_RS01970"
                     /old_locus_tag="TCCBUS3UF1_4120"
     CDS             431085..431318
                     /locus_tag="TCCBUS3UF1_RS01970"
                     /old_locus_tag="TCCBUS3UF1_4120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_041433946.1"
                     /db_xref="GI:752794515"
                     /translation="MELVFLTREGCGLCERAERALWTLGVPYVRRLVDQEPQLLARYA
                     WRVPVLLVGEEPLLEGAFTEKELLALWPNLEGR"
     gene            431322..432173
                     /locus_tag="TCCBUS3UF1_RS01975"
                     /old_locus_tag="TCCBUS3UF1_4130"
     CDS             431322..432173
                     /locus_tag="TCCBUS3UF1_RS01975"
                     /old_locus_tag="TCCBUS3UF1_4130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_014514824.1"
                     /db_xref="GI:504327722"
                     /translation="MDPTMIQIGPLRIQWYGFLLTLAIFLGFELAKRRLRAWGLDAEK
                     FETVAFWAVVFGVVGARLGYVLTSPGYFLENPLEILYIWHGGLSFHGAILGGALVFLY
                     YHRRRGYPLWPYLDAATPGVALGILAGRIGNLMNGSDTAGRLTTLPIGFTWPEWAKGF
                     PGICPGIDDIAQVYSCQELLRGPVHLTQVYGALVGLILLPLALAWLRKRPFDGYAFWQ
                     FLLWYSVLRSVLEEPFRLNPLWLPVYRNDELGIGLFTATQVVSLPLILLALYMLRRLG
                     QRAKALG"
     gene            432183..433544
                     /locus_tag="TCCBUS3UF1_RS01980"
                     /old_locus_tag="TCCBUS3UF1_4140"
     CDS             432183..433544
                     /locus_tag="TCCBUS3UF1_RS01980"
                     /old_locus_tag="TCCBUS3UF1_4140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-1-phosphate
                     uridyltransferase"
                     /protein_id="WP_014514825.1"
                     /db_xref="GI:504327723"
                     /translation="MHAHVILAAGQGTRMRSRLPKVLHPLLGKPMLAYAVETALALNP
                     AKLVVVVGHGKEKVLEALEGYPVEVAFQKEQLGTAHALLQAEPFLKDFPGPTLVTQGD
                     TPLLSPSTLGGLLERVGEGAGMALLTVELSDPTGYGRILRQGEEVLGSVEEKDATPEV
                     RAIREVNAGAYAFDPFLFRALKEVRNENAAREYYLPDLIAIYRAHGKRVAAVRGAAEE
                     ALGVNTREELARVEGILLARLRAEWMRRGVRMILPESVYLEPSVELAPDVTLWPGVVL
                     KGKTRIGEGAEVGPYALLEDTVLEPGARVLGHTVAQGAVIAGGADAGPFARLRPGAVL
                     REGVHVGNFVEVKNSLLHPGVKAGHLAYLGDAEVGEGANIGAGVITANYDGKRKHRTW
                     IGKGAFIGSNAVLVAPVRVGDGAMVGAGSVITQDVPEEALAVARGRQRNLEGYARRKR
                     EGE"
     gene            433586..433819
                     /locus_tag="TCCBUS3UF1_RS01985"
                     /old_locus_tag="TCCBUS3UF1_4150"
     CDS             433586..433819
                     /locus_tag="TCCBUS3UF1_RS01985"
                     /old_locus_tag="TCCBUS3UF1_4150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatA"
                     /protein_id="WP_014514826.1"
                     /db_xref="GI:504327724"
                     /translation="MNLGMPEILVILVVALLIFGPKKLPELGRSLGQSIREFKRGAQE
                     IREELEKSVEVREEPKPKAETPAKALEAEERKA"
     gene            433816..434559
                     /locus_tag="TCCBUS3UF1_RS01990"
                     /old_locus_tag="TCCBUS3UF1_4160"
     CDS             433816..434559
                     /locus_tag="TCCBUS3UF1_RS01990"
                     /old_locus_tag="TCCBUS3UF1_4160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit TatC"
                     /protein_id="WP_014514827.1"
                     /db_xref="GI:504327725"
                     /translation="MKEAPLVEHLEELRARLLWSLLAWVVGTGVAWSFRVGLLDWLKR
                     PLDLAAAQNGIQVNLIVLDITEPFLVSLKVAAFGGLVLALPFIVYQVWAFIAPGLYEH
                     EKRLAAPFLLGAGFSFALGALFAYYGFLPFAIPFLLGFLGDVITPQISIGRYMGQVLM
                     MMSVMGLVFEMPVVSYLLARLGILSSGFLARNWRVAVVLLLTLAAVITPTVDIVSLSI
                     VTGPLLLLYWVSVLVARLAERARPKEETA"
     gene            434565..435632
                     /locus_tag="TCCBUS3UF1_RS01995"
                     /old_locus_tag="TCCBUS3UF1_4170"
     CDS             434565..435632
                     /locus_tag="TCCBUS3UF1_RS01995"
                     /old_locus_tag="TCCBUS3UF1_4170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514828.1"
                     /note="catalyzes the formation of
                     3-deoxy-D-aribino-hept-2-ulosonate 7-phosphate from
                     phosphoenolpyruvate and D-erythrose 4-phosphate and the
                     formation of prephenate from chorismate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase"
                     /protein_id="WP_014514828.1"
                     /db_xref="GI:504327726"
                     /translation="MDERILALRKEVDRVNRELLRLLSERGRLVQEIGRIQTELGLPH
                     YDPKREEEMLAYLTAENPGPFPAETIRKLFKEIFQASLDLEERQDQKKFLYSKAHKPE
                     PTRVRVKDVVFGEKPLLIAGPCSIESEAQMLETARFLAGKGVRVLRGGAFKPRTSPYG
                     FQGLGVEGLRIGRRAADAFGMVFVTEVMDTRDVEVVAEYADILQIGARNMQNFALLKE
                     VGRAGRPVLLKRGLSATMEEWFYAAEYILSQGNEQVILAERGIRTFERWTRNTLDLSA
                     VALAKQETHLPVIVDVTHAAGRTDLLAPLARAALAVGADGVHVEVHPNPKVALSDNQQ
                     QLDFPQFARFLEAIRDLLPGG"
     gene            435633..436574
                     /locus_tag="TCCBUS3UF1_RS02000"
                     /old_locus_tag="TCCBUS3UF1_4180"
     CDS             435633..436574
                     /locus_tag="TCCBUS3UF1_RS02000"
                     /old_locus_tag="TCCBUS3UF1_4180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_014514829.1"
                     /db_xref="GI:504327727"
                     /translation="MGFLDNLLQAFLKATDPRPRYTEARCLLYKNSVGGCDRCHQACP
                     KGAVRLEGWRVELDEVLCTGCGLCTGVCPGVALEFPLGGVQEALIRGKGQLRCSKAEG
                     KGEEVLCLGRLTPGLLAEAGSRFGRVVLARGACEGCRVGGASVPQHLERMAAEARRYF
                     PVEVEVRQGELPGEKVGRRELFQALMGSAKRTAADLVPELPLPQEPEEKGLPAELRLR
                     ALAASRSPEVRWPRIRVEEGCTLCPVCTNVCPTEAVSRVREGEEYVLRLRVAACTGCG
                     ACVESCPPQVIRLEEAPKDLLGEEVELFRGKPPWYDL"
     gene            436598..438238
                     /locus_tag="TCCBUS3UF1_RS02005"
                     /old_locus_tag="TCCBUS3UF1_4190"
     CDS             436598..438238
                     /locus_tag="TCCBUS3UF1_RS02005"
                     /old_locus_tag="TCCBUS3UF1_4190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514830.1"
                     /note="proposed role in polysaccahride synthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-binding dehydrogenase"
                     /protein_id="WP_014514830.1"
                     /db_xref="GI:504327728"
                     /translation="MDAEAIVVGGGLAGLVAATELAAKGKRVLLLEQEAHLGGQAFWS
                     FGGLFLVNSPEQRRLGIRDSVELAFQDWMGSAAYDREEDHWGRLFAQAYLEFAAGEKR
                     AWLASMGVRFFPVVGWAERGGGLASGHGNSVPRFHIVWGTGPGLLEPFLRRARQLEER
                     GLLQVRLRHRAEEVLVEGGKAVGVAGLVLEEDPKPRGVPTSRRALGEFCYRAQAVLLA
                     TGGIGGNLELVRRFWPERLGKPPQRMLSGVPDHVDGAGLFLAERAGARLVNLDRMWHY
                     PEGVENHTPIWSHHGIRILPGPSALWVDATGKRLPPPLFPGFDALETLRHLRQRGWDW
                     SWFILDLATLKKEFALSGSEQNPDLTGRSWLRVMQNRLLGPAAPVRAFLERGRDFLVA
                     EDLSELLSKMDALAPGVLDPVGLEREVKARDRELLHPFAKDAQVQALWGFRRYRGDRL
                     FRVAKPHPFLGGRGGPLVAVRLWTLTRKTLGGIQTDLKGRALTPGGKPLPGLFAAGEA
                     AGFGGGGFHGYKALEGTFLGGCLFSGLQAARGILEGLE"
     gene            438243..438638
                     /locus_tag="TCCBUS3UF1_RS02010"
                     /old_locus_tag="TCCBUS3UF1_4200"
     CDS             438243..438638
                     /locus_tag="TCCBUS3UF1_RS02010"
                     /old_locus_tag="TCCBUS3UF1_4200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonyl-CoA epimerase"
                     /protein_id="WP_014514831.1"
                     /db_xref="GI:504327729"
                     /translation="MRLHHVGIAVEDLEAAKARYLLLGYRVLAEGEVTAQGVRVAMLQ
                     GEGETLLELLAPLGPDTPVGRFLAKRGPGLHHLAFATPRILEDLARLRQEGAQAIDET
                     PRPGFGGHRVAFLHPSFGLGVLWELVEEA"
     gene            438635..438976
                     /locus_tag="TCCBUS3UF1_RS02015"
                     /old_locus_tag="TCCBUS3UF1_4210"
     CDS             438635..438976
                     /locus_tag="TCCBUS3UF1_RS02015"
                     /old_locus_tag="TCCBUS3UF1_4210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ"
                     /protein_id="WP_014514832.1"
                     /db_xref="GI:504327730"
                     /translation="MRRPWALVLALLHMGLLFWLSHQPATGAGLPHPWDKAAHFLAYL
                     LLGGLLGLGLGRWRAAFLGAFLYGVGDEWHQSFIPGREAFGWDLVADALGAWVGARWG
                     GRWEAPEASLP"
     gene            complement(438930..439613)
                     /locus_tag="TCCBUS3UF1_RS02020"
                     /old_locus_tag="TCCBUS3UF1_4220"
     CDS             complement(438930..439613)
                     /locus_tag="TCCBUS3UF1_RS02020"
                     /old_locus_tag="TCCBUS3UF1_4220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmE"
                     /protein_id="WP_014514833.1"
                     /db_xref="GI:504327731"
                     /translation="MLQGKAFLVTGAGGALARAVIPALHRAGARLFLSDPRPERMAER
                     AQGVGAETFVADLTRLEEAEALARFVERQAPLHGVVHTVGGFAAGRFLDSDPGLYDWM
                     LDLNLRTTYNLLRAVLPYMERRGEGFFAAIAAGPAWTGSGPGRVLYTVAKTALASLLR
                     SLQGEVEGVRFLVVYPMGTLDTEANRRAMPEADPSRWIAPEFLAEAIVLAASARGGRL
                     LELPIYPPT"
     gene            complement(439618..440604)
                     /locus_tag="TCCBUS3UF1_RS02025"
                     /old_locus_tag="TCCBUS3UF1_4230"
     CDS             complement(439618..440604)
                     /locus_tag="TCCBUS3UF1_RS02025"
                     /old_locus_tag="TCCBUS3UF1_4230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514834.1"
                     /db_xref="GI:504327732"
                     /translation="MRSLFRLFPFLLLGLYACTGSQEPLLPALVAAGGEGQVRFFRAQ
                     DLQGGAGSPVGTWNTPGLQDLAYSNASGRLYLLFPDRVEAYATQGFTENAAPQAPPLS
                     APLPADCTGGYLRLGQNRLLVHCPGAGRAFLLNLADLGNQEEADLTGLPPGSRLALYP
                     QNTLELLAYLTDTVLGYRPPSNPTGSPKGEAALGLAFTPSDLRLDPIRGRLLGAGRGA
                     TETYLVRWEGTSPNTPSLGLQGAVRLALDPVQGLAAYGGGFRALEPQDSGPRQGFSTY
                     GAGLVGQDAYLYLARGNLLEVYDLQANPFPASPQATALLGFSPSALAFIPVE"
     gene            complement(440601..443081)
                     /locus_tag="TCCBUS3UF1_RS02030"
                     /old_locus_tag="TCCBUS3UF1_4240"
     CDS             complement(440601..443081)
                     /locus_tag="TCCBUS3UF1_RS02030"
                     /old_locus_tag="TCCBUS3UF1_4240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514835.1"
                     /db_xref="GI:504327733"
                     /translation="MRPWLWLLLFLLAPAWAQEKALKVLEAERLELRQDGGEEVYVLT
                     GNPVRLEREGEAIQALRVVYFRGRRLLFLSGEVRYLDREGRRIEAEELQIDLGDESFD
                     ALEVRIEAKDLLLTGPLCQRAAGAILLERGYATPCAGCGQEVPDYAFRAREILLYPGD
                     RVVARGVVLLMGEKPVLELPVLLLYLSERRPRLELGQDEGGAYLKAALPYVSPLGLGY
                     TLLHYYAGRGYGFGLDHFGTGEAKERYFFLHTPPDTFQYRGEYGLKRPEFALSALLER
                     DDTREKLSRFRLEALLPGTPTPGDWRYALRLEGFLDHDPTTPPPRSLQRLPELEAQTP
                     TLREGPFSLQASLVLGRYLAETNPLNRSARALGPYGEAGRALLTHGESLLLTPWTGAS
                     LRLENRFRGFYYTTQNPDGEYERQVDWTTTASFRQALGGVSAELGYGRSLQEGESPFR
                     FDALPQRRSHQATLALAFQERPLNLALRTGRDLEAGKYLPLEAQAGLQDAGYALSLVH
                     RRGLSGEGPLETRAEGSLTPYPFSLRMSLRYDHTKEVFDPLALQAGYALPGGSLNLSH
                     RHGLNGEGALTTDLALSLREGTSAYTLQARRDWRQDTLGLQGQAIWGPESLSLQASLD
                     RQALGYTLGFRSGTAPGPLGELQLSGRYQEGPRGTNLRLSLVQALPEVGFRLTANLHL
                     PEVGDEGVYLKDATFSGGAELWPPTPADEKGEGAIPGLALSGAFTYTRQPSRPEGYTL
                     ALRNFGPTLTFVGRERTKLHLAALLSQNLPGEALRPRFVLVLDRCCWALRFTLDAQKG
                     SLGLAFLYGGQAAGLLLSEEGIQLGGTR"
     gene            complement(443078..444121)
                     /locus_tag="TCCBUS3UF1_RS02035"
                     /old_locus_tag="TCCBUS3UF1_4250"
     CDS             complement(443078..444121)
                     /locus_tag="TCCBUS3UF1_RS02035"
                     /old_locus_tag="TCCBUS3UF1_4250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Permease YjgP/YjgQ"
                     /protein_id="WP_014514836.1"
                     /db_xref="GI:504327734"
                     /translation="MKTLDRYLLREALGLFALGLGVIVLLFLAGAVYEVLAPLVAKGA
                     DPATLLLYLLYRTPEALVRGAPVAYLFALLLLLSRMAEDSELKALLALGVRRERVLLP
                     FLFLGGALSLLGLLLGESLVPRALAEGQDLLRRQVLERPRALLTPGTTFQDAKGRVVY
                     VGEVAGERIGKLRVLSREEVVLAEAGRFSGGVLQVGGGQRVTYEGDRPRTLTRFQRGE
                     LVLKDLTFEPWQNPANRMGLAQLRQEVERLRAQGVKAGLEATTYYRRYAEPAAALVFA
                     LFAVGLAFYLLGGSRSLGLVGVAVLTFFYYATWSVGRIMGEQNALDPLLAAWGPNLVY
                     GALGLLLFLGGRR"
     gene            complement(444118..445128)
                     /locus_tag="TCCBUS3UF1_RS02040"
                     /old_locus_tag="TCCBUS3UF1_4260"
     CDS             complement(444118..445128)
                     /locus_tag="TCCBUS3UF1_RS02040"
                     /old_locus_tag="TCCBUS3UF1_4260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_014514837.1"
                     /db_xref="GI:504327735"
                     /translation="MLGRYALKEVLVPYLVGVFLFVALLTFDLLSSLSGVLLSRGVGV
                     EAIGRLILLRLPWTLSLALPLGLVFAILVGLARLIRHSELKAAYAAGVPPWALLKPLG
                     LLALGVSLLNLANLAELRPRALEAYDAHLARLLYGEGGLSGVLRQQLYAPPGLGVYYA
                     EEVRPEVGQNRLFGVRVVDPQGRVYSGAEGVWDAEGWHFRGYVLEGGRLKPFQGTLPF
                     PAQFRPKESLGSRDPYDTSTLGELWERGKVESGARFALARRLADALGGFFLAWVAAAL
                     GLSFREAAWAFLSIVLLIFGYYVLWTFSAQLARYDVNPLWAFLPNGAFAALALGLTWR
                     LR"
     gene            complement(445168..445580)
                     /locus_tag="TCCBUS3UF1_RS02045"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(445796..446830)
                     /locus_tag="TCCBUS3UF1_RS02050"
                     /old_locus_tag="TCCBUS3UF1_4290"
     CDS             complement(445796..446830)
                     /locus_tag="TCCBUS3UF1_RS02050"
                     /old_locus_tag="TCCBUS3UF1_4290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011172490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014514839.1"
                     /db_xref="GI:504327737"
                     /translation="MRAVVYQGPFQVAVEEVPEPRLEGEGEAIVEVELSAICGSDLHI
                     YHGKIAGVLPGTVLGHEFVGRVVEKGPLVPWALGERVVGSFQVACGECPACRRGQYFA
                     CLKGGVYGFGLALGNLPGAQAQRVRVPFARHSLFPIGDLPAEEAILAGDILTTAYGGV
                     RPFLTPGMSVAVVGSGPVGLMAQAVAHALGAGPVFAIDPEESRLEKAQALGSLPVNPK
                     AEDPVARVRKETEGLGAELVVEAVGGDGEALKLALRLAGPGGVVSSLGVPTAERLDYP
                     WLPAFSRGITLRSALANIPRWIGEVLALQRVGRLRGSFVFSHRLPLGEAAEGYRLFHE
                     RRATKVALVP"
     gene            complement(446827..447219)
                     /locus_tag="TCCBUS3UF1_RS02055"
                     /old_locus_tag="TCCBUS3UF1_4280"
     CDS             complement(446827..447219)
                     /locus_tag="TCCBUS3UF1_RS02055"
                     /old_locus_tag="TCCBUS3UF1_4280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018461413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_014514840.1"
                     /db_xref="GI:504327738"
                     /translation="MQLFSEAWAQAYCQKLSESEAYRKAAATWEGSLALAVRQDPAQG
                     LPQGVAVVLDLWHGTCRGVKVVEGDAEADFVIEADLATWQEVLSGGLEPLTALMRGLL
                     ELKKGSIAALAPYAQAAQELVRVAREVA"
     gene            447269..447694
                     /locus_tag="TCCBUS3UF1_RS02060"
                     /old_locus_tag="TCCBUS3UF1_4300"
     CDS             447269..447694
                     /locus_tag="TCCBUS3UF1_RS02060"
                     /old_locus_tag="TCCBUS3UF1_4300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514841.1"
                     /db_xref="GI:504327739"
                     /translation="MVYLLDLSGVYCEPVEPHLLRLLSQASGEPLFYLSQAFYDLLPR
                     LRGEGPGALEALFPGASRLYPKAFRPRERAFPEPFYLVSDLPFPEGMTGFFHPEKLKA
                     LPLALAALGLSPEEALYLDDNPLLVERARALGYRAELFL"
     gene            complement(447691..449973)
                     /locus_tag="TCCBUS3UF1_RS02065"
                     /old_locus_tag="TCCBUS3UF1_4310"
     CDS             complement(447691..449973)
                     /locus_tag="TCCBUS3UF1_RS02065"
                     /old_locus_tag="TCCBUS3UF1_4310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_014514842.1"
                     /db_xref="GI:504327740"
                     /translation="MPGWLDQAVALLLKEGRLLLQAYPGAGKSTLFPLQVLKALPGRV
                     LLFEPRRVAARAVAARLAENLGEPLGKTVGYRVRLEGRESRETRLLVMTEGLLTRLLL
                     KDPTLEGVSAVLLDEAHERHLEGDLALALLLRIQETLRPDLKLALLTATPDEDLERAF
                     QGASLAVEGQSYPVEILHLTKAPEGPLEPLAARYAKEAFLEGEGDVLVFLPGKAEIER
                     TRALLQGLPAYPLHGGLPLEEQAALLRPGPRKIVLATDVAETSLTLPGVRRVVDSGLA
                     KKPRFDPRTGLTRLVLSPIPEASARQRAGRAGRVGPGRVYRLYPQGPFPPKRPEILEA
                     DLSRALLLALAFGEGLEALPLPTKPPAGALEGAWHLLERLGAVAGGRLTPLGKRMLAL
                     PTHPRLARMALEAEALGLLPLAADLMALLEERSPWEGEPDLLAHLEGLLEARRLGKGP
                     FLGVERAAALWRRRLGAQPLESLPAPEAVGRLLLAAYPDRAAEALSPGRYRLATGPLL
                     RLEAGGGPPYLVAAGAELGRVLLYAPLAREDLLEGAEVAAWAGWEEGKFRGYLERRYG
                     ALVLERVAIDPGPPGEAHLREALSQGLPLPEETRQVLLRLGFLRAHGVAVPELTEASL
                     LQDLSWLLPWAQGVRRLEDLEALPWKEILLALLGEARKTLEELAPESLPLGGKRKRLL
                     YREGAPPLLSLRIQEAFGLKETPRVLGGRVPVAVALLSPAGRPVQITQDLKGFWETHY
                     PGVRRELMRRYPKHPWPENP"
     gene            complement(449973..451880)
                     /gene="gyrB"
                     /locus_tag="TCCBUS3UF1_RS02070"
                     /old_locus_tag="TCCBUS3UF1_4320"
     CDS             complement(449973..451880)
                     /gene="gyrB"
                     /locus_tag="TCCBUS3UF1_RS02070"
                     /old_locus_tag="TCCBUS3UF1_4320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514843.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_041433682.1"
                     /db_xref="GI:752794250"
                     /translation="MNYDASAIKVLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNA
                     VDEALAGHATEIITTLNPDGSLTVEDNGRGIPVDVMPEEGKPAVEVIYTTLHSGGKFE
                     SGAYKVSGGLHGVGASVVNALSEWTVVEVFRQGQHYRIAFSRGEVTEPLRVVGPAPEG
                     KTGTRVTFKPDPQIFGPLAFDPSKLRARLKEVSYLVAGLRLVFRDLQHGREEVYLDKG
                     GVASFAKALAEGEELLYEKPFLIRKQEGEVEVEVGLIHTKGYTAEILTYANMIPTRDG
                     GTHLTAFKGAYSRALNQYAKKAGLHKEKGPQPTGDDLLEGLYAVVSVKLPQPQFEGQT
                     KGKLLNPEAGSAVSQVVYEKLLEILEENPRIAKTLYEKALRAAQAREAARKARELVRR
                     QNPLESDDLPGKLADCQTENPEEAELFIVEGDSAGGSAKQGRDRRFQAVLPLRGKILN
                     VEKAGLSKALKNAEVRAMVAAIGAGIGGTGDEAHFDLEGLRYHKIIIMTDADVDGSHI
                     RTLLLTFFYRYMRPLIEGGYVYIAQPPLYRLQVGKRVEYLYSDEALAARLKELEGKAY
                     EVQRFKGLGEMNPEQLWETTMNPEKRVLKRVELQDALEASELFEKLMGQEVAPRREFI
                     EEHARYAQLDI"
     gene            452024..452410
                     /locus_tag="TCCBUS3UF1_RS02075"
                     /old_locus_tag="TCCBUS3UF1_4340"
     CDS             452024..452410
                     /locus_tag="TCCBUS3UF1_RS02075"
                     /old_locus_tag="TCCBUS3UF1_4340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514845.1"
                     /db_xref="GI:504327743"
                     /translation="MPVLVYLHALLGVFLLLAVPALALVGLWGFLRPLPPRFYAGLRG
                     VAWVAILQVVLGFLLFFLGLRPKEGLHLLYGLLLAAGLHYLGGLEPGGWFHRGLKDPP
                     KRPELFVALGLLFALGLVLRVYFTGR"
     gene            complement(452397..453599)
                     /locus_tag="TCCBUS3UF1_RS02080"
                     /old_locus_tag="TCCBUS3UF1_4350"
     CDS             complement(452397..453599)
                     /locus_tag="TCCBUS3UF1_RS02080"
                     /old_locus_tag="TCCBUS3UF1_4350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014514846.1"
                     /db_xref="GI:504327744"
                     /translation="MTPLPRTSLGQVPTPAALVAFMVGLAEAPLGGRVLEPACAHGPF
                     LRAFREVHGAGYRFYGVEVDRKALDLPPWAHGVVTDFLLWEPQEAFDLILGNPPYGAL
                     GAGARIPPGLRRLYRGRFRTWRGRYNLYGAFLEKGVELLRPGGLLVYVVPAGWMVLEE
                     FRELRAFLAREGALEVYYLGRVFPGLKVRATVLAFRKGGKGLRLWEAEGLALGASPAP
                     LLEDPHWQGAMIRFPHPEGLALEREGVPLGEAFHLHFAARSPEIKAHPLTRPAPGPGL
                     VPVLTGRNLGPGTVDYATPYSGLYFPKGAVHLLKPFYALPHLVVGHTRHYRVVAAWDE
                     RAYPWREEFHLLPKEGVRVDPEGLVAYLNGPLVQAYYRGLYREVVPHLTRPMLERLPL
                     PRDLLTAR"
     gene            complement(453601..454788)
                     /locus_tag="TCCBUS3UF1_RS02085"
                     /old_locus_tag="TCCBUS3UF1_4360"
     CDS             complement(453601..454788)
                     /locus_tag="TCCBUS3UF1_RS02085"
                     /old_locus_tag="TCCBUS3UF1_4360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="WP_014514847.1"
                     /db_xref="GI:504327745"
                     /translation="MSLSLRERVQEELERLKREGLYIRPRVLEAPQEPVTRVDGREVV
                     NLASNNYLGFANHPYLKEKARAYLERWGAGSGAVRTIAGTFTYHLELEEALARFKGTE
                     SALVLQSGFTANQGVLGSLLKEGDLVFSDELNHASIIDGLRLTKATRLVYRHADVDHL
                     EELLKAHDTDGLKLIVTDGVFSMDGDIAPLDRIVPLAKKYGAVVYVDDAHGSGVLGEK
                     GKGTVHHFGFHGDPDVIQVATLSKAWAVVGGYAAGALELKDLLINKARPFLFSTSHPP
                     AVVGALLGALELIEREPERVERLWENTRYFKAELARLGYDTLGSQTPITPVLFGEAPV
                     AFEASRMLLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTQEMLDRALEAYAKVGRRLG
                     LIP"
     gene            454941..456485
                     /locus_tag="TCCBUS3UF1_RS02090"
                     /old_locus_tag="TCCBUS3UF1_4370"
     CDS             454941..456485
                     /locus_tag="TCCBUS3UF1_RS02090"
                     /old_locus_tag="TCCBUS3UF1_4370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S8"
                     /protein_id="WP_014514848.1"
                     /db_xref="GI:504327746"
                     /translation="MVHTYRAWLLGGVLLLLAACQVGPTGQGPARGPEATLAPVYNAE
                     SPDAVPGQYIVVFKKGAAEATLAALQADREGLAPLGLTPQEVRIQAVYTEALEGFAAQ
                     LSVRALDTLRKDPRVEFIEADTYVRLQATQTNPPWGLDRIDQRGLPLDARYTYTLTGA
                     GVNVYVIDTGIRTTHADFGGRAFVAYDALGGNGQDCNGHGTHVAGTVGGTTYGVAKGV
                     RLYAVRVLDCNGSGTNSGVIAGVNWVLQNHVKPAVANMSLGGVASTALDTAVKNAIAA
                     GVTFAVAAGNENQDACLSSPARVPEALTVGATTNTDARASFSNYGSCLDIFAPGQNIL
                     SAWHTSDAATNTISGTSMATPHVAGVAALYLQQNPTTTPSQVAAAILNGATPGVVSGG
                     GTGSPNRLLYSLVSGGGSDEPCTGCEKYTGTLSQGASAYQPNGSYYYSSISGTHEGYL
                     QGPSGTDFDLYLQKWNGAAWTTVASATTASSTESIRYSGTAGYYRWRIYAYSGSGAYT
                     FWMKRP"
     gene            456617..457528
                     /locus_tag="TCCBUS3UF1_RS02095"
                     /old_locus_tag="TCCBUS3UF1_4380"
     CDS             456617..457528
                     /locus_tag="TCCBUS3UF1_RS02095"
                     /old_locus_tag="TCCBUS3UF1_4380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014514849.1"
                     /db_xref="GI:504327747"
                     /translation="MRGHLQAETEAERLERRVKLLELLHRLRGEPDELLPFHQALALR
                     PKGEHHLGLRTIEVDKVVGSVDRYEDFDRHFLPKTLHTLERWKRLRALQLEGVELPPI
                     EVYQVGEAYFVKDGHHRVALAKATGQKYMDAYVIALDVPVPVEPGDTLKDLILKAEYA
                     HFLEQTRLKELVPDAEEIRFTALGRYDLLLDHIATRRYFKGLEEGREVSWEEAVVDWY
                     QNLYRPTVEAIRRLGLLRDFPGRTEADLYLWVMDHRYFLAQELGVDLGPEGAARSYEA
                     RFGPRWKRLGGWLKWLFKHSIQIPFDF"
     gene            458504..459163
                     /locus_tag="TCCBUS3UF1_RS02100"
                     /old_locus_tag="TCCBUS3UF1_4390"
     CDS             458504..459163
                     /locus_tag="TCCBUS3UF1_RS02100"
                     /old_locus_tag="TCCBUS3UF1_4390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014514850.1"
                     /db_xref="GI:504327748"
                     /translation="MQALGFRRPNQVREAVYGHLKALLLSGRFAPGERLSEPLLAQEL
                     GVSRTPVREALMRLAEEGLVELVPGKGARVRVFTLEEVEEVYGVRALLEGEAAREAAL
                     RATPWELAELEARLRAIDEAPAEDYPEQMRRDLEFHRGLVRLSGNKTLARLYEDLLSS
                     LALVRSALPTLSQDEATREEHRAILEALRRRDPEGAKRAVEAHVARFRDLVVEALRRR
                     V"
     gene            459160..460083
                     /locus_tag="TCCBUS3UF1_RS02105"
                     /old_locus_tag="TCCBUS3UF1_4400"
     CDS             459160..460083
                     /locus_tag="TCCBUS3UF1_RS02105"
                     /old_locus_tag="TCCBUS3UF1_4400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline dehydrogenase"
                     /protein_id="WP_014514851.1"
                     /db_xref="GI:504327749"
                     /translation="MNLDLLYRQAVLSVAGNPRVEGLIKTRARSLVRRYVAGESLEEA
                     LRAAEGLERQGVHAILDLLGEMVRSEAEARAFQAGILELVRRVAERPWPKYVSLKPTQ
                     LGLDLSEGLALELLREILREAEPRGVFVRMDMEDSPRVEATLRLYRALREEGFSGVGI
                     VLQSYLFRTEKDLLDLLPYRPNLRLVKGAYREPKEVAFQDKRLIDAQFLHLGKLALRE
                     GLYVAFATHDPRLIAEVKRYAEAMGFPKTAFEFQLLYGVRPEEQRRLAQEGYTVRAYV
                     PYGRDWYPYLSRRIAERPENLFLVLRSLLGG"
     gene            460094..461644
                     /locus_tag="TCCBUS3UF1_RS02110"
                     /old_locus_tag="TCCBUS3UF1_4410"
     CDS             460094..461644
                     /locus_tag="TCCBUS3UF1_RS02110"
                     /old_locus_tag="TCCBUS3UF1_4410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514852.1"
                     /note="catalyzes the conversion of 1-proline-5-carboxylate
                     dehydrogenase to L-glutamate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_014514852.1"
                     /db_xref="GI:504327750"
                     /translation="MTVEPFRNQPIETFASEEARREMKEALRRVRAEFGRHWGLYVDG
                     AWVDTGETILSLNPSAPSEVVGSTAKAGKAEADAALEAAWRAFRTWKDWPQEDRSRLL
                     LKAAAIMRRRRRELEATLVYEIGKNWVEASAEVAEAIDFLEYYARQALRYKYPSVEVV
                     PYPGEDNESFYIPLGAGVVIAPWNFPLAIFTGMIAGPVAVGNTVVAKPAEDTVVIAAK
                     AFEIFHEAGFPPGVVNLLPGEGRDVGAYLVEHPRTRFINFTGSLEVGLWIHQAAARLA
                     PGQRWIKRVFLELGGKDAILVDETADLEAATEGILVSAYGFQGQKCSAASRLIVTEGA
                     FEPLMERLLPRAQRLVVGPAEENPDLGPVASKAQEEKILSYIEIGKGEGQLVLGGVRL
                     EGEGYFIAPTVFTGVPPTAKIAQEEIFGPVLSVIRVGDFAEALEVANSTVYGLTGGVY
                     SRKREHLEWARREFHVGNLYFNRKITGALVGVQPFGGFNLSGTNTKAGGPDYLLHFLE
                     MKSVAERF"
     gene            461784..463172
                     /locus_tag="TCCBUS3UF1_RS02115"
                     /old_locus_tag="TCCBUS3UF1_4420"
     CDS             461784..463172
                     /locus_tag="TCCBUS3UF1_RS02115"
                     /old_locus_tag="TCCBUS3UF1_4420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit I"
                     /protein_id="WP_014514853.1"
                     /db_xref="GI:504327751"
                     /translation="MEPIRPFRKTLLADLETPVTAYLKLSEKAPVSFLLESVERGRQS
                     RFSIVGVGSRRTFRLKDGVFTVNGKPVPTQDPLRTLYEAVHAPLERHPDLPPFFGGVV
                     GYAAYDLIRHYERLPSLKPDDLGLPDLLFVEPEVVLVFDHLKSLLHLVAPGRDPEEAE
                     ARLRWAEGRLKGPLPGVPGERAGGRARFRADLAREAYLEAVERALAYIRAGDIFQVVL
                     SLRLSSPLTVHPFALYRALRSVNPSPYMGYLDLGEVVLVSASPESLLRSDGRKVVTRP
                     IAGTRPRGKDEEEDQRLAEELLRDEKERAEHVMLLDLSRNDLGRVAAFGSVRVVEPMH
                     VEMYSHVMHLVSTVEGVLAEGKTPLDALASVLPMGTVSGAPKIRAMEIIEELEPHRRG
                     PYGGSFGYLAYDGAMDVALTLRTFVIAQGQMHVQAGAGIVADSVPEREYEECGNKARA
                     LLRAVEMAEEGL"
     gene            463174..463755
                     /locus_tag="TCCBUS3UF1_RS02120"
                     /old_locus_tag="TCCBUS3UF1_4430"
     CDS             463174..463755
                     /locus_tag="TCCBUS3UF1_RS02120"
                     /old_locus_tag="TCCBUS3UF1_4430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit II"
                     /protein_id="WP_014514854.1"
                     /db_xref="GI:504327752"
                     /translation="MRVLVIDNYDSFTYNLVQYLGELGANPIVWRNDQFALEEVEALD
                     PDRILISPGPCTPLEAGLSLPLIARYAPRYPILGVCLGHQAIGMAFGGKVVPAPLLMH
                     GKVSAIHHDGTGVFRGLPNPFPATRYHSLVVEAVPEALEVNAWVEEAGGRTVMGFRHR
                     DLPTHGVQFHPESYLTEAGKRLLKNFLEDPWTR"
     gene            463743..464732
                     /locus_tag="TCCBUS3UF1_RS02125"
                     /old_locus_tag="TCCBUS3UF1_4440"
     CDS             463743..464732
                     /locus_tag="TCCBUS3UF1_RS02125"
                     /old_locus_tag="TCCBUS3UF1_4440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003049599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_014514855.1"
                     /db_xref="GI:504327753"
                     /translation="MDAVRKALLGQVLSEEEAYGLMGAMMRGEVSPVQTAGVLTAMAL
                     RGETPGEIAAMARAMREAARPLRVGRRPLLDLVGTGGDHQGLLNLSTLGALVAAAGGV
                     AVAKHGNRAASSKAGSADLLEALGVDLEAPPERVGEAIEALGFGFLFARVFHPAMRHV
                     APVRAELGIRTVFNLLGPLTNPAGADRYVLGVYSPRWLSPMADALERLGARGLVVHGQ
                     GADELVLGETQVVEVGKGAYTLTPEAVGLSQHPLAALRGGSPAENAQLARRLLKGEER
                     GPLAEAVALAAGAGLYAAGKAESLEKGVRLAQEVLASGEAYLLLERYVAFLKG"
     gene            complement(464740..465966)
                     /locus_tag="TCCBUS3UF1_RS02130"
                     /old_locus_tag="TCCBUS3UF1_4450"
     CDS             complement(464740..465966)
                     /locus_tag="TCCBUS3UF1_RS02130"
                     /old_locus_tag="TCCBUS3UF1_4450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="WP_014514856.1"
                     /db_xref="GI:504327754"
                     /translation="MPGIAIIGAQWGDEGKGKVVDALAKEADYVIRYQGGANAGHTVV
                     AEGRVFKLNLLPSGVIHPHAVNVLGDGMVIDPFRLQEELLALEREGFRPKVLVSERAH
                     LVLPHHKHVESRHNFVGTTGRGIGPAYSDRARRVGIRAGDLLDEGVLQERVRRLLLEK
                     PNSTREAGWDTETKALEDLRRMREILAPYVADTGSLLREAVRKGKRLLFEGAQATLLD
                     LNYGTYPYVTSSHPTVGGILVGTGLSHKALTKVYGVAKAYATRVGEGPFPTEIHGDLA
                     HHLREKGGEYGTTTGRPRRVGWLDLVALKYACEVNGFDGLALTKLDVLSGLPRVKVAV
                     EYLDGARPGEARPEAVRYLELPGWGELSGIRGREDLPKSLLRYLELIEEHTGIPVVLF
                     STSPRREDTFGAVSWV"
     gene            complement(465978..466865)
                     /locus_tag="TCCBUS3UF1_RS02135"
                     /old_locus_tag="TCCBUS3UF1_4460"
     CDS             complement(465978..466865)
                     /locus_tag="TCCBUS3UF1_RS02135"
                     /old_locus_tag="TCCBUS3UF1_4460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Aldo/keto reductase"
                     /protein_id="WP_014514857.1"
                     /db_xref="GI:504327755"
                     /translation="MNPLFSHFMGVGTWAWGDRLFWGYGRDYGEGDLREAFRESLLAG
                     VGLWDTAEFYGFGLSERLLGQFMREAGVRPYLVTKFFPYPWRLSRKDLLRALRGSLGR
                     LGVEAVDLYLLHWPWPPVPLRVWAEALAEAHERGLARGVGVANASMAQLETVKGVLDR
                     HRVPLLANQVEYSLLQRGWEAHLPALRREGIALMAYSPLAMGWLTGKLDPDRPPKGYR
                     GAKYRPLLAGVRRLLPLLRELAEAKGVSPSAIALRYLVEKGALPIPGAKNALQARQNA
                     EALRIALSPEEVARLEGAS"
     gene            complement(466862..467530)
                     /locus_tag="TCCBUS3UF1_RS02140"
                     /old_locus_tag="TCCBUS3UF1_4470"
     CDS             complement(466862..467530)
                     /locus_tag="TCCBUS3UF1_RS02140"
                     /old_locus_tag="TCCBUS3UF1_4470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014628936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014514858.1"
                     /db_xref="GI:504327756"
                     /translation="MRYLDLITALFATVLLVSNVASTKLVVLGPFTFDGGTLLFPLAY
                     IFGDVLTEVYGYRKSRRVIWTGFLALLLATLTFQAVAALPAPPDGESQRYGQAFTLLL
                     GLTPRIVLGSLLAYFAGEFANAYVLARLKVRTAGRLFWLRALASTLVGQGLDTALFLL
                     VAFYGVLPPEVLLAVFLSNYAFKLGVEALMLPLTYLVVGFLKRAEGLDVYDRDTDFNP
                     FRLA"
     gene            complement(467527..468063)
                     /locus_tag="TCCBUS3UF1_RS02145"
                     /old_locus_tag="TCCBUS3UF1_4480"
     CDS             complement(467527..468063)
                     /locus_tag="TCCBUS3UF1_RS02145"
                     /old_locus_tag="TCCBUS3UF1_4480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_041433684.1"
                     /db_xref="GI:752794252"
                     /translation="MFTAGNGPVQISAEAIGKRVAELGQEIARDYQGKTPHLICVLNG
                     AFIFMADLVRAIPLPLTLDFISISSYGNAYRTSGEVELIKDLRLPIHGRDVIVVEDIV
                     DSGLTLAYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIQDAYVYGYGLDR
                     AQFDRNLPFITSIRPEEE"
     gene            complement(468069..468767)
                     /locus_tag="TCCBUS3UF1_RS02150"
                     /old_locus_tag="TCCBUS3UF1_4490"
     CDS             complement(468069..468767)
                     /locus_tag="TCCBUS3UF1_RS02150"
                     /old_locus_tag="TCCBUS3UF1_4490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_041433947.1"
                     /db_xref="GI:752794516"
                     /translation="MRLQAYLARAGVASRRKAEALIRQGRVRVNGAVAVLGQKVGPED
                     LVEVDGKRVPPPGERVVLALHKPRGYTTTRADPHARRTVYELLPPIPGLQAAGRLDRD
                     SEGLLLFTNDGHLALRLTHPRYGVRKVYRVWTEGGTLPPGVCRKLLEGVELEDGPARA
                     LACRPAPGGGFLTLAEGRKREVRRMLQAVGYPVKRLLRVQVGPIRLGDLPPGKWRRLS
                     EAEVAALLGESPVE"
     gene            complement(468767..469555)
                     /locus_tag="TCCBUS3UF1_RS02155"
                     /old_locus_tag="TCCBUS3UF1_4500"
     CDS             complement(468767..469555)
                     /locus_tag="TCCBUS3UF1_RS02155"
                     /old_locus_tag="TCCBUS3UF1_4500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514861.1"
                     /note="Catalyzes the reversible hydration of unsaturated
                     fatty acyl-CoA to beta-hydroxyacyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_014514861.1"
                     /db_xref="GI:504327759"
                     /translation="MDLEARYPSLRFAWPRPGVLEVGFRGEKLNALGPQAHRELAQVW
                     RDLESLGEVRAVLLRGEGGVFSAGGSFALIEEIQASHQARMRVFWEARELVLGPLNFP
                     RPVVAAVEGVAVGAGLALALAADVAVVGKGARLLDGHLRLGVAAGDHAVLLWPLLVGM
                     AKAKYHLLLGKPLTGEEAERLGLVALAVEDGEVYGKALEVAERLARGPKEALHHTKHA
                     LNGWLRAFLPQFEVSLALEFLGFTGEEVQAGLRALKEKREPEFP"
     gene            469601..470539
                     /locus_tag="TCCBUS3UF1_RS02160"
                     /old_locus_tag="TCCBUS3UF1_4510"
     CDS             469601..470539
                     /locus_tag="TCCBUS3UF1_RS02160"
                     /old_locus_tag="TCCBUS3UF1_4510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514862.1"
                     /note="catalyzes isomerization of specific uridines in RNA
                     to pseudouridine; responsible for residues in T loops of
                     many tRNAs; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_014514862.1"
                     /db_xref="GI:504327760"
                     /translation="MALYAVDKPLHLTSHDAVEEARRRLGTRRVGHTGTLDPLATGLL
                     LLVSEESTKLVPFLSGEEKEYLAWVSFGATTPTLDAEGPVSEEAPVRFDRRDLESVLP
                     SFLGLKEQVPPLYSAIKVGGKRAYEAAREGRPLELGPRPVRYVEVELLALDPEPIPHP
                     IAPSARGWRLAEKGGRRVELPRPLGAYPTAVIRLVVGPGTYVRAFARDLGEKLKTKAF
                     LSGLVRTRIGKVGLERSVRLAELSPEKAIPEPDVLPFPVVELSHTEARRVLEGIPLPI
                     PALGYVTLVDSRRRLLAIAEGDGFKLKIRRVFVKEA"
     gene            470542..471651
                     /locus_tag="TCCBUS3UF1_RS02165"
                     /old_locus_tag="TCCBUS3UF1_4520"
     CDS             470542..471651
                     /locus_tag="TCCBUS3UF1_RS02165"
                     /old_locus_tag="TCCBUS3UF1_4520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003049625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine dehydrogenase"
                     /protein_id="WP_014514863.1"
                     /db_xref="GI:504327761"
                     /translation="MVIGVPKEIKTLENRVALTPGGVESLVKRGHTVLVERGAGVGSG
                     LSDAEYERAGAELVSREEAWGAGMVVKVKEPLPEEYSFLREGLILFTYLHLAADRTLT
                     EAMLRSGVTGVAYETVQLPDGSLPLLVPMSEVAGRMAPQVGAQFLEKPHGGRGVLLGG
                     VPGVAPASVVILGGGTVGTNAAKIALGMGAQVTILDVNHRRLQYLDDVFGGRVVTLTA
                     TEANIKKSIQHADLLIGAVLVPGAKAPKLVTREMLPLMKEGSVIVDVAVDQGGCVETI
                     RPTTHAEPTYVVDGVVHYGVANMPGAVPRTSTFALTNQTLPYVLRLAERGLEALREDE
                     ALLKGLNTHKGFLTHPGVAEAFGLPYTPPEEALRR"
     gene            471653..471994
                     /locus_tag="TCCBUS3UF1_RS02170"
                     /old_locus_tag="TCCBUS3UF1_4530"
     CDS             471653..471994
                     /locus_tag="TCCBUS3UF1_RS02170"
                     /old_locus_tag="TCCBUS3UF1_4530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline-shock protein"
                     /protein_id="WP_014514864.1"
                     /db_xref="GI:504327762"
                     /translation="MQGRVTITESALASLLGLAAHEVPGVVGMAPAGLKDQVVRILGR
                     QEASEGVVVRQDPMNPGRYTADFYVVVAVGTRIPTVVESLAERVAFAAKKLAGVEFSQ
                     VRVHVVGVGRG"
     gene            471987..473552
                     /locus_tag="TCCBUS3UF1_RS02175"
                     /old_locus_tag="TCCBUS3UF1_4540"
     CDS             471987..473552
                     /locus_tag="TCCBUS3UF1_RS02175"
                     /old_locus_tag="TCCBUS3UF1_4540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="kinase"
                     /protein_id="WP_014514865.1"
                     /db_xref="GI:504327763"
                     /translation="MGSWTPVELAEAFRYATDWFRVYVEELNALNVYPVPDGDTGTNM
                     HLTLQSARRELDLADTRKMPEVARAIAYGSLLGARGNSGVILSQILKGFTEAIRKREA
                     LDAKALAEALRQGAETGYRAVMKPVEGTILTVARAAAEGAHGNTLEEVLESALIAAQA
                     ALARTPELLPVLKQAGVVDAGGAGYVRFLEGIRGYALKLPLPEPPKVERYAQTAFATE
                     EFGYCTEFLMEGVEVPIERIREAVAPFGDSLLVVGAEGYVKGHIHTDDPDGLLSTVAR
                     FGRMVRTKVEDMTEQHTEILAMAGLLEEAPPPTGLVAVALGHGLSKAFRSLGARVVAG
                     GQTQNPSVEDLLSAVRSLPNPKVILLPNNPNVFLAAEEAARLAKEAGKEVYVLKTRTL
                     GQGLAAAVRYLPEAEPETLLPEMEEAAQGARTLEVTWASRDAEVEGLKVLKDKPIGLL
                     DGKLVLVGESPEEVLEGLIRLAQEGKEVLTLFLGPNTPREKAEAVAQNFPHLVVEILP
                     GGPDLYAYLGVLE"
     gene            473617..474453
                     /locus_tag="TCCBUS3UF1_RS02180"
                     /old_locus_tag="TCCBUS3UF1_4550"
     CDS             473617..474453
                     /locus_tag="TCCBUS3UF1_RS02180"
                     /old_locus_tag="TCCBUS3UF1_4550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008630579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514866.1"
                     /db_xref="GI:504327764"
                     /translation="MWRILLGVLVLVLGACGLEGPPPASGELGVGGSVVASLPAARVG
                     PGDRPVPSVAVYRILLQQGGAVQVSAVSAGLQLRANLRLVLLDSRGVVQAVSVARDRF
                     GLPSQAYAFPLGLSPQVFPDVGVRLNFRGGANQVFYLRVENFATEPDTVNVQAASFLP
                     DPNGEPGGPLQTLPSGITRGAIEFVGEADFYRLQSGSGPYLCFDPGILDLVAKISAGT
                     TPANPVRLDRVVRGVNLNDLDFTPTLLVVQERTQSMAGFNDMEARWSGRYTLTLSPIP
                     CP"
     gene            474650..475072
                     /locus_tag="TCCBUS3UF1_RS02185"
                     /old_locus_tag="TCCBUS3UF1_4560"
     CDS             474650..475072
                     /locus_tag="TCCBUS3UF1_RS02185"
                     /old_locus_tag="TCCBUS3UF1_4560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514867.1"
                     /db_xref="GI:504327765"
                     /translation="MRGLFFALFLALAVAGAWAQEKTVLRLQATAYTSSVRETDRTPF
                     VTATGMRTRLGVLAVSPDLLKVLPYGTKVRLRDLGSVQGRGRGQFAYLFQDRVFVVAD
                     VMHSRMRRKVDVWLPDRATALRFGLRWVELEVVAYPKR"
     gene            475090..476205
                     /locus_tag="TCCBUS3UF1_RS02190"
                     /old_locus_tag="TCCBUS3UF1_4570"
     CDS             475090..476205
                     /locus_tag="TCCBUS3UF1_RS02190"
                     /old_locus_tag="TCCBUS3UF1_4570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014514868.1"
                     /db_xref="GI:504327766"
                     /translation="MRFALFLALAHLRRRPLQTALALLGVGVGVAVLLAALSLTNGFV
                     SGLVRATLKAYPHLVLFSLGQDLPPLPPHPEVEGAAPFAATKALLIRPAEGARGPGVD
                     FATLVGLGEGGEALYPELGLRLEPGGIYLGSALVQSLGVVVGERIYAMSATQERLTLR
                     VLGSFRTGNYLLDSGYAFVDLKTLERLSGLRAQGYQVRLKDPWRAREVGFELAGTRFF
                     PQAWQDTQRTLLEQLALQKQVLGILIFLIVAVAALGVANLLVLKVVEKTPEIALLRSM
                     GASRLTVGLVFALEGVFLGVGGVGLGNLLGYALGLYLSLRPVPLPGELYFLTHLPVEM
                     RLADFLAVSGASLVATLLSALLPLWRALQVQPGVVLR"
     gene            476246..476320
                     /locus_tag="TCCBUS3UF1_RS02195"
                     /old_locus_tag="TCCBUS3UF1_t60"
     tRNA            476246..476320
                     /locus_tag="TCCBUS3UF1_RS02195"
                     /old_locus_tag="TCCBUS3UF1_t60"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:476278..476280,aa:Thr,seq:cgt)
     gene            476516..476929
                     /locus_tag="TCCBUS3UF1_RS02200"
     CDS             476516..476929
                     /locus_tag="TCCBUS3UF1_RS02200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_018110828.1"
                     /db_xref="GI:516808048"
                     /translation="MVALPTINQLVRRGREKVQKKSKVPALKGSPFRRGVCTVVRTVT
                     PKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVR
                     GVYDTQGVKDRKKSRSKYGTKRPKETKGAAPAKKK"
     gene            476937..477407
                     /locus_tag="TCCBUS3UF1_RS02205"
                     /old_locus_tag="TCCBUS3UF1_4590"
     CDS             476937..477407
                     /locus_tag="TCCBUS3UF1_RS02205"
                     /old_locus_tag="TCCBUS3UF1_4590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_014514870.1"
                     /db_xref="GI:504327768"
                     /translation="MARRRRAEVRQLQPDLVYGDVVVSAFINKIMRDGKKNLAARIFY
                     DACRIIQEKTGQEPLKVFKQAVENVKPRLEVRSRRVGGANYQVPMEVSPRRQQSLALR
                     WLVQAANARSERGAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW"
     gene            477411..479486
                     /gene="fusA"
                     /locus_tag="TCCBUS3UF1_RS02210"
                     /old_locus_tag="TCCBUS3UF1_4600"
     CDS             477411..479486
                     /gene="fusA"
                     /locus_tag="TCCBUS3UF1_RS02210"
                     /old_locus_tag="TCCBUS3UF1_4600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019551714.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_014514871.1"
                     /db_xref="GI:504327769"
                     /translation="MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGKIHKIGE
                     VHEGAATMDFMEQERERGITITAAVTTCFWRDHRINIIDTPGHVDFTIEVERSMRVLD
                     GAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGAR
                     PVVMQLPIGREDTFSGIIDVLRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLIE
                     AAADFDENIMLKYLEGEEPSEEELVAAIRKGTIDIKITPVFLGSALKNKGVQLLLDAV
                     VDYLPSPLDIPPIRGTTPEGETVEIYPDPEGPLSALAFKIMADPYVGRLTFIRVYSGT
                     ITSGSYVYNTTKGRKERVARLLRMHANHREEVEELKAGDLGAVVGLKETITGDTLVGE
                     DAPRVILESIEVPEPVIDVAIEPKTKADQDKLSQALARLAEEDPTFRVSTHPETGQTI
                     ISGMGELHLEIIVDRLKREFKVDANVGKPQVAYRETITRPVDVEGKFIRQTGGRGQYG
                     HVKIKAEPLPRGSGFEFVNAIVGGVIPKEYIPAVQKGIEEAMQSGPLIGFPVVDVKVT
                     LYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPVILEPIMRVEVTTPEEYMGDVIGDL
                     NSRRGQILGMEPRGNAQVIRAYVPLAEMFGYATDLRSKTQGRGSFVMFFDHYQEVPKQ
                     VQEKLIKGQ"
     gene            479545..480765
                     /gene="tuf"
                     /locus_tag="TCCBUS3UF1_RS02215"
                     /old_locus_tag="TCCBUS3UF1_4610"
     CDS             479545..480765
                     /gene="tuf"
                     /locus_tag="TCCBUS3UF1_RS02215"
                     /old_locus_tag="TCCBUS3UF1_4610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550494.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_014514872.1"
                     /db_xref="GI:504327770"
                     /translation="MAKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTFVAAAENPNVE
                     VKDYGEIDKAPEERARGITINTAHVEYETAARHYSHVDCPGHADYIKNMITGAAQMDG
                     AILVVSAADGPMPQTREHILLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLN
                     QYEFPGDEVPVIRGSALLALEQMHKNPQTKRGENEWVDRIWELLDAIDRYIPTPQRDV
                     DKPFLMPVEDVFTITGRGTVATGRIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRK
                     TLQEGIAGDNVGLLLRGVGRDEVERGQVLAKPGSITPHTKFEASVYILKKEEGGRHTG
                     FFTGYRPQFYFRTTDVTGVVELPQGVEMVMPGDNVTFVVELIKPVALEEGLRFAIREG
                     GRTVGAGVVTKILE"
     gene            480774..481091
                     /locus_tag="TCCBUS3UF1_RS02220"
                     /old_locus_tag="TCCBUS3UF1_4620"
     CDS             480774..481091
                     /locus_tag="TCCBUS3UF1_RS02220"
                     /old_locus_tag="TCCBUS3UF1_4620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_014514873.1"
                     /db_xref="GI:504327771"
                     /translation="MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPVPLPTRV
                     RRFTVIRGPFKHKDSREHFELRTHNRLVDILNPNRKTIESLMSLDLPTGVEIEIKTVG
                     GGK"
     gene            481088..481708
                     /locus_tag="TCCBUS3UF1_RS02225"
                     /old_locus_tag="TCCBUS3UF1_4630"
     CDS             481088..481708
                     /locus_tag="TCCBUS3UF1_RS02225"
                     /old_locus_tag="TCCBUS3UF1_4630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_014514874.1"
                     /db_xref="GI:504327772"
                     /translation="MKGILGTKVGMTRIYKEDRAIPVTVILAGPCPVVQRRTPEKDGY
                     VAVQLGFQPQNPKRVNRPLKGHFARAGVEPVRILKEIRDFNPEGDVVTVEIFQPGERV
                     DVTGTSKGRGTAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKRMAGRY
                     GAERVTVMNLEVVDVIPEENLLLVKGAVPGPSGGLVVVRETKKVAK"
     gene            481717..482337
                     /locus_tag="TCCBUS3UF1_RS02230"
                     /old_locus_tag="TCCBUS3UF1_4640"
     CDS             481717..482337
                     /locus_tag="TCCBUS3UF1_RS02230"
                     /old_locus_tag="TCCBUS3UF1_4640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_041433948.1"
                     /db_xref="GI:752794517"
                     /translation="MVYQIPVLSPTGKRELAADLPQEVNPHLLWEVVRWQLASRRRGT
                     ASTKTRGEVAYSSRKIYPQKHTGRARHGDIGAPIFVGGGTVFGPKPRDYAYTLPKKVR
                     RAGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKAAGLDGSETVLLVAESEAVR
                     RAARNLPWVVTLAPEGLNVYDILRTERLVMDLKAWEAFQARVGGEA"
     gene            482334..482624
                     /locus_tag="TCCBUS3UF1_RS02235"
                     /old_locus_tag="TCCBUS3UF1_4650"
     CDS             482334..482624
                     /locus_tag="TCCBUS3UF1_RS02235"
                     /old_locus_tag="TCCBUS3UF1_4650"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RA57.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_014514876.1"
                     /db_xref="GI:504327774"
                     /translation="MKTAFDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVE
                     AAFKVKVVGVNTLNVRGKKKRLGRYLGKRPDRKKAIVQVAAGQKIEALEGLI"
     gene            482676..483506
                     /gene="rplB"
                     /locus_tag="TCCBUS3UF1_RS02240"
                     /old_locus_tag="TCCBUS3UF1_4660"
     CDS             482676..483506
                     /gene="rplB"
                     /locus_tag="TCCBUS3UF1_RS02240"
                     /old_locus_tag="TCCBUS3UF1_4660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018460490.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_014514877.1"
                     /db_xref="GI:504327775"
                     /translation="MAVKKFKPYTPSRRFMTVADFSEITKTEPEKSLVKPLKKTGGRN
                     NQGRITVRFRGGGHKRLYRIVDFKRWDKAGIPAKVAAIEYDPNRSARIALLHYADGEK
                     RYILAPEGLAVGQQVVAGPDAPIQVGNALPLRFIPVGTVVHAVELEPKKGAKLARSAG
                     TSTQIQGREGDYVILRLPSGELRKVHGECYATVGSVGNADHKNVVLGKAGRTRWLGRK
                     PHVRGAAMNPVDHPHGGGEGRAPRGRPPASPWGWQTKGLKTRKRRKPSSRFILARRKK
                     "
     gene            483515..483796
                     /locus_tag="TCCBUS3UF1_RS02245"
                     /old_locus_tag="TCCBUS3UF1_4670"
     CDS             483515..483796
                     /locus_tag="TCCBUS3UF1_RS02245"
                     /old_locus_tag="TCCBUS3UF1_4670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013704504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_011173711.1"
                     /db_xref="GI:499487071"
                     /translation="MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEM
                     VGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK"
     gene            483799..484140
                     /locus_tag="TCCBUS3UF1_RS02250"
                     /old_locus_tag="TCCBUS3UF1_4680"
     CDS             483799..484140
                     /locus_tag="TCCBUS3UF1_RS02250"
                     /old_locus_tag="TCCBUS3UF1_4680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_014514878.1"
                     /db_xref="GI:504327776"
                     /translation="MEAKAIARYVRIAPRKVRLVVDLIRGKSLEEARAILRYTHKRGA
                     YHVAKVLESAAANAVNNHDMLEDRLFVKAAFVDEGPALKRVLPRARGRADIIKKKTSH
                     ITVILGEKHGK"
     gene            484130..484849
                     /locus_tag="TCCBUS3UF1_RS02255"
                     /old_locus_tag="TCCBUS3UF1_4690"
     CDS             484130..484849
                     /locus_tag="TCCBUS3UF1_RS02255"
                     /old_locus_tag="TCCBUS3UF1_4690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_014514879.1"
                     /db_xref="GI:504327777"
                     /translation="MGNKIHPIGFRLGITRDWESRWYAGKKQYRHLLQEDQRIREVLT
                     KELYPAGLARIDIERAADNVAVTVHVAKPGVVIGRGGEKIKVLRDTLAKLTGKNVALN
                     VQEIHNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGA
                     EQARTEWAAEGRVPLHTLRANIDYGFALARTTYGVLGVKAYVFLGEVIGGQKARPRPE
                     GAKPEEKPRRRRPAVRVKKEE"
     gene            484853..485278
                     /locus_tag="TCCBUS3UF1_RS02260"
                     /old_locus_tag="TCCBUS3UF1_4700"
     CDS             484853..485278
                     /locus_tag="TCCBUS3UF1_RS02260"
                     /old_locus_tag="TCCBUS3UF1_4700"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P60489.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_014514880.1"
                     /db_xref="GI:504327778"
                     /translation="MLMPRRMKYRKQHRGRMKGAAKGGDYVAFGDFGLVAMEPAWITA
                     QQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRV
                     MFEVAGVTEEQALEALRIAGHKLPIKTKVVRRDAYDEAQ"
     gene            485265..485462
                     /locus_tag="TCCBUS3UF1_RS02265"
                     /old_locus_tag="TCCBUS3UF1_4710"
     CDS             485265..485462
                     /locus_tag="TCCBUS3UF1_RS02265"
                     /old_locus_tag="TCCBUS3UF1_4710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_014514881.1"
                     /db_xref="GI:504327779"
                     /translation="MKPSEIRKLSPAEIEKLVREKKRELMELRFQASIGQLSQNHRVR
                     ETRRLIARLLTILNEKRRANA"
     gene            485455..485772
                     /locus_tag="TCCBUS3UF1_RS02270"
                     /old_locus_tag="TCCBUS3UF1_4720"
     CDS             485455..485772
                     /locus_tag="TCCBUS3UF1_RS02270"
                     /old_locus_tag="TCCBUS3UF1_4720"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62658.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_014514882.1"
                     /db_xref="GI:504327780"
                     /translation="MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLA
                     HDPEERYKVGDVVEIIESRPISKRKRFRVLRLVEGGRLDLVEKYLVRRQNYASLSKRG
                     GKA"
     gene            485769..486137
                     /locus_tag="TCCBUS3UF1_RS02275"
                     /old_locus_tag="TCCBUS3UF1_4730"
     CDS             485769..486137
                     /locus_tag="TCCBUS3UF1_RS02275"
                     /old_locus_tag="TCCBUS3UF1_4730"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P60557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_003043914.1"
                     /db_xref="GI:489134130"
                     /translation="MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVK
                     EAIPRGAVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFGPV
                     ARELREKGFMKIVSLAPEVL"
     gene            486137..486469
                     /locus_tag="TCCBUS3UF1_RS02280"
                     /old_locus_tag="TCCBUS3UF1_4740"
     CDS             486137..486469
                     /locus_tag="TCCBUS3UF1_RS02280"
                     /old_locus_tag="TCCBUS3UF1_4740"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P60559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_014514883.1"
                     /db_xref="GI:504327781"
                     /translation="MQAKVHVKKGDTVLVASGKYKGRVGKVKAVLPKKGAVVVEGVNL
                     VKKAVRVSPQYPQGGFVEQEAPLHASKVRPICPACGKPTRVRKKFLEDGRKVRACAKC
                     GGSLDVEE"
     gene            486471..487019
                     /locus_tag="TCCBUS3UF1_RS02285"
                     /old_locus_tag="TCCBUS3UF1_4750"
     CDS             486471..487019
                     /locus_tag="TCCBUS3UF1_RS02285"
                     /old_locus_tag="TCCBUS3UF1_4750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_014514884.1"
                     /db_xref="GI:504327782"
                     /translation="MPLDVALKKKYLEEVRPELIRRFGYQNVWEVPRLVKVVVNQGLG
                     EAKEDARILEKAAKELSLITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRGDRMWIF
                     LEKLLNVALPRIRDFRGVNPGSFDGRGNYNLGLKEQLIFPEITYDMVDALRGMDIAVV
                     TTAKTDEEAKALLELLGFPFRK"
     gene            487027..487212
                     /gene="rpsN"
                     /locus_tag="TCCBUS3UF1_RS02290"
                     /old_locus_tag="TCCBUS3UF1_4760"
     CDS             487027..487212
                     /gene="rpsN"
                     /locus_tag="TCCBUS3UF1_RS02290"
                     /old_locus_tag="TCCBUS3UF1_4760"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P24320.4"
                     /note="located in the peptidyl transferase center and
                     involved in assembly of 30S ribosome subunit; similar to
                     what is observed with proteins L31 and L33, some proteins
                     in this family contain CXXC motifs that are involved in
                     zinc binding; if two copies are present in a genome, then
                     the duplicated copy appears to have lost the zinc-binding
                     motif and is instead regulated by zinc; the proteins in
                     this group appear to contain the zinc-binding motif;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14 type Z"
                     /protein_id="WP_014514885.1"
                     /db_xref="GI:504327783"
                     /translation="MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRYFGICRLCL
                     RELAHKGQLPGVKKASW"
     gene            487281..487697
                     /locus_tag="TCCBUS3UF1_RS02295"
                     /old_locus_tag="TCCBUS3UF1_4770"
     CDS             487281..487697
                     /locus_tag="TCCBUS3UF1_RS02295"
                     /old_locus_tag="TCCBUS3UF1_4770"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_014514886.1"
                     /db_xref="GI:504327784"
                     /translation="MLTDPIADMLTRIRNATRVYKESTEVPASRFKEEILKILAREGF
                     IKGYERVEVDGKPVLRIHLKYGPRRQGPDPRPEQVIKHIRRISRPGRRVYVGVKEIPR
                     VRRGLGIAILSTPKGVLTDREARKLGVGGELICEVW"
     gene            487697..488239
                     /locus_tag="TCCBUS3UF1_RS02300"
                     /old_locus_tag="TCCBUS3UF1_4780"
     CDS             487697..488239
                     /locus_tag="TCCBUS3UF1_RS02300"
                     /old_locus_tag="TCCBUS3UF1_4780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_014514887.1"
                     /db_xref="GI:504327785"
                     /translation="MSRIGRLPIPLPKGVTVEVAPGLVKVKGPKGELSVPVSPEMRVV
                     VEGGVVRVERPSDERRHKSLHGLTRTLIANAIKGVAEGYVKELLIKGIGYRARLAGRA
                     VELTVGYSHPVVVEPPEGITFEVPEPTKIRVLGIDKQKVGQVAANLRAVKKPSAYHEK
                     GIYYAGEPVRLKPGKAGTKK"
     gene            488248..488586
                     /locus_tag="TCCBUS3UF1_RS02305"
                     /old_locus_tag="TCCBUS3UF1_4790"
     CDS             488248..488586
                     /locus_tag="TCCBUS3UF1_RS02305"
                     /old_locus_tag="TCCBUS3UF1_4790"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P80320.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_014514888.1"
                     /db_xref="GI:504327786"
                     /translation="MARLTAYERRKFRVRNRVKRAGRLRLSVFRSLNHIYAQIIDDEK
                     GETLVAESSLALKLKGNKTEVARQVGRALAEKALAKGIRQVAFDRGPYKYHGRVKALA
                     EGAREGGLEF"
     gene            488599..489072
                     /locus_tag="TCCBUS3UF1_RS02310"
                     /old_locus_tag="TCCBUS3UF1_4800"
     CDS             488599..489072
                     /locus_tag="TCCBUS3UF1_RS02310"
                     /old_locus_tag="TCCBUS3UF1_4800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_014514889.1"
                     /db_xref="GI:504327787"
                     /translation="MPETDFEEKMILVRRTAKTYQGGRRFRFGALVVVGDRQGRVGLG
                     LGKAKEVPLAVQKAGYYARRNMVEVPLLNGTIPHEIEVEYGASKILLKPAAPGTGVIA
                     GAVPRAILELAGITDILTKELGSRNPINIAYATMEALRQLQTKEDVRRLRKGGEE"
     gene            489072..489254
                     /locus_tag="TCCBUS3UF1_RS02315"
                     /old_locus_tag="TCCBUS3UF1_4810"
     CDS             489072..489254
                     /locus_tag="TCCBUS3UF1_RS02315"
                     /old_locus_tag="TCCBUS3UF1_4810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016328570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_014514890.1"
                     /db_xref="GI:504327788"
                     /translation="MARLKVKLVKSPIGYPKDQKAALKALGLTKLQRERVLADTPAVR
                     GNIQKVSHLLQVEVLE"
     gene            489251..489703
                     /locus_tag="TCCBUS3UF1_RS02320"
                     /old_locus_tag="TCCBUS3UF1_4820"
     CDS             489251..489703
                     /locus_tag="TCCBUS3UF1_RS02320"
                     /old_locus_tag="TCCBUS3UF1_4820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_014514891.1"
                     /db_xref="GI:504327789"
                     /translation="MKLTDLKPNPGANKKRKRVGRGPGSGHGKTATRGHKGQKSRSGG
                     LKDPRRFEGGRSTTLMRLPKRGMQGQVPGAIPRPRYQGVNLKDLARFEGEVTPELLVQ
                     AGILKKGYRLKVLGDGEAKALKVVAHAFSKSALEKLKAAGGEAVLLEA"
     gene            489705..491021
                     /locus_tag="TCCBUS3UF1_RS02325"
                     /old_locus_tag="TCCBUS3UF1_4830"
     CDS             489705..491021
                     /locus_tag="TCCBUS3UF1_RS02325"
                     /old_locus_tag="TCCBUS3UF1_4830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_014514892.1"
                     /db_xref="GI:504327790"
                     /translation="MLKAFRSALAIPELRQRILFTLLVLAAYRLGAFIPTPGVDLDKI
                     QEFLRTTQGGVFGIINLFSGGNFERFSIFALGIMPYITAAIIMQLLVNVVPALEKLSK
                     EGEEGRRIINQYTRIGGIALGAFQGFFLATAFLGAEGGRFLLPGWAPGPFFWLVVVVT
                     QVAGIALLLWMAERITEYGIGNGTSMIIFAGIVVEWLPQILRTVGLIRTGEVNLVAFL
                     FFLAFIVLAFAGMAAVQQAERRIPVQYARKVVGRRVYGGQATYIPIKLNAAGVIPIVF
                     AAAILQIPIFLTAPFQDNQVLQAIANFFNPTRLSGLLLEVALIVLFTYVYTAVQFDPK
                     RIAESLREYGGFIPGIRPGEPTVKFLEHIVSRLTLWGALFLGLVAALPQIIQNLTGVK
                     SIAFSGIGLLIVVGVALDTLRQIESQLMLRNYEGFLSKGRIRGRTR"
     gene            491031..491585
                     /locus_tag="TCCBUS3UF1_RS02330"
                     /old_locus_tag="TCCBUS3UF1_4840"
     CDS             491031..491585
                     /locus_tag="TCCBUS3UF1_RS02330"
                     /old_locus_tag="TCCBUS3UF1_4840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_014514893.1"
                     /db_xref="GI:504327791"
                     /translation="MGEAVIFLGPPGAGKGTQAARLSEELGFKKLSTGDILRDHVARG
                     TPLGQQVKPIMDRGDLVPDELILALIREELADRFILDGFPRTLPQAEALDRLLAETGT
                     RLLGVVLVEVPEEELVRRMLRRAELEGRSDDNEATIRRRLEVYQEKTAPLIQYYEKKG
                     ALKRVEGVGAPDEVYARIRAALGI"
     gene            491585..492352
                     /locus_tag="TCCBUS3UF1_RS02335"
                     /old_locus_tag="TCCBUS3UF1_4850"
     CDS             491585..492352
                     /locus_tag="TCCBUS3UF1_RS02335"
                     /old_locus_tag="TCCBUS3UF1_4850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_014514894.1"
                     /db_xref="GI:504327792"
                     /translation="MAIKLKSPWEIERMREAGALLTEVVEEVARHVEPGITTKELDRI
                     AHEAIRRRKAKPAFLGLYGFPATLCTSVNEVVVHGIPSEEPLKEGDILSVDVGLIHGG
                     FAADMARTFPVGRVSEEAERLIRDTEAAFWEGLKYLRPGYRIGDVAHAVQTFLESRGY
                     GVVREFVGHGVGREIHEDPQLPNFGKPGTGPKIRPGMTLALEPMVTLRPAPVVILEDG
                     WTASAGKGNLAAHYENTVLVTEEGPELLTGVPLVRAQ"
     gene            492360..492578
                     /gene="infA"
                     /locus_tag="TCCBUS3UF1_RS02340"
                     /old_locus_tag="TCCBUS3UF1_4860"
     CDS             492360..492578
                     /gene="infA"
                     /locus_tag="TCCBUS3UF1_RS02340"
                     /old_locus_tag="TCCBUS3UF1_4860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016328575.1"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_003043942.1"
                     /db_xref="GI:489134158"
                     /translation="MAKEKDTIRAEGVVTEALPNTTFRVKLDSGPEILAYISGKMRMH
                     YIRILPGDRVVVEITPYDPTRGRIVYRK"
     gene            492587..492700
                     /gene="rpmJ"
                     /locus_tag="TCCBUS3UF1_RS02345"
                     /old_locus_tag="TCCBUS3UF1_4870"
     CDS             492587..492700
                     /gene="rpmJ"
                     /locus_tag="TCCBUS3UF1_RS02345"
                     /old_locus_tag="TCCBUS3UF1_4870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043944.1"
                     /note="smallest protein in the large subunit; similar to
                     what is found with protein L31 and L33 several bacterial
                     genomes contain paralogs which may be regulated by zinc;
                     the protein from Thermus thermophilus has a zinc-binding
                     motif and contains a bound zinc ion; the proteins in this
                     group have the motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_014514895.1"
                     /db_xref="GI:504327793"
                     /translation="MKVRASVKKMCEKCKVVRRHGRVYVICENPKHKQRQG"
     gene            492714..493094
                     /locus_tag="TCCBUS3UF1_RS02350"
                     /old_locus_tag="TCCBUS3UF1_4880"
     CDS             492714..493094
                     /locus_tag="TCCBUS3UF1_RS02350"
                     /old_locus_tag="TCCBUS3UF1_4880"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P80377.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_014514896.1"
                     /db_xref="GI:504327794"
                     /translation="MARIAGVEIPRNKRVDVALTYIYGVGPARAKEALEKTGINPATR
                     VKDLTEAEVVRLREYVENAWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQR
                     TRTNARTRKGPRKTVAGKKKAPRK"
     gene            493153..493542
                     /locus_tag="TCCBUS3UF1_RS02355"
                     /old_locus_tag="TCCBUS3UF1_4890"
     CDS             493153..493542
                     /locus_tag="TCCBUS3UF1_RS02355"
                     /old_locus_tag="TCCBUS3UF1_4890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_014514897.1"
                     /db_xref="GI:504327795"
                     /translation="MARKATKKKVKRQVASGKAYIHASYNNTIVTITDPDGNPITWSS
                     GGVIGYKGSRKGTPYAAQLAAMDAAKKAMAYGMQSVDVVVRGTGAGREQAIRALQASG
                     LQVKSIVDDTPVPHNGCRPKKKFRKAS"
     gene            493556..494185
                     /locus_tag="TCCBUS3UF1_RS02360"
                     /old_locus_tag="TCCBUS3UF1_4900"
     CDS             493556..494185
                     /locus_tag="TCCBUS3UF1_RS02360"
                     /old_locus_tag="TCCBUS3UF1_4900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_014514898.1"
                     /db_xref="GI:504327796"
                     /translation="MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHG
                     QKRTRRPSDYAVRLREKQKLRRIYGISETQFRNLFEEASRKKGVTGTVFLGLLESRLD
                     NVVYRLGFAASRRQARQMVRHGHITVNGRRVDLPAYRVKPGDEIAIAEGSKNLAFIRE
                     NLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR"
     gene            494234..495187
                     /locus_tag="TCCBUS3UF1_RS02365"
                     /old_locus_tag="TCCBUS3UF1_4910"
     CDS             494234..495187
                     /locus_tag="TCCBUS3UF1_RS02365"
                     /old_locus_tag="TCCBUS3UF1_4910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_014514899.1"
                     /db_xref="GI:504327797"
                     /translation="MFESKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRIL
                     LSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMQTTTLVLR
                     AEGPKEVKAADFTVPSDVELLNPDLHIATLEAGGRLYMEVRVDRGVGYVPAERHGTKD
                     RINSIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPMEALNQAVEIL
                     KEHLSYFANPQTTALPTPEPAVGERPERGGEKEEDLDLPLEELGLSTRVLHSLKEEGI
                     ESVRALLALNLKDLKNIPGIGERSLEEIREALAKRGFALKE"
     gene            495192..495548
                     /locus_tag="TCCBUS3UF1_RS02370"
                     /old_locus_tag="TCCBUS3UF1_4920"
     CDS             495192..495548
                     /locus_tag="TCCBUS3UF1_RS02370"
                     /old_locus_tag="TCCBUS3UF1_4920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_014514900.1"
                     /db_xref="GI:504327798"
                     /translation="MRHLKSGRKLNRHSSHRLALYRNQAKSLLAHGRITTTLPKAKEI
                     TGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYQNRPGGYTRVLKLAE
                     RRRGDGAPLALVELVE"
     gene            complement(495592..496065)
                     /locus_tag="TCCBUS3UF1_RS02375"
                     /old_locus_tag="TCCBUS3UF1_4930"
     CDS             complement(495592..496065)
                     /locus_tag="TCCBUS3UF1_RS02375"
                     /old_locus_tag="TCCBUS3UF1_4930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514901.1"
                     /db_xref="GI:504327799"
                     /translation="MSARTLFALLVLLLLFLFSWLNWGEITRPTSLSLGLTRVEAPLG
                     LVLVVALGTVSLLYLLFTIGLETAALLEVKRYARELLHYKKLAEDAEQSRYTELKRYL
                     EAELQRLAQVEKEEIQALEARLAETLEKHGNTLAAYIGELEDQVLRLLGPREKEG"
     gene            496111..496944
                     /locus_tag="TCCBUS3UF1_RS02380"
                     /old_locus_tag="TCCBUS3UF1_4940"
     CDS             496111..496944
                     /locus_tag="TCCBUS3UF1_RS02380"
                     /old_locus_tag="TCCBUS3UF1_4940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014514902.1"
                     /db_xref="GI:504327800"
                     /translation="MGYLYLLLAAFLWGLIGPVSRMAFQEGLPPLLVAFFRAVIAWAF
                     FGLHALWARQVRVAARDLPALFLFGLVGVSLFYGSYQLAVGYGGAALASVLLYTAPAW
                     VALLSFLVLREPLDRQGLLAVALTLLGVGLMGLGGGSEVRAGPLALLFGLLSGFTYAL
                     YYIFGKLYLPRYATPTLFLYALPVGALGLLPFVDPVPLRPGALGALLFLGVFSTYGAY
                     LAYYAGLKRLPATRASVVATLEPVVANLFAFLLFREVLSPLGYLGAALVLLAVLLSVR
                     R"
     gene            complement(496982..497518)
                     /locus_tag="TCCBUS3UF1_RS02385"
                     /old_locus_tag="TCCBUS3UF1_4950"
     CDS             complement(496982..497518)
                     /locus_tag="TCCBUS3UF1_RS02385"
                     /old_locus_tag="TCCBUS3UF1_4950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_041433693.1"
                     /db_xref="GI:752794261"
                     /translation="MGPAHPKASDLDAPRVLVLNAAYEVLGLASIKRSVLLVLSGSAE
                     MVSESGRFLHTPSTRIPVPSVIRLKRLVRRGPSRIPLNRRNVLRRDRYTCQYCGRQGG
                     ELTVDHVLPRSRGGKGTWENLVAACRPCNLKKGDRTPEEAGMRLLKSPRAPRAPLFLA
                     ELKEVPEDWRPYLEAFLR"
     gene            497598..498947
                     /locus_tag="TCCBUS3UF1_RS02390"
                     /old_locus_tag="TCCBUS3UF1_4960"
     CDS             497598..498947
                     /locus_tag="TCCBUS3UF1_RS02390"
                     /old_locus_tag="TCCBUS3UF1_4960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514904.1"
                     /db_xref="GI:504327802"
                     /translation="MMKPIPKALPLLLGLGLALAQPSLEQAEALLKAGNYAQAALAYE
                     EVLARDYGRLEAHLGLGVALFRAGRLEEARFAFDQMVRVFPERYEGHFNLGQVYLRLG
                     KPQEAAGAFAKAAELSPSEEAYLGWASALAQAGQAKEAAEALKKGLTPERSPAYRLAL
                     AQALYAAGARAEAVPVLYGLLNRDPKAAEAWDLLARILAEEGLKARALRELDRGLALV
                     EGKARARLLLRKALLSPSPEPLLREAYALDPSLWEAAYLLGRARLEAGDPRGALAFLL
                     PAYRTSPEPEVALALAGAYLALKDYPNAYRYADEAGPSGLFLKAQAARALGRRVEALE
                     LLEGVNALEAQAFKGSILLEMGRAEEALGVLRTAYTAQKSPEVGVNLGASLLALGRFG
                     EAELVLREILQAAPRMAAAWYNLGLALKALGREAEAQRALTQAANLGSAEAKALLRR"
     gene            498949..499740
                     /locus_tag="TCCBUS3UF1_RS02395"
                     /old_locus_tag="TCCBUS3UF1_4970"
     CDS             498949..499740
                     /locus_tag="TCCBUS3UF1_RS02395"
                     /old_locus_tag="TCCBUS3UF1_4970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="WP_014514905.1"
                     /db_xref="GI:504327803"
                     /translation="MRWLRENWLDLLIFLLIAVVAAGIVLYLTGVNPFARPKPQAESL
                     PAPSVPASPSPSPAPTPSPEPAQPVVTVLPLPQAPPASEETGRSPVAPAPQKASQVQA
                     PSQASPPRSSAPPSPTGAYRVVVGAFANPENAARLRQELAQKGYPARLEPAGNLTRVV
                     VGPYASEAQARQVAEALTVYGAQVYRGQGAAPPPAGQVYLQVGAFQKEENALLVAGRL
                     KELGLPVVLVKDGVYRVRVGPVAEAEKEDVKAKVAALGLEALEVR"
     gene            499737..500372
                     /locus_tag="TCCBUS3UF1_RS02400"
                     /old_locus_tag="TCCBUS3UF1_4980"
     CDS             499737..500372
                     /locus_tag="TCCBUS3UF1_RS02400"
                     /old_locus_tag="TCCBUS3UF1_4980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018460494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="REX family transcriptional regulator"
                     /protein_id="WP_014514906.1"
                     /db_xref="GI:504327804"
                     /translation="MKVPSAAIIRLVTYLRILEELEAKGVHRTSSEQLAEEAQVTAFQ
                     VRKDLSYFGSYGTRGVGYTVPVLKRELRHILGLNRKWGLCIVGMGRLGSALADYPGFG
                     ESFELRGFFDVDPEKIGRRVGSGVIEPLDLLPQRVPGRIEIALLTVPREAAQEAADRL
                     VAAGIRGILNFAPVVLEVPKEVAVENVDFLAGLARLSFSILNPKWREEMMG"
     gene            500375..500890
                     /locus_tag="TCCBUS3UF1_RS02405"
                     /old_locus_tag="TCCBUS3UF1_4990"
     CDS             500375..500890
                     /locus_tag="TCCBUS3UF1_RS02405"
                     /old_locus_tag="TCCBUS3UF1_4990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514907.1"
                     /db_xref="GI:504327805"
                     /translation="MKGLKILLGLGMALAFAACGTDVFFQQPYRVLLEPTQLGYEVDD
                     QGRIIVVGNNAYVQAAPGAPGGYLERYEYLVVDDSGNEVFSGSSLGSGFVGVEVPPGR
                     EEANGQVTYAYKQSRPFSFSLDGRVALEHLNQNAPLNWRYQVTWYLTTANGRTVTWLQ
                     EYQVKYPLRGQ"
     gene            500914..501861
                     /locus_tag="TCCBUS3UF1_RS02410"
                     /old_locus_tag="TCCBUS3UF1_5000"
     CDS             500914..501861
                     /locus_tag="TCCBUS3UF1_RS02410"
                     /old_locus_tag="TCCBUS3UF1_5000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl-diphosphate synthase"
                     /protein_id="WP_014514908.1"
                     /db_xref="GI:504327806"
                     /translation="MTVQEALEAPLLRFEQALSELVQSEVLFIRLIHQDLVTAGGKRI
                     RPRLVFLASRALGGAPFELELALAVELLHSATLLHDDLIDEAETRRGKEAAFRKYGNA
                     VSVLSGDFLLSRLLHVIAKTGRMELVERFAQVAKTLSEGEVLQFQVAALEDYSLENYE
                     RIITAKTAVLMALATEGPALLREEPLEVRQALYRFGLLYGQAFQMRDDYLDLMGTPEV
                     LGKPVGGDVREGKATLITLLLMERFPEVREVLRRKGREPGDLERLRDLARKSGVAREV
                     EAHIRQRAQQAAEALAFLPDSPYKEALKALALKEAERLA"
     gene            501909..503168
                     /locus_tag="TCCBUS3UF1_RS02415"
                     /old_locus_tag="TCCBUS3UF1_5010"
     CDS             501909..503168
                     /locus_tag="TCCBUS3UF1_RS02415"
                     /old_locus_tag="TCCBUS3UF1_5010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014514909.1"
                     /db_xref="GI:504327807"
                     /translation="MAIPAYRPPEDPGLWEAFLERLERTLKVAAVHPTTVEYLAHPKR
                     LVTVSLPVVMDDGKVRVFQGYRVVHDIARGPAKGGVRLHPGVTLGQTAGLAAWMTLKA
                     AVYDLPFGGAAGGVAVDPKALSPRELERLVRRYTAELVNLIGPDIDILGPDVGTDQQV
                     MAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGVALVLRELAQRRGLPLEG
                     ARVAVQGFGQVGGSFALHAEAMGLKVVAVSTGRGVMYREAGLPVGEVLRHYEATGELP
                     HYHLAPEEVFALPVDYLVLAALEGALDGERAKGVQARAVLEAANFALTLEAEAYLLGK
                     GVLVVPDLLTGGGGLLASYLEWVQDLNMFFWSADEVRQSFTKSVAKAVAEVCARAEGL
                     GADLRTGALALALERLNEATRLRGVYP"
     gene            503179..504453
                     /locus_tag="TCCBUS3UF1_RS02420"
                     /old_locus_tag="TCCBUS3UF1_5020"
     CDS             503179..504453
                     /locus_tag="TCCBUS3UF1_RS02420"
                     /old_locus_tag="TCCBUS3UF1_5020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003043978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014514910.1"
                     /db_xref="GI:504327808"
                     /translation="MKSEPLSYLGKDGGPWEIFVEQVDRVIPYLGRYAPLAESLKRPK
                     RVLIVDVPIHLDDGTVAHFEGYRVHHNTARGPAKGGVRYHPEVTLSEVMALAAWMTIK
                     NAAVGLPYGGGKGGIRVDPRKLSPHELERLTRRYTSEIGILLGPDRDIPAPDVNTGER
                     EMAWMMDTFSMNVGRTVPGVVTGKPIALGGSLGRRDATGRGVFVTAAAAAEKIGLPIA
                     GSRVILQGFGNVGNAAARIFHDHGARILAVQDHTGTVYHEGGIDPYDLLRHVQEYGGV
                     RGYPRAEPLPNAEFWSIPTDFLIPAALEKQITEQNAWRIQAKIVAEGANGPTTPAADD
                     ILLEKGVLVVPDVIANAGGVTVSYFEWVQDFNSYFWSEEEINARLERVLRSAFEAVWQ
                     VSQEKKIPLRTAAYVVAATRVLEARALRGLYP"
     gene            504491..505018
                     /locus_tag="TCCBUS3UF1_RS02425"
                     /old_locus_tag="TCCBUS3UF1_5030"
     CDS             504491..505018
                     /locus_tag="TCCBUS3UF1_RS02425"
                     /old_locus_tag="TCCBUS3UF1_5030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_014514911.1"
                     /db_xref="GI:504327809"
                     /translation="MDWPRHGRVTLKPFAAGLTEAEWRGLYETFRDPEVAEWNGSSPL
                     RSPLWLFKRFVQAEMRRKDRMAFAILDEKGEYLGTLELYDLTPEEATLGILIGRKDRW
                     GQGYGTEAVRAALGYAFGQLGLKRVRLRTFAHNLRARRAFQKAGFREVGFGPGPKGKE
                     DVYMEVCREDFDLEA"
     gene            504993..505883
                     /locus_tag="TCCBUS3UF1_RS02430"
                     /old_locus_tag="TCCBUS3UF1_5040"
     CDS             504993..505883
                     /locus_tag="TCCBUS3UF1_RS02430"
                     /old_locus_tag="TCCBUS3UF1_5040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_014514912.1"
                     /db_xref="GI:504327810"
                     /translation="MRILTSRLREEVFALLPQGVEVRFLDEPWPRSADLFLPPFGQEE
                     VVRRVLAEVEVRVVQTLSAGVDWILPLLPPGVVLCDGSGIHDVPVAEWVVLALLSLLK
                     DLPGFLEAQREGRWAPRRLPDLEGQTVLLLGYGAIGKAVEARLRPFGVELLPVARHPR
                     PGVYTPKDLPHLLPRADAVVLLLPLTPETRGMVDQDFLARLKPGALLVNAGRGPLVDT
                     EALLKALEAGRVRAFLDVTDPEPLPEGHPLWRAKGVVITPHVAGLSQGFSRRAARFLA
                     EQVGRYLRGEPLLNVVREGY"
     gene            505883..506092
                     /locus_tag="TCCBUS3UF1_RS02435"
                     /old_locus_tag="TCCBUS3UF1_5050"
     CDS             505883..506092
                     /locus_tag="TCCBUS3UF1_RS02435"
                     /old_locus_tag="TCCBUS3UF1_5050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514913.1"
                     /db_xref="GI:504327811"
                     /translation="MEVILYGDLRRYGERLRVEARTPKEALERLGIPLEEVWLLAVGD
                     RVVGLEEATEGPLEVYPPIAGGWYT"
     gene            506168..507190
                     /locus_tag="TCCBUS3UF1_RS02440"
                     /old_locus_tag="TCCBUS3UF1_5060"
     CDS             506168..507190
                     /locus_tag="TCCBUS3UF1_RS02440"
                     /old_locus_tag="TCCBUS3UF1_5060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514914.1"
                     /note="transforms a conserved lysine residue of initiation
                     factor 5A into deoxyhypusine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyhypusine synthase"
                     /protein_id="WP_014514914.1"
                     /db_xref="GI:504327812"
                     /translation="MEKKELLSTPVVPIDIKAFDAGPILEAMGKTAFQARNLHRAAEI
                     YLRMLEDEAAVILTLAGSLVSAGQGLIVHDLIRKGLVDAIVATGANIVDQDFFEALGH
                     RHYQGDPKADDEALRRLWIDRIYDTYIDEEELRHTDYTIAEIASSLEPRPYSSREFIW
                     HMGRYLAERGLGEKSIVRAAYEEGVPIFVPAFSDSSAGFGLVYHQVKHPKAHVTIDSV
                     ADFRELTQIKLQAGTTGLVMLGGGVPKNFAQDIVVAAEVLGHQVEMHKYAIQITVADE
                     RDGGLSGSTLSEAQSWGKVDAALSQMVFAEATLAFPLLASYVWHRAPVRAKRRYADLF
                     QAEAVA"
     gene            507277..510048
                     /locus_tag="TCCBUS3UF1_RS02445"
                     /old_locus_tag="TCCBUS3UF1_5070"
     CDS             507277..510048
                     /locus_tag="TCCBUS3UF1_RS02445"
                     /old_locus_tag="TCCBUS3UF1_5070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433695.1"
                     /db_xref="GI:752794263"
                     /translation="MPDELRLYLKERFGVQGPVSPSRFEAELARRLGSPGKRQPLLRA
                     WRAYLGGGGREAVRSFYREVLKVPRGEALVYGMHLPFLEFYARELPQRVEGRVLEVGA
                     FTGALVGYLQRKRPELSWHALDGVEEAVAVGRRRVPEVAWHLGWAEEVELPPFDTLLL
                     LSVFPEGWVEEGMESRLEPEAFWKRFSFFARLPRFLRLLRPGGLLAYGHGPFLGKSLE
                     GVEEGLRRLGFQEVERVGEGEYFLVLARRPEALAEVSLEEAWEDLPALEEPVAVAVAE
                     PDLAEVQALLEAGQYAEVLARLPEGVEGEAAYLRGRALFALSRFAEAEEALRRAMREE
                     AEDLRALVLVELKDYERAKGRLEALAGRGGRYRLALGRVYLAQGRYADALRQFVESGL
                     PEAEVYVREALEGIEGRMRRFAREGEWTEVSRRAEFVEDLSPGLLTREMLRLGLRAAL
                     LQGLFARAERYARRLADLDEAEGFLGLALAAVRLRTPLEHKGEDLKAVEPYLTEALAR
                     AEIPEALLLLGILREREGRFREALYLLERAARHGEGEVAGMAFHHLAEVKRALRRPLR
                     EVLGDHKRAHALKAYPAPYLFHLAQEALAGGEEVLARELLSRARDAGLAEVAEEDLLG
                     LLSLLERLEGPWAAFSVLYQALGRTPRPPLELLALAYRLSRSFRESPEAESVRGQYLA
                     ALYGAGRAKEAEAVLLEELRAHPQALEVLFDLAEHHETQGEWRQAAEYWQKALEVALY
                     GEKDLGLAREVLRNLLFLRPHDESLALYLEELKAVGQGLKAMGEEPPEVPQDPEGLLE
                     EALPRFHGEHLLVVGGHTQLRSRLVPLLEARGLRVDWFDADSAGVGKEALKRIQNRLE
                     KAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHIIPGRARGATGFLRALKAFAPELFKR
                     ALKGHGRGP"
     gene            510068..510886
                     /locus_tag="TCCBUS3UF1_RS02450"
                     /old_locus_tag="TCCBUS3UF1_5080"
     CDS             510068..510886
                     /locus_tag="TCCBUS3UF1_RS02450"
                     /old_locus_tag="TCCBUS3UF1_5080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1,4-dihydroxy-6-naphthoate synthase"
                     /protein_id="WP_014514916.1"
                     /db_xref="GI:504327814"
                     /translation="MEALALGYSPCPNDTFIFYALTHGRVESPLPIQPVLEDVETLNR
                     WALEGRLPLTKLSYAAYGRVRDRYVALRSGGALGRGVGPLVVARRPLESLEGVRVAIP
                     GRNTTAFLLLSLYAQGFQPLEVRYDQVMPLVAQGEVEAGLIIHESRFTYPQYGLVKVL
                     DLGEWWEAWTGLPLPLGGILARRDLGEERIRALDQAVRRSLEYALAHPEETLPYLKAH
                     AQEMAEEVLWAHVRTYVNAFSLDLGEEGEEAVRRLLAEAEARGLLPPSAAPLFL"
     gene            510896..511522
                     /locus_tag="TCCBUS3UF1_RS02455"
                     /old_locus_tag="TCCBUS3UF1_5090"
     CDS             510896..511522
                     /locus_tag="TCCBUS3UF1_RS02455"
                     /old_locus_tag="TCCBUS3UF1_5090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014514917.1"
                     /db_xref="GI:504327815"
                     /translation="MFQELAPEARREAARVFQPLRVRRGAPLYALGDPVDGLYLVREG
                     FLWLEGPRSPTGEAATLGVVGPGGLLGEEALVGEARRTAGASALTYGELLFAPKGELK
                     ALRDRFPEVEAWLLKGIYARLKAAEERLWEVRHLSVGQRLARLLLRLSQGGEVALSHQ
                     DLAHMVGATRETVTKLLGEWALLGWVDLGYRRVEVRAREALAQQAGAL"
     gene            511533..512987
                     /locus_tag="TCCBUS3UF1_RS02460"
                     /old_locus_tag="TCCBUS3UF1_5100"
     CDS             511533..512987
                     /locus_tag="TCCBUS3UF1_RS02460"
                     /old_locus_tag="TCCBUS3UF1_5100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514918.1"
                     /db_xref="GI:504327816"
                     /translation="MEPALLARLLGLPQGMEALRERMGRVGHPGLLPALSAYLKRLGA
                     PEEARRFLERLPQGAVVTGQQAGLLGGPALTFYKAHSALSLAGEVGGAAVFWVASQDH
                     DVEEVRHLHLLWEEEVRTLSLPLPPLPAGRLSLEPHRERLREFLGPWAREARVAYALE
                     GRTLAEFFARLLLAFLGERGLLPFDPMAEELAPLFQEALERELSDPLASAEAINQEAE
                     RIRSLGGKPPLGRKPGATNLFLETDARRLLHYEGGVFRDGVRTYTRKELLELLRTDPT
                     RLTPAAGLRPIFQDLVLPTAGFVVGPNEFRYVAELTRVYGLYGLPVPALFLRLQGVVL
                     EPPVVRILGRYALDPWAFLARGEEAFLDAVRKTLEEFRQLEEDLARLLAQAEALAERA
                     KALEPTLERPFRRYRARLQGEGERLWRKLLRARLHRDGVLLHHLERLKRHLLPLGLPQ
                     ERVFPFAMYALRHPEALRRLEEAPGYGRAVLTLG"
     gene            513012..514094
                     /locus_tag="TCCBUS3UF1_RS02465"
                     /old_locus_tag="TCCBUS3UF1_5110"
     CDS             513012..514094
                     /locus_tag="TCCBUS3UF1_RS02465"
                     /old_locus_tag="TCCBUS3UF1_5110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stage II sporulation protein D"
                     /protein_id="WP_014514919.1"
                     /db_xref="GI:504327817"
                     /translation="MARGWLLILLLPLLLFPFHSPGWGQAKDLLLRVLLKEVPLGQEV
                     PLALPQGEVVVRGMGEGVAVEGRVQPFWDLAVPYFRLEGRPYRGGVRLLVQGERLLLV
                     NLVPLEDYLLGVLPGEMPQGFPLEALKAQAVVARTFAVNRLNPRAPYDLCASELCQVY
                     LGLGAETARHREAVAATQGQVLSYGGRAISALYHADSGGMTAGSEEVFGNALPYLRPR
                     PDPYARGPKSAWRLRLTPEAASRALVSLGRTPKGQDPPQVLERSPSGRAWRVRLLGVE
                     VQGPEAGRLLRLMGLPSALAEFEGWEVAGRGAGHGVGLSQWGAKGMAEAGYAYREILG
                     HYFPGTFLSDLLLAEPPFPGALARLP"
     gene            514099..>514562
                     /locus_tag="TCCBUS3UF1_RS02470"
                     /old_locus_tag="TCCBUS3UF1_5120"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(514542..515969)
                     /locus_tag="TCCBUS3UF1_RS02475"
                     /old_locus_tag="TCCBUS3UF1_5130"
     CDS             complement(514542..515969)
                     /locus_tag="TCCBUS3UF1_RS02475"
                     /old_locus_tag="TCCBUS3UF1_5130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pullulanase"
                     /protein_id="WP_014514921.1"
                     /db_xref="GI:504327819"
                     /translation="MAWYEGVFFYQIFPDRFFRAGPPGRPAPAGPLEPWEAPPSLRGF
                     KGGTLWGVAEKIPYLKGLGVEALYLNPIFASTANHRYHTTDYLQVDPLLGGNQALRHL
                     LEVAHAHGIRVILDGVFNHTGRGFFAFQHLLENGEASPYRDWYYVKGFPLNPYAPQPN
                     YEAWWGNPELPKLRVETPAVRDYLLGVAEHWIRFGADGWRLDVPNEIRDPEFWRAFRR
                     RVKGANPEAYIVGEIWEEAEAWLQGDMFDATMNYPLARAILGFVGGEALDRELAARSG
                     LGRIEPLQALAFSHRLEGLFGRYRLEVVRAQMNLLTSHDTPRLLSLLRGSVARARLAL
                     ALLFLLPGNPTVYYGEEIGMEGGMDPENRGGMVWEEARWKREILETVRRLARLRQEHP
                     ELRTAPYARVYAADGHLAFTRGPYLVVVNASPEPFRQDFPLRGALPRGAQAVDLLSGA
                     SCTPMGGRLCGPELPPFSVAVWAEV"
     gene            516062..516724
                     /locus_tag="TCCBUS3UF1_RS02480"
                     /old_locus_tag="TCCBUS3UF1_5140"
     CDS             516062..516724
                     /locus_tag="TCCBUS3UF1_RS02480"
                     /old_locus_tag="TCCBUS3UF1_5140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_014514922.1"
                     /db_xref="GI:504327820"
                     /translation="MRGRLFVMTGASGVGKGTVRARVLERTRLFYSISMTTRPPRPGE
                     RDGVDYYFVDRPAFEALLAQDGFLEHAEYVGHLYGTPKAPVERALARGEDVLLEIEVQ
                     GALQVRAKVPEAVLIFLLPPSLSELKRRLVYRGKDSPEKIQKRLAQAEWEIQNAHLFD
                     YVVVNDVLEEAVADFLAILTAERRRTPRMARALERALKRDGDLEAELDEILRRNHGGT
                     RD"
     gene            516705..517007
                     /locus_tag="TCCBUS3UF1_RS02485"
                     /old_locus_tag="TCCBUS3UF1_5150"
     CDS             516705..517007
                     /locus_tag="TCCBUS3UF1_RS02485"
                     /old_locus_tag="TCCBUS3UF1_5150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_014514923.1"
                     /db_xref="GI:504327821"
                     /translation="MAEPGIDKLFALVDSKYRLTVVVAKRAQQLLRHRFKNTVLEPEE
                     RPKMRTLEGLYDDPNAVTWAMKEALTGRLVFGENLIPEDRLQKEMERLYPVEEEEA"
     gene            517008..518198
                     /locus_tag="TCCBUS3UF1_RS02490"
                     /old_locus_tag="TCCBUS3UF1_5160"
     CDS             517008..518198
                     /locus_tag="TCCBUS3UF1_RS02490"
                     /old_locus_tag="TCCBUS3UF1_5160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA/pantothenate metabolism flavoprotein"
                     /protein_id="WP_014514924.1"
                     /db_xref="GI:504327822"
                     /translation="MARVLVAATGGVAAIKVPHLLRLLRAAGHEVRVLATPRALEFVT
                     PLSLAVAAGGEVATEEAWFRPDGRALHIELARFADVVLVAPATADALAKAALGLADDL
                     LSATLLAGAKRVAWAPAMNQAMWLAPQTQAHVERLKALGHAVFGPAYGPLAAVGEGEG
                     WGRMLEPEELVERLHAFLTPKDLQGLRLLVSAGPTREYLDPVRFLSNPSSGRMGYAVA
                     EAARDRGAEVVLVAGPTCLPDPWGVEVVRVESALEMRDRLRERYPWAQGVVMAAAVAD
                     YRPAEVLAEKEPKVEAERILRLVPNPDILKELGQEKGDKVLVGFAMETGEGLERAKGK
                     LWRKNLDLIVLNWVNREGVGFGSPENEVVLLLKDGRILELPRMSKRQVADRILDFVKE
                     FWQA"
     gene            518209..518706
                     /locus_tag="TCCBUS3UF1_RS02495"
                     /old_locus_tag="TCCBUS3UF1_5170"
     CDS             518209..518706
                     /locus_tag="TCCBUS3UF1_RS02495"
                     /old_locus_tag="TCCBUS3UF1_5170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine repressor"
                     /protein_id="WP_014514925.1"
                     /db_xref="GI:504327823"
                     /translation="MRSKAERHRAIQEIVSREEIGTQKELVERLRQLGFDVTQATVSR
                     DIAELRLARVALGKGRHKYALPSLELPEDVHEELKRQFGLFVKDVDRGGNILVVKTAE
                     GHASGIALLMDRLRRDEIVGTLAGEDTILVVARSEEGAKALEEEFGELLVAGKAGKRA
                     PGLPS"
     gene            518711..519322
                     /locus_tag="TCCBUS3UF1_RS02500"
                     /old_locus_tag="TCCBUS3UF1_5180"
     CDS             518711..519322
                     /locus_tag="TCCBUS3UF1_RS02500"
                     /old_locus_tag="TCCBUS3UF1_5180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarC family transcriptional regulator"
                     /protein_id="WP_014514926.1"
                     /db_xref="GI:504327824"
                     /translation="MLELFLKSFLTLFVVVDPVGLVPVFLALAGDRPPRKQAQIAKKA
                     VLVAGGLLVSFFFFGRGLLEHLGISLEALRIAGGILLFRIATEMVFAHHERETEEEKD
                     EALHRADISVFPLAIPLIAGPGALASVLILGGEARGTPWGWAVVLLTAFLVLLLAYLF
                     LRAALHVRQVLGRTGVNVVTRVLGLLLAALAVQYVADGVKGLL"
     gene            complement(519306..520472)
                     /locus_tag="TCCBUS3UF1_RS02505"
                     /old_locus_tag="TCCBUS3UF1_5190"
     CDS             complement(519306..520472)
                     /locus_tag="TCCBUS3UF1_RS02505"
                     /old_locus_tag="TCCBUS3UF1_5190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014514927.1"
                     /db_xref="GI:504327825"
                     /translation="MNPLEAPYPVFLLRGEEVVANALAQGLPLPQGETLEVEERSYQV
                     VRLPTPEGTYLLLLETTPLAIRARAYQSLLAVLKGLLQHEEPEGLLQDLIREAVAVVP
                     GAEAGSILLREGGFFYLVAQEGFSEDLLGARTSLEEELAWYGLGVDNWLKGRPRVLKG
                     TEIRHLSSLSTVEARPAFFEHGRLLEIQATLGLPIVLEGEVLAAMNLDSFSHPEAFTP
                     LSLELAQAFALEAALLLKAMRERQALQEKARTDPLTGLGNRRALEETFPQLQAEARTL
                     GEPLGLIYWDLNGLKALNDREGHAAGDRALKSLATALKSLSRRRDLAFRVGGDEFVSL
                     HLGLSPEEIPLLIARLQANLPYGVAAGGLCVGEESLEEALEEADRRMYRAKGGP"
     gene            complement(520469..522025)
                     /locus_tag="TCCBUS3UF1_RS02510"
                     /old_locus_tag="TCCBUS3UF1_5200"
     CDS             complement(520469..522025)
                     /locus_tag="TCCBUS3UF1_RS02510"
                     /old_locus_tag="TCCBUS3UF1_5200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="WP_014514928.1"
                     /db_xref="GI:504327826"
                     /translation="MLLRLEVQNLAAIREAVLELGPGLNVLTGETGAGKSLLVDALAL
                     LLGEKAEGLLGPFGESLLVTAFFPERVLSRRVGSRSTPRIDGEVVSLKELQEEAERWL
                     SLHAQHAALALLSPKRQRALLDALLPPETLGAYAEAYGQYQALLAEQRALEEALRMRS
                     EREDLLRFQLREIEEAKPRPGEDQELWQEAERLRHLEALRERAGRAYALLAEEGALDL
                     LQGAVRELRGGGRFDRALEALAGDLEAALQGARAVARELEDYLEGLEGDPERLAALEA
                     RLSLLERLKRKYGPTLEEVLAHAQRAQEELRTLEGGEERLEAVRRAVRASRETLLAAG
                     EALTEARAQAAQRLARGMEAELSALGLPQARFQVELLPLPEPGPFGLEEVAFRFSASP
                     HLPPAPLGAASGGELSRIALALALLTGAEAPTVVFDEMDTGVGGETAWKLAERLARLA
                     ESRQVLVVTHLPQVAARAHRHLRVVKEGSEVRVEVLEGEARVRELARLLSGQYTEAAL
                     AHARLLLERP"
     gene            complement(522059..523282)
                     /gene="glyA"
                     /locus_tag="TCCBUS3UF1_RS02515"
                     /old_locus_tag="TCCBUS3UF1_5210"
     CDS             complement(522059..523282)
                     /gene="glyA"
                     /locus_tag="TCCBUS3UF1_RS02515"
                     /old_locus_tag="TCCBUS3UF1_5210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633107.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_014514929.1"
                     /db_xref="GI:504327827"
                     /translation="MVRTSLRDEALFELIALEEKRQREGLELIASENFVSAQVREAVG
                     SVLTNKYAEGYPGARYYGGCEVIDQVERLAMERAKALFGAAWANVQPHSGSQANMAVY
                     MALMEPGDTLMGMDLAAGGHLTHGAKVNFSGKLYRVVSYGVRPDTERIDLEEVRRLAR
                     EHRPKVIVAGSSAYPRFWDFQAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPIPYAH
                     VVTSTTHKTLRGPRGGLILSNDLELGKKIDKLIFPGIQGGPLEHVIAGKAVAFFEALQ
                     PEFKAYSRLVVQNAQRLAAELAERGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDA
                     VGITVNKNAIPFDPKPPRVTSGIRVGTPAITTRGFTPEEMPRVAELMDRALTEGPSEA
                     LREEVRRLALAHPMP"
     gene            523329..523595
                     /locus_tag="TCCBUS3UF1_RS02520"
                     /old_locus_tag="TCCBUS3UF1_5220"
     CDS             523329..523595
                     /locus_tag="TCCBUS3UF1_RS02520"
                     /old_locus_tag="TCCBUS3UF1_5220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514930.1"
                     /db_xref="GI:504327828"
                     /translation="MKGNTFTIAKWAALLLLAILLLTILLINFTSSRDLPELVRVQVE
                     RYAVCSYWFFGWHLASTGAFAFAFLALGFLLGLGAGLFLRWGRP"
     gene            complement(523592..524983)
                     /locus_tag="TCCBUS3UF1_RS02525"
                     /old_locus_tag="TCCBUS3UF1_5230"
     CDS             complement(523592..524983)
                     /locus_tag="TCCBUS3UF1_RS02525"
                     /old_locus_tag="TCCBUS3UF1_5230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633103.1"
                     /note="Catalyzes first step of the de novo purine
                     nucleotide biosynthetic pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_014514931.1"
                     /db_xref="GI:504327829"
                     /translation="MDKPQEECGILGLWSQSPLDAAGLLHLGLLALQHRGQEAAGIAV
                     SDGQAFLVEKDLGLVNQVFTEERLAKLRLPQARLGLAHARYSTTGSNLRFNAQPLTAR
                     TAHGVLAIAHNGNFTNAKPLRDRLLQEGATFQSTSDTEVMLYLIARLAHLPLPQAAAE
                     AMKALEGGYSILLMDRTTLLALRDPHGVRPLAIGRLPRGYAFASEPPALALMGAEYLR
                     DVRPGELVWVEEGELRSLQVLPPSPTPCAFEWIYFARPDSLLDGVEAYQARVRMGEEL
                     FREAPAEADIVVPVPDSGIGAAVGYARASGLPLEYGLYKNPYAGRTFIQPTQELRDLK
                     TRLKLSPTSAVRGKRVVLIDDSIVRGTTSKRIVRMLKEAGAVEVHFRVSSPPIRFPCY
                     YGIDTAARKELIAAEKSVEEIRAYIGAESLAFLSEEGVRRAIGGPVCLACFNGRYPAG
                     VPLEGEKLALELL"
     gene            complement(524976..527153)
                     /locus_tag="TCCBUS3UF1_RS02530"
                     /old_locus_tag="TCCBUS3UF1_5240"
     CDS             complement(524976..527153)
                     /locus_tag="TCCBUS3UF1_RS02530"
                     /old_locus_tag="TCCBUS3UF1_5240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_014514932.1"
                     /db_xref="GI:504327830"
                     /translation="MEAFAKEIGIPEEEYRAILRKLGREPNRVELFLFKVMWSEHCAY
                     KNSRPLLKELPKEGEAVLQGPGENAGVVRLGEGWAVAFKIESHNHPSAVEPFQGAATG
                     VGGILRDIMSMGARPIALLDSLRFGPPQDPRSRYLFKGVVAGIAHYGNAIGVPTVGGD
                     LYFHEGYRENPLVNAMCLGLLREEQLKRSRASLGRPIYYAGAKTGRDGIGGAAFASKE
                     LGEDKEEDRPAVQVGDPFLGKLLMEATLEAIERDLVEGVQDMGAAGLTSSLSELVHKS
                     GLGVELDLDRVPTREAGMGPIELLLSESQERMVLVPKEGKEEALEEVFRRWGLDCVAV
                     ARTVPERVFRVRFRGEVVAEVPTEALAEAPTYVRVGREDPEIRRLRETPLPPLQADPQ
                     EVLPRLLSSPNLASREAVYERYDHQVGTRTALLPGRGDAAVLWIKGTQLGLAAKVDQN
                     PRYSRLHPRLGAMHALAEACRNVSVVGARPLAYTDGLNLGSPETPEGYFELKETLEGL
                     KEASEALGVPVVSGNVSLYNESGGRRIPPTAMVGVVGVLDIRKRAEMGFRRPGEVILL
                     LGEARGELGASELLYLLTGLELGHPPALDLVEERRVQEAIRELIGLGLTATAHDLAEG
                     GLLVALAEMTFPYGLGATVEVRERGLEALFGEAPSRILLTVAKEKLAEATGRLEALGL
                     PYRVLGETGGETLTVLTPEGVLEWEVRELMAAWKEPLREVLDG"
     gene            complement(527153..527866)
                     /locus_tag="TCCBUS3UF1_RS02535"
                     /old_locus_tag="TCCBUS3UF1_5250"
     CDS             complement(527153..527866)
                     /locus_tag="TCCBUS3UF1_RS02535"
                     /old_locus_tag="TCCBUS3UF1_5250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-haloalkanoic acid dehalogenase"
                     /protein_id="WP_014514933.1"
                     /db_xref="GI:504327831"
                     /translation="MKPKAITFDFWGTLFTEGPAFLEKVMPVRYEILLDALSEAGHPA
                     EEHEVREAYRQATLAFEEAWKAGEHMPVYDRVARIFALLGAPHDPGLIALTARKLEES
                     SLLVDLTPLPGVGVLRELSRRYPLALVSDTGMTPGRLLREHLKRQGLEVFQAYSFSDE
                     TGYVKPRSEAFQAALSALGVAPEEALHVGDLPQTDIRGAFATGYPWAVQYVGLREVNG
                     EVRPTAKVKDHRELLSLLE"
     gene            complement(527863..528543)
                     /locus_tag="TCCBUS3UF1_RS02540"
                     /old_locus_tag="TCCBUS3UF1_5260"
     CDS             complement(527863..528543)
                     /locus_tag="TCCBUS3UF1_RS02540"
                     /old_locus_tag="TCCBUS3UF1_5260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_014514934.1"
                     /db_xref="GI:504327832"
                     /translation="MKWAIVRFPGSNCDEDARFALAKAGLEATYVWHTETDLRGFDGI
                     FLPGGFSYGDYLRPGALAAKSPVMAEVRRFAREGRLVIGVCNGFQVLTEAGLLPGALL
                     ANLNLHFTCKEVGVRVERTDLPFTRRYAPGQVLRLPIAHAEGRYYADPETLARLEGEG
                     QVVFRYAPLRGEADPNPNGSLNDIAGIVNEGGNVLGMMPHPERAVDPILGGEDGLPLF
                     LGLLEVAR"
     gene            complement(528540..528794)
                     /locus_tag="TCCBUS3UF1_RS02545"
                     /old_locus_tag="TCCBUS3UF1_5270"
     CDS             complement(528540..528794)
                     /locus_tag="TCCBUS3UF1_RS02545"
                     /old_locus_tag="TCCBUS3UF1_5270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylformylglycinamidine synthase"
                     /protein_id="WP_014514935.1"
                     /db_xref="GI:504327833"
                     /translation="MPRYQATLLIELKDGILDPQGRAVEGVLRGLGHPVDSVRVGKVL
                     EIVFPAENLLQAEEKALTMGRLLANPVMEVFALEALKELP"
     gene            complement(528798..529499)
                     /locus_tag="TCCBUS3UF1_RS02550"
                     /old_locus_tag="TCCBUS3UF1_5280"
     CDS             complement(528798..529499)
                     /locus_tag="TCCBUS3UF1_RS02550"
                     /old_locus_tag="TCCBUS3UF1_5280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012673685.1"
                     /note="catalyzes the formation of
                     (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-
                     carboxamido)succinate from
                     5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate and
                     L-aspartate in purine biosynthesis; SAICAR synthase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole-succinocarboxamide
                     synthase"
                     /protein_id="WP_014514936.1"
                     /db_xref="GI:504327834"
                     /translation="MEKLYEGKAKVLYPEGEDTLRVYFKDEATAFNARKRGLIPGKGV
                     VNNKVSAALFRYLEAHGIRTHFLEEVSEREMRVKRVEILPLEVILRFRAAGSFAKRYG
                     LEEGTPLKGPLVEFSLKNDPLGDPLICPEAILALGLAGEAELEGVRATTLKVGELLKA
                     FFAERGLEVVDFKLEFGRREGEILLADEISPDTMRLWDMETGEPLDKDRFRKDLGGVA
                     EAYQEVLRRVLGEGV"
     gene            complement(529549..530859)
                     /locus_tag="TCCBUS3UF1_RS02555"
                     /old_locus_tag="TCCBUS3UF1_5290"
     CDS             complement(529549..530859)
                     /locus_tag="TCCBUS3UF1_RS02555"
                     /old_locus_tag="TCCBUS3UF1_5290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="WP_014514937.1"
                     /db_xref="GI:504327835"
                     /translation="MVPRYQTPEMARLWSEENRYRTWALVEAYALEAWEALGQVPKGL
                     SARLLDKLAEKPLDRAFAQRVAELEEVTRHDLVAFTRALAEWTGDEEVGRYLHLGLTS
                     SDVVDTAQNALLVEALDLIGEELQGVREALKGLALRYKHTPAIARTHGVHAEPTSFGL
                     RFLSFYAAFGRDEERLRRAKEAIGVAMLSGSVGNYAHVPPEVEAHVARRLGLVPEPIS
                     TQVVPRDRHAEVLAALALLGGNLERVAVELRHLQRTEVLEAQEPFREGQTGSSSMPHK
                     KNPVGLENLTGMARLLRGYLQPALENIALWHERDISHSSVERVVLPDATTAAHYALRR
                     LRGILEGLVVLEANLERNLGLTRGLVYSQQVLNALIAQGLPRDRAYALVQRNALKSFE
                     EGRDFRELLEMDPENPLKGEALGALFSPQAFLRHVDAIYARFGL"
     gene            complement(530863..531453)
                     /locus_tag="TCCBUS3UF1_RS02560"
                     /old_locus_tag="TCCBUS3UF1_5300"
     CDS             complement(530863..531453)
                     /locus_tag="TCCBUS3UF1_RS02560"
                     /old_locus_tag="TCCBUS3UF1_5300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catechol 1,2-dioxygenase"
                     /protein_id="WP_014514938.1"
                     /db_xref="GI:504327836"
                     /translation="MHRRAFLALPLLAWVRAQGGCPPTPALTEGPYWLREVPRRKDLR
                     EGLPGVPLRLGLTLRDRACRPLGGARVDLWHTDALGRYAGVQAPGTFCRGWEVSDPQG
                     RVEFLTLFPGWYPSRTPHLHLRVEAGGQSFATQLFFPEEVQRQVYARPPYAARGLPRV
                     GNRQDGIFRADLLLSLRPEGEGYAAEFPLTLPFGYP"
     gene            complement(531453..532013)
                     /locus_tag="TCCBUS3UF1_RS02565"
                     /old_locus_tag="TCCBUS3UF1_5310"
     CDS             complement(531453..532013)
                     /locus_tag="TCCBUS3UF1_RS02565"
                     /old_locus_tag="TCCBUS3UF1_5310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514939.1"
                     /db_xref="GI:504327837"
                     /translation="MRGWVWVWVLFLPVLAQSFEVAQGEARYRVREQLVQVGITDAVG
                     TTKAVRGQVTLQGGRASGEFVVDLRELRSDQSRRDNYLRQNTLQTDRFPTATFRPKEV
                     RGLPSPLPQSGRFPVQVVGDLTLREATEEVVWEGEAEFKGGEVQVLLKTEFPFEKFRL
                     VQPRVAVVLSVENRIRLEVELTLRRR"
     gene            532099..532758
                     /locus_tag="TCCBUS3UF1_RS02570"
                     /old_locus_tag="TCCBUS3UF1_5320"
     CDS             532099..532758
                     /locus_tag="TCCBUS3UF1_RS02570"
                     /old_locus_tag="TCCBUS3UF1_5320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014514940.1"
                     /db_xref="GI:504327838"
                     /translation="MLRAVLFDVGNTLILASPRFWLLPFLQERGLRPLQDPRPAALAA
                     FRFYEEHHLEARDLERALGLWREFHRRLFLGMGLEAHAEALSQELVENWKNPRFWPVT
                     PGAEATLRALRKRGYLLAVVSNWDATLPEILEVVGLRAYFQHLAVSALSGVAKPDPRL
                     FQEALAALGVAPEEAVHVGDAEADLLGARAAGVRPLLFDPLGENPRALHRLEGVLDYL
                     A"
     gene            532755..533120
                     /locus_tag="TCCBUS3UF1_RS02575"
                     /old_locus_tag="TCCBUS3UF1_5330"
     CDS             532755..533120
                     /locus_tag="TCCBUS3UF1_RS02575"
                     /old_locus_tag="TCCBUS3UF1_5330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="WP_014514941.1"
                     /db_xref="GI:504327839"
                     /translation="MSVRQAIWGEKREAIEASLREVDEDLFRYIRDFAYEEVLARPGL
                     DLKTRELLAITALIALGSPKELATHLEGALRVGAREEEVREAILQSALFLGFPRALAA
                     MKLFHQVLKGRGAPHPGER"
     gene            533092..533772
                     /locus_tag="TCCBUS3UF1_RS02580"
                     /old_locus_tag="TCCBUS3UF1_5340"
     CDS             533092..533772
                     /locus_tag="TCCBUS3UF1_RS02580"
                     /old_locus_tag="TCCBUS3UF1_5340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_041433697.1"
                     /db_xref="GI:752794265"
                     /translation="MVLLTRGKDKALLEKLAALGVEAAEVALLEQVDLPGLARLPGLL
                     REGVDWVAVTSKEGAGRLLWAWEEAGRPPLKVAAVGEGTAGVLAAGGLPPAFLPPRAT
                     AQDLALAFPPAQRVLFVAGDLAGGDLEEGLRVRGVRVERLTVYATRARALGEEEVALL
                     ARAQVAAFFSPSGVRAFARWTERRPKAACIGPVTAREAGALGFPVVEAENPGLEGLLR
                     AILQALGT"
     gene            533809..534987
                     /locus_tag="TCCBUS3UF1_RS02585"
                     /old_locus_tag="TCCBUS3UF1_5350"
     CDS             533809..534987
                     /locus_tag="TCCBUS3UF1_RS02585"
                     /old_locus_tag="TCCBUS3UF1_5350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="WP_014514943.1"
                     /db_xref="GI:504327841"
                     /translation="MALPLYLVGLSHKTAPVEVRERAALDPVVALPVLLRTLGHGVVV
                     STCNRTEIYGVGNPEAAWAFLRGRGVEASHLYLRQGVEALRHLYRVAAGLDSLVVGEA
                     QILGQVREALFLARKHRATEGLLEKAFQSAIALGKRARSETAIGAGAVSVAYAALDLA
                     LAVYGDLTGLKVAVLGAGEMAELFLTHLKAHGVGQVLVVNRTEARARELAERFGGRAY
                     GLKALAEVLRQADLVVASAAAPHYLVRPEDLPRRAKPLFLIDIALPRNIHPAVGRLPH
                     AYLYNLDDLERVVEKNLRARQGEIPKVEALVEGALADYLEWYAGHRVREAIRALEAWA
                     LKEAVRDLPQADPATWQKEAGRRAHPWILAVKARAKDFLQGPPCPEGCPLLAFRPSRP
                     "
     gene            534984..535736
                     /locus_tag="TCCBUS3UF1_RS02590"
                     /old_locus_tag="TCCBUS3UF1_5360"
     CDS             534984..535736
                     /locus_tag="TCCBUS3UF1_RS02590"
                     /old_locus_tag="TCCBUS3UF1_5360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C assembly protein"
                     /protein_id="WP_014514944.1"
                     /db_xref="GI:504327842"
                     /translation="MTPATLLALAGVLFLASGLSWPRGLLWGALLYLGAALADALAKG
                     PLSGPAQVALLLGGLLALRGETLFLRPRLSPLRRYLVLLALLLGLFALKALPHPGGGL
                     PLALTLLHGGAFVVAYLALAVGVGAGVMCGLQDRWLRLAPERAVRAAPLWSLRRLERG
                     YLKVGYLATTLGLGSGMAWAWGYFGSPLALDPKEVSVLLGWLLLTLYFLLEERLRGYG
                     RVGWLLLAYALLLFAFLGAPFLGSRHPSRLSL"
     gene            535801..535998
                     /locus_tag="TCCBUS3UF1_RS02595"
                     /old_locus_tag="TCCBUS3UF1_5370"
     CDS             535801..535998
                     /locus_tag="TCCBUS3UF1_RS02595"
                     /old_locus_tag="TCCBUS3UF1_5370"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514945.1"
                     /db_xref="GI:504327843"
                     /translation="MGHPLEAEEAVKARVEALRAEAERERLLRLVQVPWRRRLALYLR
                     RLAARLEGEAQGFPLGMGYGG"
     gene            536001..536372
                     /locus_tag="TCCBUS3UF1_RS02600"
                     /old_locus_tag="TCCBUS3UF1_5380"
     CDS             536001..536372
                     /locus_tag="TCCBUS3UF1_RS02600"
                     /old_locus_tag="TCCBUS3UF1_5380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514946.1"
                     /db_xref="GI:504327844"
                     /translation="MEEKRRILQMVQAGEIGVEEALALLGALEGARPPARVPARLLRV
                     LVQGWDEGKPLKVQVNLPLALADLVEGFLPEEAKLAMGKSGVNLKDLLSRVREGLPEG
                     KLVEVEAEEEEGPIRVLVEVV"
     gene            536369..536629
                     /locus_tag="TCCBUS3UF1_RS02605"
                     /old_locus_tag="TCCBUS3UF1_5390"
     CDS             536369..536629
                     /locus_tag="TCCBUS3UF1_RS02605"
                     /old_locus_tag="TCCBUS3UF1_5390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514947.1"
                     /db_xref="GI:504327845"
                     /translation="MRAPWRPRFLYLWVRGPWALPLLLFLPLSALEWGLALLLFLKKG
                     QALFRGRPFPVPWRAFLALRLLPPTVLVAVEAEKVEVKVALW"
     gene            536623..537000
                     /locus_tag="TCCBUS3UF1_RS02610"
                     /old_locus_tag="TCCBUS3UF1_5400"
     CDS             536623..537000
                     /locus_tag="TCCBUS3UF1_RS02610"
                     /old_locus_tag="TCCBUS3UF1_5400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433699.1"
                     /db_xref="GI:752794267"
                     /translation="MVRKNLPVRCPACEGPLGVKVLFCPACGTEVAGQFPLHEFALLP
                     KEHLDFLRLFVKARGNLKEVERILGVSYPTVRARLDALLRVLGYEVEEEGEPEARLAV
                     LEALRRGEISLEEAVARLREGRS"
     gene            complement(536954..538360)
                     /locus_tag="TCCBUS3UF1_RS02615"
                     /old_locus_tag="TCCBUS3UF1_5410"
     CDS             complement(536954..538360)
                     /locus_tag="TCCBUS3UF1_RS02615"
                     /old_locus_tag="TCCBUS3UF1_5410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014514949.1"
                     /db_xref="GI:504327847"
                     /translation="MTLRSRITFLTAGLLLATLLALGLALEGLLRSFLYRSLREELQE
                     ASNQVVRLLNLGGQALLEAGLPASLYAEVQLLPEENPTLLSQEGGISLQKSPALGSQR
                     LLLPEAGYKALLEGGEAWTYAELPREGPPLRLLVYARRVEVSLSGTVWKGALLVGRPV
                     EDLEKTLVQFTRIYAGTALLALLLSILLARNLVARALEPLEWVARRAEAITERPEPLP
                     EPEGRDEVASLVRALNGMLSRMQKAFEAQTRFLQDASHELRTPLTAILGHVGYLLRRT
                     PLTAAQRESLEVVKREAERMGKLVSDLLELSQSGSWRMEPVPVRVLDLLEEVREEFAK
                     SLEGEIVVEAPPELFVRGDPDRLHQVLANLLTNALKAGARHVWLRAFDLGEKVVVRVE
                     DDGEGIPKEHLPHLFERFYRVDKARDRERGGSGLGLAIVKAILEAHGGEIWVESEVGR
                     GTAFSFSLPASGPPPPPG"
     gene            complement(538370..539044)
                     /locus_tag="TCCBUS3UF1_RS02620"
                     /old_locus_tag="TCCBUS3UF1_5420"
     CDS             complement(538370..539044)
                     /locus_tag="TCCBUS3UF1_RS02620"
                     /old_locus_tag="TCCBUS3UF1_5420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014514950.1"
                     /db_xref="GI:504327848"
                     /translation="MEPPLILIVEDEKDIARFIELELQAEGYRTEVAHDGITGLSRFR
                     EVNPNLVILDLMLPVMDGIEVAKRIRKTSNVPILILTAKDRVEDKVEGLDAGADDYLV
                     KPFSIEELLARVRAHLRRVSPAITGEIRVADLIINLEGREVFRSGRRIELSNKEFELL
                     ELLAKNPGKVFSRYEIEEKVWPGYQGGSNVVDVYIGYLRKKLEAGGERRLIHTVRGVG
                     YVLRED"
     gene            complement(539077..539694)
                     /locus_tag="TCCBUS3UF1_RS02625"
                     /old_locus_tag="TCCBUS3UF1_5430"
     CDS             complement(539077..539694)
                     /locus_tag="TCCBUS3UF1_RS02625"
                     /old_locus_tag="TCCBUS3UF1_5430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_014514951.1"
                     /db_xref="GI:504327849"
                     /translation="MVREPFNALSHALGVPLALLGTALFLLLAPKEAWPALLTFGLTM
                     ALTFGASALYHALRVGEKTLAWLRRLDHAAIFLFIAGSYTPFLAEGLSQGLRPFALGL
                     VWGLALLGVGFRLFFLKAPRWLYTLAYLGLGWLSVLFLPRLELPFPTFVLMAASGVFY
                     TLGALVYGKKRPDPWPGRVGFHGLWHLLVLLGSFLMYLAVLSLYT"
     gene            complement(539708..542098)
                     /locus_tag="TCCBUS3UF1_RS02630"
                     /old_locus_tag="TCCBUS3UF1_5440"
     CDS             complement(539708..542098)
                     /locus_tag="TCCBUS3UF1_RS02630"
                     /old_locus_tag="TCCBUS3UF1_5440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514952.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="WP_014514952.1"
                     /db_xref="GI:504327850"
                     /translation="MRWVRFFHEVGLEDVPLVGGKNASLGEMIRELSPLGVRVPGGFA
                     TTSEAYWYFLERNGLKEAIAQTLKEGDLEDPKTLQRASRQLRNLILRGAYPPDLEEEI
                     RLAYRRLSQEAGEEALPVAVRSSATAEDLPTASFAGQQESYLYVQGEEDLLLHVKQAM
                     ASLFTARAISYRAHMGFDHLKVALSVGVQRMVRADTAASGVIFTLDPDTGHPGFVYLT
                     AIWGLGENIVQGRVGPDGYYVHKETLKAGYKALVYKRLGSKELTLAFDPKEGRLKNRP
                     TPPYLRNQFALQDEEALLLADWSLKIEAHYTEKRGAPTPMDIEWAKDGVTGELFILQA
                     RPETVHSQKRPVLRIHRLLARGEVLAEGLAVGEAIAAGRARILRDPKEMDRFQEGEVL
                     VTETTNPDWEPIMKRAAAIVTERGGRTSHAAIVARELGVPAVVGAVGATRLIPDGEKV
                     TVSCAEGETGRVYRGELPFAVEEIRPEALPRTRTRIMVNVGTPDEALRASLLPTDGVG
                     LLRMEFVFASHVRVHPLALTRFPSLPKEVQRQVEEVTEAYADKRAYFVDTLAQGIGLI
                     AAAFYPRPVLLRFSDFKTNEYARLLGGHLFEPKEENPMLGWRGASRYYHPEYKEGFLL
                     EVAAVKKVREEMGLKNLMVMVPFCRTPEEGQRVLEVMAEGGLRRGEGGLEVYVMAEIP
                     SNILEAEAFCELFDGFSIGSNDLTQLALGLDRDSERVASLFDERRPTVKALCALLIEK
                     AHARGKKVGICGQAPSDYPEFAAFLVERGIDSISLNPDALLRTVAKVAELEAVLGR"
     gene            complement(542095..543003)
                     /locus_tag="TCCBUS3UF1_RS02635"
                     /old_locus_tag="TCCBUS3UF1_5450"
     CDS             complement(542095..543003)
                     /locus_tag="TCCBUS3UF1_RS02635"
                     /old_locus_tag="TCCBUS3UF1_5450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014514953.1"
                     /db_xref="GI:504327851"
                     /translation="MAESLPQALSRLQAALHGVLFGQEAAIEALLATLLARGHALLEG
                     VPGLGKTLLAESFARGSGLSYKRIQFTPDLLPQDLTGSEVFREGRFVFLPGPIFAQVV
                     LADEINRAPPKVQSALLEAMQERAVTAGGVRHPLPEPFFVVATQNPLELEGTYPLPEA
                     QLDRFAAKIPFRPPRREVWLRILTEEPRPPEPLEVDFLQAQREAGEVRVAKEALEAIT
                     HVAFLTGEDRRLRMGLSPRGAKAWLALAKALAYLRGKPLVDWKELKDAAFLALPHRLF
                     LTEEALYEGETAEGVLKEVLRKGGVP"
     gene            complement(543025..545022)
                     /locus_tag="TCCBUS3UF1_RS02640"
                     /old_locus_tag="TCCBUS3UF1_5460"
     CDS             complement(543025..545022)
                     /locus_tag="TCCBUS3UF1_RS02640"
                     /old_locus_tag="TCCBUS3UF1_5460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_014514954.1"
                     /db_xref="GI:504327852"
                     /translation="MIQTGRTRTVALVGHAGSGKTTLTEALLYKTGAKERMGRVEDGT
                     TTTDYTPEAKLHRTTVRTGVAPLRHQGHRIFLLDAPGYGDFVGEIRGALEAADAAMVA
                     VSAEAGVQVGTERAWTVAERLGLPRMVVVTKLDKGGDYYALLEDLRATLGPILPIDLP
                     LYEGGRWVGLMDVFHQKAYRYQGGQEVEVPVPEAEGERVRRFRQEVLEAIVETDEGLL
                     EKYLEGEEVTGEALEKAFHEAVRQGLLYPVALASGTEGIGILPLLDLILEALPSPGER
                     FGEGPALGKVFKVQVDPFMGQVAYVRLYRGRLRPGDTLLSEAGPVRLPHLYVPMGKDL
                     LEVEEAEGGYILGLPKAEALHRGMVLWQGERPESEAVPFARLPEPNVPVAIRPKGRTD
                     EAKLGEALRKLLEEDPSLKLERQEETGELLLWGHGELHLATAKERLADYGVEVEFSVP
                     KVPYRETIRKVAEGQGKYKKQTGGHGQYGDVWLRLEPAPEYSFEWRITGGVIPSKYQE
                     AIEEGILEAAKKGVLAGYPVMGFKAIVYNGSYHEVDSSDLAFQIAASMAFKKVMEQAG
                     PVLLEPIYQIKVVAPQERVGDILSDLQARRGRILGMEQEGALSAVRAEVPLSEVLEYY
                     KALPSLTGGAGAYTLEFSHYAEVPPHLAQRIVQERKAAEGQ"
     gene            545070..545453
                     /locus_tag="TCCBUS3UF1_RS02645"
                     /old_locus_tag="TCCBUS3UF1_5470"
     CDS             545070..545453
                     /locus_tag="TCCBUS3UF1_RS02645"
                     /old_locus_tag="TCCBUS3UF1_5470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Metal-dependent protease of the PAD1/JAB1
                     superfamily"
                     /protein_id="WP_014514955.1"
                     /db_xref="GI:504327853"
                     /translation="MSQVLYVPRNLLAQTRAHLLREAPREGVGLWAGRREVERVLPLP
                     NAHPEPLTGYLAEPLALLRALKEVEREGLSLLAIYHSHPQGPALPSPRDIREARWRVP
                     YVIFGTDGVRAFLLPEGREVGLVLL"
     gene            complement(545494..546285)
                     /locus_tag="TCCBUS3UF1_RS02650"
                     /old_locus_tag="TCCBUS3UF1_5480"
     CDS             complement(545494..546285)
                     /locus_tag="TCCBUS3UF1_RS02650"
                     /old_locus_tag="TCCBUS3UF1_5480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol phosphate phosphatase"
                     /protein_id="WP_041433949.1"
                     /db_xref="GI:752794518"
                     /translation="MGRKHPFFPHLEAMLEAAHLARGIHAYYLERGFTQGTKSGPTDL
                     VTQADREAEEAIKDLLLSRFPEAGFLGEEGGSAGGKALRFIVDPLDGTVNYAHGFPFY
                     GVSLALEVGGAVQVGVVMDTARGEAFYAVRGEGAYLGGRPLRVTERGELLGSLLATGF
                     PYDVAKDPENLTYFSRALRKGLLVRRPGAAALDLAYVAAGRLDGFWEVKLNPWDVAAG
                     WLLVEEAGGKVTDLEGQPYRLGHRYILASNGRIHEALRRTLLGQD"
     gene            complement(546296..546895)
                     /locus_tag="TCCBUS3UF1_RS02655"
                     /old_locus_tag="TCCBUS3UF1_5490"
     CDS             complement(546296..546895)
                     /locus_tag="TCCBUS3UF1_RS02655"
                     /old_locus_tag="TCCBUS3UF1_5490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-(5'-phosphoribosyl)anthranilate isomerase"
                     /protein_id="WP_041433950.1"
                     /db_xref="GI:752794519"
                     /translation="MRVKVCGLTRLEDALLAEALGAFALGFVFAPGSPRRLEPEAARA
                     ISKALGPMVVRVGVFRDQGPEEVLRTLEEARLQVAQLHGAEPPEWAERVGRFFPVIKA
                     FPLEGPAREEWADYPAQALLLDSRAPGSGKAYPREWALPLLRTGRRVILAGGITPENV
                     GEVLSLSPYALDLASGVEEAPGVKSPARLRALFARVRGV"
     gene            complement(546924..549854)
                     /locus_tag="TCCBUS3UF1_RS02660"
                     /old_locus_tag="TCCBUS3UF1_5500"
     CDS             complement(546924..549854)
                     /locus_tag="TCCBUS3UF1_RS02660"
                     /old_locus_tag="TCCBUS3UF1_5500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="WP_014514958.1"
                     /db_xref="GI:504327856"
                     /translation="MERHFFDEHAQAIAKRQYLQPGDGDILGMFRRVAREVARVERPE
                     ERALWEERFFELMASKRFSPGGRILAGAGTPHGNLLNCFVQGATENPPESFAGIMEVA
                     KKLALVTKVGGGNGVNLDPYRSKGDRQRRPVRGVAYLAASHPDVEDFIRGLMRPPTNP
                     DGPKEEITLKNFVRVVYGELPPELKALAERYGVLTVKEPPEERILVPDDMGGIVEAAK
                     EAADLARKGKEPQVDFSLLRPEGAPIRGSGGTSSGPVSFLFELFDHFLEWAALGAEAA
                     GPVATLRYVYAPVLRVVRQGGTRRGAGMATLSIDHPDLLDFLTAKDLDREKAEGDIST
                     FNISVLVTDAFMEALEADALWPVTPVEVPGKYYPHPLEGPYSGRIPDLPERADGAKPI
                     PLFGGQVPARWLWHEIAWHAWATGEPGLIFIDRVNALSALKGLGPQYEIRSTNPCGEI
                     PLTVGEPCDLGALNLAAYVEDGEFQMEAFRQDVKTAVRFLDNVLDVNKFALPDNEAAA
                     KRLRRLGLGVMGLADALIKMGLPYASEAAREKVYEIISAMREEAIRASEELARERGPF
                     PLYEAHREHFARLGVRPRRNVALLTVAPTGTTSMLMGVSSGIEPVFSPFVWRRIGGEY
                     KPLLHPLFVELLEAYPPAFGFERDGKWDWDKVVEEIQRDGHGSVQGLPFVPEAIRKVF
                     QCAHDISPLDHVRMQGAVQRAFDAEGLAGNSLSKTINLPHEATVLDVEAAYAEAYRTG
                     CKGITVYRDGSREFQVLTVKKEEAKGQGEDTPQAKAQEVKGVAEAQEHPPAPQGVAPG
                     KPQGQPTYERPGRLLGFTDMVKLLSPDGSKRSFLVTVNMLGDRPIEVILTSGKAGDEA
                     NADSEALGRVVSIALQYGVPPEALIRTLRGINGGLYGTYQGRLVSSKADLIAVALETV
                     PEAFKGTPRAPGGEEVEKALPTLSGGGLSLPGASPCPACGEKALVREEGCWNCQACGY
                     SKCG"
     gene            549996..551303
                     /locus_tag="TCCBUS3UF1_RS02665"
                     /old_locus_tag="TCCBUS3UF1_5520"
     CDS             549996..551303
                     /locus_tag="TCCBUS3UF1_RS02665"
                     /old_locus_tag="TCCBUS3UF1_5520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modifying enzyme"
                     /protein_id="WP_041433701.1"
                     /db_xref="GI:752794269"
                     /translation="MRAAFRTLGCKVNQVETEALLAFLKALEPEVVPLEAGADLVVIN
                     TCAVTTTAEADARKEIRRARRANPGAFIVVTGCYAELSPEQIRELGADAVVPNSRKAE
                     LPRVILERFGLPSDPITTPPNEFWGAGERGLLNSRVRAFLKVQDGCQAGCAYCIIPRL
                     RGKERHRDYRDALAEAEALLRLGIREIVLTGVRLGSYRGHPRGLAGLVEDLRALGAKV
                     RLSSIEPEDTGEDLLRVIARHAPEVRPHLHLSLQTGSDRLLRLMGRRYDKAYYRNLVQ
                     RAYALIPGFALTTDVIAGLPTETEEEHRETLAFLEELRPTRVHAFTYTPRPKTRAASL
                     PQVPLEVRKRRTKELIALAQALAEARLRPKLGGQVEVLVERIQEGLALGHTPDYYEAR
                     LAGPARPGETVWAQVEGVEGYTLLGRVVGVKEEASAPLELPLR"
     gene            551313..551636
                     /locus_tag="TCCBUS3UF1_RS02670"
                     /old_locus_tag="TCCBUS3UF1_5530"
     CDS             551313..551636
                     /locus_tag="TCCBUS3UF1_RS02670"
                     /old_locus_tag="TCCBUS3UF1_5530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter"
                     /protein_id="WP_014514961.1"
                     /db_xref="GI:504327859"
                     /translation="MDCVFCRIIRGELPSRKVYEDEGFVAFHDIRPKAPVHVLVVPKE
                     HVAKLSDYPDTPEGEKKLGALFRTANRVARELGLEGYKLQVHVGEKGGQEVFHVHVHV
                     MGSPA"
     gene            complement(551617..552378)
                     /locus_tag="TCCBUS3UF1_RS02675"
                     /old_locus_tag="TCCBUS3UF1_5540"
     CDS             complement(551617..552378)
                     /locus_tag="TCCBUS3UF1_RS02675"
                     /old_locus_tag="TCCBUS3UF1_5540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase"
                     /protein_id="WP_014514962.1"
                     /db_xref="GI:504327860"
                     /translation="MRLLALLLSLLLPGAWAQRLGVIGDWGSSTPGRAQVAALLRQEH
                     AQRPLMALLTTGDNFYPKGEVVEGFLRQLPPVPLYPAFGNHDAPSLGAQLRRFRLERP
                     YYRVRLGAGEFFFFYTEAGVREQREWLAQALASSQAPWKVLVLHRPLYSMGWPSPSLR
                     ALLEPLLLGHGVRLVLAGHDHHYARILAKGIQHVTTGGGGARLYPVFPKPMAQAWAVA
                     HHAFFLEVDERSLVGYALDTEGRLLDRFALRQENP"
     gene            complement(552378..552806)
                     /locus_tag="TCCBUS3UF1_RS02680"
                     /old_locus_tag="TCCBUS3UF1_5550"
     CDS             complement(552378..552806)
                     /locus_tag="TCCBUS3UF1_RS02680"
                     /old_locus_tag="TCCBUS3UF1_5550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008633255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514963.1"
                     /db_xref="GI:504327861"
                     /translation="MLSAKIETLGVDPQNGSVVVLLRTENDKLLPIVIGPLEAHHIVV
                     ALQGEKPPRPLTPDLLLSVMDMLQGKLQRVEITDLHDGTFYARLILEHRGIELEVDAR
                     PSDAMALALRVGAPILVAEEVVEKAGVEEASLKPHGAAEA"
     gene            552845..553366
                     /locus_tag="TCCBUS3UF1_RS02685"
                     /old_locus_tag="TCCBUS3UF1_5560"
     CDS             552845..553366
                     /locus_tag="TCCBUS3UF1_RS02685"
                     /old_locus_tag="TCCBUS3UF1_5560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718015.1"
                     /note="Catalyzes a salvage reaction resulting in the
                     formation of AMP, that is energically less costly than de
                     novo synthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_014514964.1"
                     /db_xref="GI:504327862"
                     /translation="MEIAGVRRDLPIVQVGPDVAVALLNLLGDTELTEAAAEALAQRL
                     PPEVETLVTPEVKAVPLAHALSRVTGRPYVVARKTEKPYMINPVSRQVLSITTGKPQL
                     LVLDGADIPLIRGRKVAIVDDVVSTGSTLSGLRELIESVGGQVVAVLAVFTEGTPRQD
                     VIALGHLPLFKPE"
     gene            553376..553903
                     /locus_tag="TCCBUS3UF1_RS02690"
                     /old_locus_tag="TCCBUS3UF1_5570"
     CDS             553376..553903
                     /locus_tag="TCCBUS3UF1_RS02690"
                     /old_locus_tag="TCCBUS3UF1_5570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015718014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_014514965.1"
                     /db_xref="GI:504327863"
                     /translation="METYPISIGGVTRHVPLIEPLPGRRIPLVEFLGDPELVRAAARA
                     LRPLVPQGTEVLFTTETSPIPLTHVLAEEMGLPYVVARRRRRPYMEDPIIQEVQTLTL
                     GVGEVLWLDRRFAERLLNQKVTLISDVVSSGETMKAMERMVLRAGGRVVGRLAAFRQG
                     GPSLDVVTVAELPVL"
     gene            complement(553875..554486)
                     /locus_tag="TCCBUS3UF1_RS02695"
                     /old_locus_tag="TCCBUS3UF1_5580"
     CDS             complement(553875..554486)
                     /locus_tag="TCCBUS3UF1_RS02695"
                     /old_locus_tag="TCCBUS3UF1_5580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_014514966.1"
                     /db_xref="GI:504327864"
                     /translation="MRGALLDRDGVLLLMDEEALYQKALELALYGAGLEKTLAVLARA
                     VREVGEAVRGLRVRTLEEEARFWEELVLEASRELGVPPGKLLPLRYYHFFRKAPGAEA
                     LLRTLRARGLRIGVLSNTLPSLRESLAYHGLDAHVDGFFASCALGVAKPDPQAFLLAL
                     EGLGLAPGETLYLDDDPENVETARRLGLRAAVYAVTGPGVPPP"
     gene            complement(554524..555045)
                     /locus_tag="TCCBUS3UF1_RS02700"
                     /old_locus_tag="TCCBUS3UF1_5590"
     CDS             complement(554524..555045)
                     /locus_tag="TCCBUS3UF1_RS02700"
                     /old_locus_tag="TCCBUS3UF1_5590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_014514967.1"
                     /db_xref="GI:504327865"
                     /translation="MDKPTLRRRFLEVWRTLDREGLSRKVVAALLPWLRTRRFRHILL
                     YHPLPHELDLLLLRTLYPAHYYLPKVAGQGLTVHPFGPLAPGPFRLREPTTEAVDPGV
                     LDLVVVPGLAFDREGYRLGHGQGYYDRFLASVAAETVGVVPKALLLPWLPRDPWDVPV
                     AHLATEEGVGRAG"
     gene            555122..555349
                     /locus_tag="TCCBUS3UF1_RS02705"
                     /old_locus_tag="TCCBUS3UF1_5600"
     CDS             555122..555349
                     /locus_tag="TCCBUS3UF1_RS02705"
                     /old_locus_tag="TCCBUS3UF1_5600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FmdB family transcriptional regulator"
                     /protein_id="WP_014514968.1"
                     /db_xref="GI:504327866"
                     /translation="MPVYVYKGLQTGNYYEFEQGFHDEPLKAHPETGEPLKRVITPPA
                     IIFKGSGWHVKDYAKKDTGKSEGGESKGDKE"
     gene            555403..556338
                     /locus_tag="TCCBUS3UF1_RS02710"
                     /old_locus_tag="TCCBUS3UF1_5610"
     CDS             555403..556338
                     /locus_tag="TCCBUS3UF1_RS02710"
                     /old_locus_tag="TCCBUS3UF1_5610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514969.1"
                     /db_xref="GI:504327867"
                     /translation="MLNLAALALLLLGVGVLFTPRRRLGLPLLGLGLLLLLLANSFVV
                     VPAGHVGVVFNILRGVQERALGEGVHFVLPGLQQVILYDARVQEVTLSAPHEGERRAD
                     TSIRARSKEGLEIGVDVTVQYRILKEEAPRLHQEVGPGFLETLIVPQVRSKVRDAVGQ
                     YGAAELISTQRAALETSVIQGLEATLRQYHIALISVLLREIRIPETVAKVIEEKQTAE
                     QQVQIEINRRKQAEIAAERRVIEAKGERDAAILRAEGEARAIELRGRALKNAPEVVQL
                     TFAEKLAPGVQTVFVPSTGNFLLDLRGLSGGQPAR"
     gene            complement(556335..556784)
                     /locus_tag="TCCBUS3UF1_RS02715"
                     /old_locus_tag="TCCBUS3UF1_5620"
     CDS             complement(556335..556784)
                     /locus_tag="TCCBUS3UF1_RS02715"
                     /old_locus_tag="TCCBUS3UF1_5620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514970.1"
                     /db_xref="GI:504327868"
                     /translation="MERNPLFPLAAFALLILLSVFAFLGYLLAARRFQTPPAPQRVVV
                     ETREGTHSLRARLARTPEAWSRGLGVRQEALEALLYLFPQATDAPFSAEGYRFPVVVA
                     FLDGEGRVLKVVRLAPGETHAPGTAYRGVLEVREGLLRLAPGDRVLP"
     gene            complement(556784..557239)
                     /locus_tag="TCCBUS3UF1_RS02720"
                     /old_locus_tag="TCCBUS3UF1_5630"
     CDS             complement(556784..557239)
                     /locus_tag="TCCBUS3UF1_RS02720"
                     /old_locus_tag="TCCBUS3UF1_5630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514971.1"
                     /db_xref="GI:504327869"
                     /translation="MRPLAFALLLGLLALAQGLTFPRSTLQVVQGEKRYPLRVEVADT
                     PERQAQGLMFRKALGEEEGMVFLFSSPTAGGFWMKNTLIPLSIAFFDRQGTILRILDM
                     EPCRADPCPVYYPGVVYQGALEVNRGWFQRRGLTPGAKVEGEALKLWPR"
     gene            complement(557247..557852)
                     /locus_tag="TCCBUS3UF1_RS02725"
                     /old_locus_tag="TCCBUS3UF1_5640"
     CDS             complement(557247..557852)
                     /locus_tag="TCCBUS3UF1_RS02725"
                     /old_locus_tag="TCCBUS3UF1_5640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate kinase"
                     /protein_id="WP_014514972.1"
                     /db_xref="GI:504327870"
                     /translation="MAGLFLTLEGLDGAGKSTQASLLARFLEAQGLRVRLTREPGGGL
                     PGVRPLLLRAGQGELSPQAEYLLFSADRAEHVRKVILPALEGGEWVVSDRYLDSSLAY
                     QGFGRGLPLPWLLEVAKEATLGLKPRRTFLLDLPPEEALARLKDKDRMERMGLAFFQR
                     VREGYLGLARAEPERFVVLDATRPVAEVQAAIQEALRPLLP"
     gene            complement(557857..558585)
                     /locus_tag="TCCBUS3UF1_RS02730"
                     /old_locus_tag="TCCBUS3UF1_5650"
     CDS             complement(557857..558585)
                     /locus_tag="TCCBUS3UF1_RS02730"
                     /old_locus_tag="TCCBUS3UF1_5650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514973.1"
                     /db_xref="GI:504327871"
                     /translation="MERDALVRYLNAYLRLQDFPQDPSLNGLQVEGKGEVTKVGAAVD
                     AGEAIFQKALEEGVDFLLVHHGLFWGRPFPITGHHKRRLELLFRGGINLYAAHLPLDA
                     HPEVGNNHELARALGLGDLEPYDVGVKGRFPFPTPLVQVADRLGQLTGMQPLVHQGGA
                     DTVVEVVIVSGGAAGLVGRVEADLFITGEPKHSVFHETFERGLNVIYAGHYDTEVFGV
                     KALARHLEARFGLPWVFLDHPTGL"
     gene            558648..560456
                     /locus_tag="TCCBUS3UF1_RS02735"
                     /old_locus_tag="TCCBUS3UF1_5660"
     CDS             558648..560456
                     /locus_tag="TCCBUS3UF1_RS02735"
                     /old_locus_tag="TCCBUS3UF1_5660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_014514974.1"
                     /db_xref="GI:504327872"
                     /translation="MGPEVLLKVRFLSDLTEGPEGLPLFLLTEIQEGEPPKYLSRLAL
                     FDGALRFLTQEEARKPRYAHPYVYFLRRVGEVQELFRLDLRGGEAERLTQTAGVLDYA
                     LGPEGQVAFLALKEAPKPGLPRTFSGWPFKLDGRGLLPEGQVALYLLHGGEVRLLLDR
                     YPAPKEMVFAPEGLYLVMPEDPQAQAGWRDTLYRLREGGLEKVWGGVGPIFALEWSPE
                     GLFFLGHAFERGGGTEARLYHLRDGGVRVLLEGSLQNSVNADLRFGAHFQGPKWTEEG
                     VYLVRTEGGEGRLYRVGLDGQAEALSASGSVLAFARTPKGLFLLTEDFTRPARLEGPL
                     GVYDPNEGLSLPLAEPQATAWQSPEGHRVPGWVLLPEGEGPHPVILYIHGGPHTAFGR
                     APMLEFALYRQAGYAVAFANPRGSTGYGQDFALLEGAWGERDERDLLGFLDHVLAHFP
                     LDPERVGVAGGSYGGYMTNWLTARHPGRFKAAVTDRSICNWLSFFGASDIGPRFTYLE
                     LFAKPWERPEVLWEKSPLRYVHQVRTPTLVVHAEGDHRCPMDQGETWYTALWHLGVKT
                     RFLRVPEEGHELSRSGRPDRRLARLRAYLDWWRENL"
     gene            complement(560499..560765)
                     /locus_tag="TCCBUS3UF1_RS02740"
                     /old_locus_tag="TCCBUS3UF1_5670"
     CDS             complement(560499..560765)
                     /locus_tag="TCCBUS3UF1_RS02740"
                     /old_locus_tag="TCCBUS3UF1_5670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514975.1"
                     /db_xref="GI:504327873"
                     /translation="MTEMKLDIQIDKDTALGRYTNLALIAHTKNEFILDFALLQPQGG
                     AMVVSRVITSPQHAKALLRSLAENVARYEETFGPIPEPVAEGQA"
     gene            complement(560762..561109)
                     /locus_tag="TCCBUS3UF1_RS02745"
                     /old_locus_tag="TCCBUS3UF1_5680"
     CDS             complement(560762..561109)
                     /locus_tag="TCCBUS3UF1_RS02745"
                     /old_locus_tag="TCCBUS3UF1_5680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dynein regulation protein LC7"
                     /protein_id="WP_014514976.1"
                     /db_xref="GI:504327874"
                     /translation="MDEILKELKETRGVRAVALLSEEGFVVEEVREEGAPEATLLSAR
                     AATVLGTAKALAQSLNQEAVEEIMVEYPEGALLLVPLSGHHLLLFLDGVKSLGRVRLA
                     LKKALPKIEEALA"
     gene            complement(561124..561453)
                     /locus_tag="TCCBUS3UF1_RS02750"
                     /old_locus_tag="TCCBUS3UF1_5690"
     CDS             complement(561124..561453)
                     /locus_tag="TCCBUS3UF1_RS02750"
                     /old_locus_tag="TCCBUS3UF1_5690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514977.1"
                     /db_xref="GI:504327875"
                     /translation="MAYLESLAALGVRRAVLTGLDGLVIEALGRGSPPAEVLAAELAS
                     VVRHLTPLAEALSGEVRRFTLATEQQELLALKVGEYLLGAVLERGMDRKAVGQELSRI
                     ALKIQNL"
     gene            complement(561441..561827)
                     /locus_tag="TCCBUS3UF1_RS02755"
                     /old_locus_tag="TCCBUS3UF1_5700"
     CDS             complement(561441..561827)
                     /locus_tag="TCCBUS3UF1_RS02755"
                     /old_locus_tag="TCCBUS3UF1_5700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514978.1"
                     /db_xref="GI:504327876"
                     /translation="MEELLQSLLDRVEGSFAAALGTLDGLLVEGVRRRRVDLEAAIAE
                     HAALLRQAGRAYAGALGSPQIQELLVVGHPVVGYARMARATPGLTPQESLFLLVLMGP
                     EANLGQARLQATQVAERLAEVTGWLT"
     gene            complement(561831..562415)
                     /locus_tag="TCCBUS3UF1_RS02760"
                     /old_locus_tag="TCCBUS3UF1_5710"
     CDS             complement(561831..562415)
                     /locus_tag="TCCBUS3UF1_RS02760"
                     /old_locus_tag="TCCBUS3UF1_5710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecR"
                     /protein_id="WP_014514979.1"
                     /db_xref="GI:504327877"
                     /translation="MRYPERLLKLARALSRLPGIGPKTAQKLSLHLAFHREEAGELRE
                     ALAGLEALGLCRVCGNLAEGELCPICQDEGRDRGLLAVVESVADLFALERSGEFPGVY
                     HVLGGALNPLEGVGPRELNLESLWPRLAGVREVVLATSMTVEGEATALYLAEELKRRG
                     VKATRLAYGLPVGGSLEYVDEVTLGRALEGRKPI"
     gene            complement(562417..562734)
                     /locus_tag="TCCBUS3UF1_RS02765"
     CDS             complement(562417..562734)
                     /locus_tag="TCCBUS3UF1_RS02765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019551544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid-associated protein DR_0199"
                     /protein_id="WP_041433704.1"
                     /db_xref="GI:752794272"
                     /translation="MNLQKLLKEAQKAQKKAAEIQERLETLTVVGTAQGLVEVEANGH
                     GKILAVRLKPEVLEAFRDDLEGLEDLLLVAIQDAQKKAHELSEKEMSRELGGVGQMLG
                     KLF"
     gene            562765..563745
                     /locus_tag="TCCBUS3UF1_RS02770"
     CDS             562765..563745
                     /locus_tag="TCCBUS3UF1_RS02770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="WP_041433706.1"
                     /db_xref="GI:752794274"
                     /translation="MERPRRLRSPLLRRLVAEVDLSPRHLILPLFVKEGGEPEEVASM
                     PGVFRHPLSRLPQVGEAALEAGLGGVILFGVLPEEAKDPWGQGAYAEEGVVQRAIRLL
                     KEAFPELLVLADTCLCEYTDHGHCGVVRQGPLGFYVDNDATLDLLAKTALSQAQAGAD
                     VVAPSAMMDGQVQAIRQALDQGGFPHVPILSYAVKYASAFYGPFREAAASAPQFGDRS
                     GYQMDPRAGLWDALREARLDDLEGADLLMVKPALPYLDVLHALRERFAKPLFAYQVSG
                     EYAMLKAAALRGWLEERRAVLESLYALRRAGAQGILTYYALEAARWLKEG"
     gene            complement(563742..564944)
                     /locus_tag="TCCBUS3UF1_RS02775"
                     /old_locus_tag="TCCBUS3UF1_5730"
     CDS             complement(563742..564944)
                     /locus_tag="TCCBUS3UF1_RS02775"
                     /old_locus_tag="TCCBUS3UF1_5730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_014514981.1"
                     /db_xref="GI:504327879"
                     /translation="MKALRHPAFARLILSYLVSQAGSKIHRVALLVLVYLLTENALWV
                     SLVLGVQLLGTVVFSPLLSAWADTQDRKALLVWSDLLRAPLVALIPLLGAKSLPALLL
                     LVFLIELLRDLHDPIQNAVVPDLVPKEEVDEANSLILLADRLSEVLFVGAAGVLVAAV
                     GPAFAFYLDAITYLASGLILMGLPPLKPDHIPKAGFFARVKEGLGHLRRHPAIRRTVG
                     TLFAAAAFGSVETALGVVLAIKWLGVGSAGFGFMEAALALGAILGGLAMPRLLARLPR
                     EKLFLYGLLLFGLFEASVGLFPTFAWVLVAFFLGGFLNMTFIVPARSILQLNTPQEMR
                     GRIFAAFGAVMNAAVLIGTMLGGALEGPMGAPMVFLLAGGMVSLAALYTLLTGGIPAP
                     QDGRQTAG"
     gene            complement(564987..566702)
                     /locus_tag="TCCBUS3UF1_RS02780"
                     /old_locus_tag="TCCBUS3UF1_5740"
     CDS             complement(564987..566702)
                     /locus_tag="TCCBUS3UF1_RS02780"
                     /old_locus_tag="TCCBUS3UF1_5740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514982.1"
                     /db_xref="GI:504327880"
                     /translation="MERLSDLVDLYEYRVEDLVAGRTPKGGKRALLELRALLAQARLP
                     GPLAKRFRQADARFRALRRPQEGTPAPLDLPTWIPEEAEAHPPSHGEEGPKALALKVW
                     RLMAGREAKVRARELLAGRREELRLLYAFLQNYLHYREQEGFKRDFNLSRFSPRFPIP
                     SLSDSLLDLEDPEVASRLLLEFLETALHLPQDLPLPPEETRAYVRRFLNRLLEWEEAY
                     GLPPRKDLLALKRALEEAKRLGASAQEIARLEERLRQEAREERRRELLLEEERGRFRV
                     AAEKLLALLNLLPVPQGETPWPKVPEPGQGEEGLLTLRLSPGRVVLGPLTLTLSQVEG
                     TWHLGLAGEDHALEDSLAIPWEDLEVWAVREGDLLHLRLEARSGLRLYELLAEGRVLA
                     LLLSPQGAYAYLRLLRALSARLKGEFQREAFGPALAEKYRQAPEEALQDFARKGLELT
                     LKRLGPTDPAPLLQEVGQALGHGEEAKVLAETLREYLGRRPPTRETLGGEVHFLPLTP
                     EPAGLRVGQTILSVRLREDAVYVGQAGEVPRRLRDLLVYRLPGGAVVLAREGQRLAYL
                     VVGNP"
     gene            566728..567483
                     /locus_tag="TCCBUS3UF1_RS02785"
                     /old_locus_tag="TCCBUS3UF1_5750"
     CDS             566728..567483
                     /locus_tag="TCCBUS3UF1_RS02785"
                     /old_locus_tag="TCCBUS3UF1_5750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine phosphatase"
                     /protein_id="WP_014514983.1"
                     /db_xref="GI:504327881"
                     /translation="MRLAPRFSVAAVSHVGRRQNNEDFHRVLRLEVPQGHLLLLAVAD
                     GMGGMEAGEWASKVAIEALSEAARAYAEHLKGGRPAVGLSRVMEKAFALAQRRVEKEA
                     EKPGRKGMGTTLTAFLYADWLKEGVVGHIGDSRAYHLTPRGLVRLTEDHSWVAERVKE
                     GVLTPTEAERHPYRNVLTRALGLPEARYDLKGVHLAPGEGVLLVTDGLYGLVPEVEWQ
                     LGKDLQASLEALVSEALRRGGDDNVTAVALRVG"
     gene            567483..569432
                     /locus_tag="TCCBUS3UF1_RS02790"
                     /old_locus_tag="TCCBUS3UF1_5760"
     CDS             567483..569432
                     /locus_tag="TCCBUS3UF1_RS02790"
                     /old_locus_tag="TCCBUS3UF1_5760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_014514984.1"
                     /db_xref="GI:504327882"
                     /translation="MAFLLAFLLVLLTAALASRLSPWPLFFLLALLAGAAWATGVRAE
                     ALLPWLLLALGSMAAPRVYLAPRRRARRAPRQGRPTRVKTTEEAQALAQRYEVLEKVG
                     VGGMATVYKAKDRKTGRVVALKVPQERFVGDPRFVRRFHREAEVLSKMDHPNIVKVFD
                     HGQVDGVHFIAMEYLDGEGLDRLIEERRLNLRQAAAILARVADALKHIHAQGIVHRDI
                     KPGNIMVLKGALKEDGVDPRGVRLMDFGIAAGKVLTRLTITGARIGTPVYMSPEQAKG
                     QKLDHRSDIYSLGIVLYEALTGQPPFTGGYETVIHQQIFQVPTPPKQLKPEIPQALSD
                     LVLRMLEKDPAKRPTLDEVIQGLSGSWEEEKGLPQPYYLLLGVEAKRGVVRLLDVQGT
                     AARLLSGIGSAPGHFPAPPLAVAADPEGGIWVSVFEHGAKLLHRFSPEGELLLSAGPY
                     GMKPGEFLFPVALAVADGSLFVLDGETATISRLDLKGQYLGRFGGQGLGRGSFQDPKA
                     LVVAGEYLLVLDYGNRQVQRLTLEGRYLSRYAFRRSKESEELRLLGGVGAGEGRIYLY
                     DVEAAKVRAVDPSGALLASYALPLLEGEDRMSLVELLPWDGVLYAARRGSSRVHRIDL
                     RTGEALPPLEVYAPVRALALWKNPL"
     gene            569429..570073
                     /locus_tag="TCCBUS3UF1_RS02795"
                     /old_locus_tag="TCCBUS3UF1_5770"
     CDS             569429..570073
                     /locus_tag="TCCBUS3UF1_RS02795"
                     /old_locus_tag="TCCBUS3UF1_5770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014514985.1"
                     /db_xref="GI:504327883"
                     /translation="MRVLLVEDDPGVREALELGLALEGHEVRSASRPKEALAHLPWAE
                     AVVLDVLLPEGDGFSLLKEIRARSEVPVLMLTALDAVEWRVKGLREGADDYLVKPYSL
                     QELLARLEALRRRVRRGEEVLAYGDLRLYPRRMEAYRGERRLALGPKAFLLLKAFLEA
                     PEEVLSKEALMLRVWGEPVEPATLEVHLSALRKALGEPNPIQTVRGYGYRLFLP"
     gene            570048..571353
                     /locus_tag="TCCBUS3UF1_RS02800"
                     /old_locus_tag="TCCBUS3UF1_5780"
                     /note="histidine kinase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            571378..571926
                     /locus_tag="TCCBUS3UF1_RS02805"
                     /old_locus_tag="TCCBUS3UF1_5790"
     CDS             571378..571926
                     /locus_tag="TCCBUS3UF1_RS02805"
                     /old_locus_tag="TCCBUS3UF1_5790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514987.1"
                     /db_xref="GI:504327885"
                     /translation="MKRTLFGLLLLAAGLSLAQGTDYRQAALAAHALARLQAVAQAAQ
                     GEEKLLKWAQEVKARAERDYEAKAYFKAAREAQAALLLFRAARGQAAPTPPASHRGWD
                     HRRWDRGPGFGPRPGLEARLAQRAPGAVERAEKELAYYRGQDPLVKDLIAEAKGRLAK
                     EPGRALLLAQAALALISAERGF"
     gene            571933..572358
                     /locus_tag="TCCBUS3UF1_RS02810"
                     /old_locus_tag="TCCBUS3UF1_5800"
     CDS             571933..572358
                     /locus_tag="TCCBUS3UF1_RS02810"
                     /old_locus_tag="TCCBUS3UF1_5800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433708.1"
                     /db_xref="GI:752794276"
                     /translation="MRGGWAALLLAWGLAWAEGSPPPSEAAFLRCREVVGGLEVQALY
                     QGEGATLVLLGKGRPLLLVALEEGRPLPHAGPPRGKPMARRPFPFLRELSLARRVVVL
                     AGEYRCFVLHRGRVVGVLRLGPDLEPLPLFPPPEGPPAP"
     gene            572410..574611
                     /locus_tag="TCCBUS3UF1_RS02815"
                     /old_locus_tag="TCCBUS3UF1_5810"
     CDS             572410..574611
                     /locus_tag="TCCBUS3UF1_RS02815"
                     /old_locus_tag="TCCBUS3UF1_5810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014514989.1"
                     /db_xref="GI:504327887"
                     /translation="MKPGLYPVLGPPASGKTRLALELARGALARRQRVVWVGLPHQRA
                     YLYRLLGEEGAFLGLEFLSFQALYYRVLAEAGRLGPLLPGAGRVALVAEALRAFSPEV
                     APGEARLFARAIAELKRFGLSPFALPKEGEAGRLRRVYFRYERLKGRALDYDDFRHRA
                     LRAPLRLFPPPGLVVVDGFREIGPLDLRFLRRLAAQVPVLLTLERLPEGLEPWRELSP
                     RPVRKRVWALANPVEEARYLLRALKRALAPRALGGEGLSPEEILVVAPEGRIGGLLLL
                     QEEYGLPLSDGRERALAEGEEGERVLALLNPVPTGRDLLALGFTALGRRALRLGLAGE
                     EALAVLAEREGLLEEWRAFLALRTPGPDLLAWGEAVLERLGVAAKEPFLARLRLALGV
                     DRANPLAWWRSLLLDETLPPEPVRGVPLLPPLRATGVRARRAYVLEWVAGRYTLGEGE
                     DYFLLEELRERGLLRSLPRRLRGLDPLFQAEMATRGEEVFLLYPEAGLSGLYEPLERG
                     ERPPPLPPASALEVLPQEPFPLSPLRASGPPPHLEALRRLRECPFRAYAERFGLREGG
                     EALGWHLFPEGKEALSRHPEVGPWLQAHGAHLEGMRFWVWWQGAHFPLRLDGVRREGG
                     TIHLYRLLPRGAEPDLGPQRRWTEWYALGALLQRGDVEAVHLWVWPFLGTPRPYRPRP
                     FRKGESIPALREVRDQAEKALALWHQGVFSPRPGPHCYACGLADVCRKEDA"
     gene            574608..577211
                     /locus_tag="TCCBUS3UF1_RS02820"
                     /old_locus_tag="TCCBUS3UF1_5820"
     CDS             574608..577211
                     /locus_tag="TCCBUS3UF1_RS02820"
                     /old_locus_tag="TCCBUS3UF1_5820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="WP_014514990.1"
                     /db_xref="GI:504327888"
                     /translation="MRLYVASAGTGKTHALVRELLDLVAQGVPLRRVAALTFTRKAAE
                     ELRRRIEAQVRALAPQDPLAQEAQREVYGAVFTTLHGFMAEALRHTAPLLSLDPDFAV
                     LDELVAEAFFREETRSLLYLRGLDPGLEELLFALYKKRSLADRLYPAPGAEGVWALFQ
                     EALEGYRRRTREALGPSDLEALALRLLDHPVAVGRVVERFPHILLDEYQDINPLQGRF
                     FAALEAAGARLVAVGDPKQSIYLFRNARVEVFRQALERAEERRELRETWRHARAVAQL
                     LNRFVALFPEGERVEVVPQRAEEGRVEVHWVVGEGELADKRRHEAHLLARRLRELAAE
                     GYAFSEMAVLVRSRQSLPPLEGALRALGVPYGLRRGRSFFTRPEVRDLYHALRLSLLE
                     GPPSPEERLSLLAFLRGPFLGLDLGSLEEALRAEDPLPLLPPMAQERLAWLKGLAGRR
                     PLEALKLLAREETFLRRLSPRARANLDTLLLLASAERFPDLEALLEWLQARAKDPEAS
                     ELPEGGEGVNLLTVHAAKGLEWRVVAVFDLARGERPNQEPLRVGLSGEVALEGTPAYQ
                     ALGQALAQAEEEEALRLLYVALSRARDVLLVTGSESARPGPWARALDRLGLGPKDQDP
                     WVRRHLFQEPPPPLPREGPEGEANPAPYATWSLPPKPFPQVYSPSAHRKAEAEPRPLA
                     EALEAEALPEFARAVGTLVHYALARHLDPEDEGAMAALLLQEVAFPLAQEGERLLAEV
                     RALLRGYRALLGPVLPPLEAREEDYAELPLVLPLMGTVWYGVLDRLYRVGGRWYLEDY
                     KTDREVDPEAYRLQLALYWEAVRRAWGVEAEARLVYLRHRRVQPFTPEELREALAGLE
                     TEHPPEGASGG"
     gene            complement(577223..577609)
                     /locus_tag="TCCBUS3UF1_RS02825"
                     /old_locus_tag="TCCBUS3UF1_5830"
     CDS             complement(577223..577609)
                     /locus_tag="TCCBUS3UF1_RS02825"
                     /old_locus_tag="TCCBUS3UF1_5830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_014514991.1"
                     /db_xref="GI:504327889"
                     /translation="MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFQDYFQGIVRAV
                     AALEPLRAVDALGRFDAYITVSGGGKSGQVDAIKLGVARALLRYNPDYRAKLKPLGFL
                     TRDARVVERKKYGKHKARRAPQYSKR"
     gene            complement(577609..578034)
                     /locus_tag="TCCBUS3UF1_RS02830"
                     /old_locus_tag="TCCBUS3UF1_5840"
     CDS             complement(577609..578034)
                     /locus_tag="TCCBUS3UF1_RS02830"
                     /old_locus_tag="TCCBUS3UF1_5840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_014514992.1"
                     /db_xref="GI:504327890"
                     /translation="MQTYVPKETEPRWVLIDAEGKTLGRLATQIATLLRGKHRPDWTP
                     NLAMGDFVVVVNADKIRLTGKKLKQKIYTRYSGYQGGLKEIPAEKMLATHPERVLEHA
                     VKGMLPKGPLGRRLFKRLKVYAGPTHPHQAQKPQKLEVK"
     gene            578170..579819
                     /gene="pyrG"
                     /locus_tag="TCCBUS3UF1_RS02835"
                     /old_locus_tag="TCCBUS3UF1_5850"
     CDS             578170..579819
                     /gene="pyrG"
                     /locus_tag="TCCBUS3UF1_RS02835"
                     /old_locus_tag="TCCBUS3UF1_5850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514993.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_014514993.1"
                     /db_xref="GI:504327891"
                     /translation="MDGVAERASRPRKYVFVTGGVVSSLGKGILTSSLGALFRARGYQ
                     VTAIKIDPYVNVDAGTMRPYEHGEVFVTGDGAETDLDIGHYERFLDMDLSRGNNLTTG
                     QVYLSVIQKERRGEYLSQTVQVIPHITDEIKERIRKVAEEQRAEVVVVEVGGTVGDIE
                     SLPFLEAIRQFRFDEGEGNTFYIHLTLVPYLETSEEFKTKPTQHSVATLRGVGIQPDA
                     VVLRSAKPVPEEVRKKVALFTNVRPGHVFSSPNVDHLYEVPLLLEEQGLGRAVERALG
                     LEPVFPNLAFWQEAVRVLKHPERTVRIAIAGKYVKMPDAYLSLLEALKHAGIKNRARV
                     EVKWVDAEGLEAGDLEEAFRDVAGILVPGGFGVRGIEGKVRAAQYARERKIPYLGICL
                     GLQIAVIEFARNVAGLKGANSTEFDPYTPHPVIDLMPEQLEVEGLGGTMRLGDWPMRI
                     KEGTLLHRLYGKDEVLERHRHRYEVNPLYVDGLERAGLVVSATTPGMRGRGAGLVEAI
                     ELKDHPFFLAVQSHPEFKSRPMRPSPPFAGFVEAALRHAGA"
     gene            complement(579826..580860)
                     /locus_tag="TCCBUS3UF1_RS02840"
                     /old_locus_tag="TCCBUS3UF1_5860"
     CDS             complement(579826..580860)
                     /locus_tag="TCCBUS3UF1_RS02840"
                     /old_locus_tag="TCCBUS3UF1_5860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase (AAA+ superfamily)"
                     /protein_id="WP_041433709.1"
                     /db_xref="GI:752794277"
                     /translation="MEPMEHPQTPIDLLALDLPRGEPWGYALAQGLLKAPWAWRALRP
                     TPGVLDLIRMDLEALHAKLLRLRRDFPLGDLGERPPHPAEEGALAALLARDPQALVRV
                     LQAHGPYPFALYRAFRFGGEVQPIPSPRLPREGELLGYEAQREALEENARRFLQGRPA
                     LHTLLYGARGTGKSTAAKGLLRLEGARMVEVETGALAHLERLLQTLALLPHRFFLFLD
                     DLSLDPEDEAFHHLKALLEGSLEGPPENVLLLATSNRRHLVRHLGENPLPGEGPQAWD
                     ALQDTLALSERFGLVLTFPPFDKGLYLRAVAHHLGRPLTPEEEGAALRFALEKGYSGR
                     VARQCASLLA"
     gene            complement(580896..580971)
                     /locus_tag="TCCBUS3UF1_RS02845"
                     /old_locus_tag="TCCBUS3UF1_t480"
     tRNA            complement(580896..580971)
                     /locus_tag="TCCBUS3UF1_RS02845"
                     /old_locus_tag="TCCBUS3UF1_t480"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(580936..580938),aa:Lys,seq:ctt)
     gene            complement(581011..581625)
                     /locus_tag="TCCBUS3UF1_RS02850"
                     /old_locus_tag="TCCBUS3UF1_5870"
     CDS             complement(581011..581625)
                     /locus_tag="TCCBUS3UF1_RS02850"
                     /old_locus_tag="TCCBUS3UF1_5870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014514995.1"
                     /db_xref="GI:504327893"
                     /translation="MRRFALLLGGPLLATEGLKVRLRGYRLLAADSGARHALALGLAP
                     ELWLGDFDSSPPWLQEALPSPKEVLPREKELTDGEALVRKALELGAEEVLLLGGIGGR
                     LDHTLAHLELAFALREQGVGAALTDGLAWAYPLLPGEHRFPLGEGEPFSLLPFPRATL
                     GVEGARYPLHPTPLEATTLTLENRALGPIRVRVEEGRALLYLFP"
     gene            complement(581622..582572)
                     /locus_tag="TCCBUS3UF1_RS02855"
                     /old_locus_tag="TCCBUS3UF1_5880"
     CDS             complement(581622..582572)
                     /locus_tag="TCCBUS3UF1_RS02855"
                     /old_locus_tag="TCCBUS3UF1_5880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014514996.1"
                     /db_xref="GI:504327894"
                     /translation="MLALSLEKSFPGFRLAVALEVQEGEVLALLGPSGSGKSTLLRLI
                     TGLLPPDRGFVRFRDQDLTPLPPERRGVGFLFQDYALFPHLTVAENLAFGLVEARWPK
                     AAREARVEELLRRMELTPHARKRPQELSGGEQQRVALARALAPRPRLLLLDEPLGALD
                     LRLREELLLFLRRTLRAEGITTLVVTHDQEEAFLLAGRVAVMREGRLVQVGRPEEVYT
                     RPQDAWTARFLGHKNLLSPEESQALGLPPKPHLLPPQALGLGGPLRGKVEERLFFGAR
                     VGLWVRAKGVRLYLEAPAGPEEGTEVGLHLDPKRAVALGG"
     gene            complement(582627..583073)
                     /locus_tag="TCCBUS3UF1_RS02860"
                     /old_locus_tag="TCCBUS3UF1_5890"
     CDS             complement(582627..583073)
                     /locus_tag="TCCBUS3UF1_RS02860"
                     /old_locus_tag="TCCBUS3UF1_5890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsB"
                     /protein_id="WP_014514997.1"
                     /db_xref="GI:504327895"
                     /translation="MKRTLMAFLLLGGLALAQADGAKLYTQCAGCHQATGQGIPGAFP
                     PLAGHVAEILALKGGREFLIQVLLWGLQGQIEVKGMKYNGAMPAYNGLKDEEIAALLN
                     HIATAWGDDKKVQGFKPFTADEVKALRAKRLTPQQVLEERKKLGLK"
     gene            583315..583746
                     /locus_tag="TCCBUS3UF1_RS02865"
                     /old_locus_tag="TCCBUS3UF1_5900"
     CDS             583315..583746
                     /locus_tag="TCCBUS3UF1_RS02865"
                     /old_locus_tag="TCCBUS3UF1_5900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_014514998.1"
                     /db_xref="GI:504327896"
                     /translation="MYVYRVLWTLLLAGPLALAALDASRWYPFAQAQDLAREYSRVLM
                     VYFHSPTCPYCDQMNTFVLSDPGVSQLLEERFLVASVSTATPEGQELSRRFRVPGTPT
                     FVFLVHRKGAWEEVGRLFGSRPRAQFLSELRQVCAKGGVCE"
     gene            583739..584191
                     /locus_tag="TCCBUS3UF1_RS02870"
                     /old_locus_tag="TCCBUS3UF1_5910"
     CDS             583739..584191
                     /locus_tag="TCCBUS3UF1_RS02870"
                     /old_locus_tag="TCCBUS3UF1_5910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014514999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sulfur oxidation protein SoxY"
                     /protein_id="WP_014514999.1"
                     /db_xref="GI:504327897"
                     /translation="MNRRAFLKATGAALGAVALAGLPARAQALEGEDLANLEKALKEA
                     LGKGFKDLTPSNLVKLTMPAIAESGANVPAEVEVNLPPSQVKAIHLFADKNPTPRLVS
                     FMPMKAMAYYATRVRLAETSAVRAVVETTDGRLLLASASTRVTVGGCG"
     gene            584210..584536
                     /locus_tag="TCCBUS3UF1_RS02875"
                     /old_locus_tag="TCCBUS3UF1_5920"
     CDS             584210..584536
                     /locus_tag="TCCBUS3UF1_RS02875"
                     /old_locus_tag="TCCBUS3UF1_5920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515000.1"
                     /db_xref="GI:504327898"
                     /translation="MPIRTIVRLTPAKPKAGEEVRLQAVAQHPNEPGTRRDEKGNLIP
                     ANYINLVEVYFEGEKVAEARPGPSTSANPLYGFKFKAEKPGTFTVKLKDTSGDTGEGQ
                     VKLELA"
     gene            584581..585360
                     /locus_tag="TCCBUS3UF1_RS02880"
                     /old_locus_tag="TCCBUS3UF1_5930"
     CDS             584581..585360
                     /locus_tag="TCCBUS3UF1_RS02880"
                     /old_locus_tag="TCCBUS3UF1_5930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014515001.1"
                     /db_xref="GI:504327899"
                     /translation="MVWRAWCTLALVLLLPLALAQDADPREEAKRQKELLLKTAGILP
                     TELVVEQGRELFGRKGPSGKTMAECDFGLGKGVLEGAAARLPRYFLDTNRVEDLDSRI
                     LTCMTRVQGFKPEQIRRSEVVAVAFYIASKSTGQRIQVRLLFPQERELYALGEKLFYA
                     RTGARDVGCATCHVTYVGRRAGVLPYADVLGKDQSWTHWPAYRYSNDQTWTMQDRIRA
                     CYGNIAHPPPDLYSLPILALEVFLAYRNNGAVVEEWPAFVR"
     gene            585370..585939
                     /locus_tag="TCCBUS3UF1_RS02885"
                     /old_locus_tag="TCCBUS3UF1_5940"
     CDS             585370..585939
                     /locus_tag="TCCBUS3UF1_RS02885"
                     /old_locus_tag="TCCBUS3UF1_5940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014515002.1"
                     /db_xref="GI:504327900"
                     /translation="MRKVVFALMVLSLVALAQRYFQDQELERIKTAGRAYAEVFLNQR
                     PDQALCSLHKNRLPADLLPQFLEAQRAQIRYPQNGKLMGDWKKGGAIFNNLQKANCFS
                     CHFGSPVHLGGDVGPSLEKYGLKRGQSEAVQRYTYEVIYNAWAFFPCTVMYRFGAQGL
                     LTPEEIADVVAYLLDPESDFNTKPAVGSK"
     gene            585936..587657
                     /locus_tag="TCCBUS3UF1_RS02890"
                     /old_locus_tag="TCCBUS3UF1_5950"
     CDS             585936..587657
                     /locus_tag="TCCBUS3UF1_RS02890"
                     /old_locus_tag="TCCBUS3UF1_5950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur oxidation protein SoxB"
                     /protein_id="WP_014515003.1"
                     /db_xref="GI:504327901"
                     /translation="MNRRDFLFLLSVLGGLGPRALAQVREDPARLYDLPPYGEATLLY
                     FSDLHGQAFPHHFMEPPNLIAPKPLMGRPGYLTGEAILRYYGVGRGTPLAYLLSYLDF
                     VELARAFGPIGGMAALTALIRQQKAQVEAAGGQALVLDGGDTWTNSGLSLLTQGEAIV
                     EWQNLTGVDHMVSHWEWTLGRQRVEELLKKFRGEHLSYNVVDELFGDPLFPAYRIHTL
                     GGYAVAVVGATYPYVKVSHPEGFTEGLSFALDEKRLQETVDAARAEGADAVVLLSHNG
                     LQLDAALAERVQGIDLILSGHTHDLTPLPWRVGKTWIVAGSAAGKALMRVDLKLRRGG
                     VANLRVRVLPVLAQHLPKAADVEAWLEARMAPHRAHLLEALAVAETLLYKRDTLYSTF
                     DQLVGEAVKALYPEVEVVFSPAVRWGTTILPGQAITRDHLYAFTGFTYPELYLFWLRG
                     EQIRNVLEDIASNVFSPDPFYQQGGDVSRTHGLRYALDPDAPLGRRVQRVEVGGRPLD
                     PGRRYLVAAYGGRLQRAGEARAGYEPKPIYALLEAYLKGVGRVRVLPEPNVRVLGRNY
                     RIPEVRG"
     gene            587654..588214
                     /locus_tag="TCCBUS3UF1_RS02895"
                     /old_locus_tag="TCCBUS3UF1_5960"
     CDS             587654..588214
                     /locus_tag="TCCBUS3UF1_RS02895"
                     /old_locus_tag="TCCBUS3UF1_5960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014515004.1"
                     /db_xref="GI:504327902"
                     /translation="MKRKALLAMGLLAFGLALSQVSPFRARLEAALGSGGREFAQVML
                     SQDRGQALCSQYRDRLPPDLIPQFLAEQKALIKYPKSGKLLGDWRNGEKVFTDPKRGN
                     CYACHAGDPKEVAYGTMGPSLTGYGQRGTSEPVVRYTYEKIYNAWAFVPCSLMYRGGV
                     HGLFTPEETADLVAYLLDPNSPINRR"
     gene            588218..589021
                     /locus_tag="TCCBUS3UF1_RS02900"
                     /old_locus_tag="TCCBUS3UF1_5970"
     CDS             588218..589021
                     /locus_tag="TCCBUS3UF1_RS02900"
                     /old_locus_tag="TCCBUS3UF1_5970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014515005.1"
                     /db_xref="GI:504327903"
                     /translation="MKDKRTRILFLSLSLAALGGLLGYTQQPKPLDPFEEAMRQRQMY
                     LETFGVLPGELYVEEGKELFFRKGPSGKTLEECDFGLGKGKLEGVYAVLPKYFPDSRK
                     VEDLESRVYTCMQTVQGYKPQAIKREEVKAITTYIASFSSKAKMQVVPKHPQELAMYN
                     LGRELWYARAGARDMSCAVCHDQYAGQRVRLSPVRSPKQGLGSEWPAYRFEADKLYTM
                     EDRIAFCYESIAIPAPAFYSEPYIALTLYMLAEATKAGRSFEELPFFTR"
     gene            589024..589455
                     /locus_tag="TCCBUS3UF1_RS02905"
                     /old_locus_tag="TCCBUS3UF1_5980"
     CDS             589024..589455
                     /locus_tag="TCCBUS3UF1_RS02905"
                     /old_locus_tag="TCCBUS3UF1_5980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
                     /protein_id="WP_014515006.1"
                     /db_xref="GI:504327904"
                     /translation="MRRRHLLALLPLLPLARAQGGEGWVQAFGAFLQRVPPASYLVYP
                     TEAKDLLLFEPFVLDVRTLEERKRGYIPGSVHIYAGQVPDRLSELPKDKEALILVYCN
                     SGSVSMVVAAYLRALGYKNAKNIAHGFKGWLDAGLEVEGGS"
     gene            589452..590306
                     /locus_tag="TCCBUS3UF1_RS02910"
                     /old_locus_tag="TCCBUS3UF1_5990"
     CDS             589452..590306
                     /locus_tag="TCCBUS3UF1_RS02910"
                     /old_locus_tag="TCCBUS3UF1_5990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor 2"
                     /protein_id="WP_014515007.1"
                     /db_xref="GI:504327905"
                     /translation="MKRILVLTAALLGFSLAQSLVVEVRGSLEAVEARTLRALREAGL
                     EPDRVLNLGEQVRQVTGPGFPDYRLVVLKPEAGSVEAASKNPMAAIVLPPTVFITGEG
                     GRYTVGTLDGRLLFGMLGVYGGAVERLVWRLEAALGRLGPVRQVAPAMMPDPRSGMMP
                     ALLYRVPGAKLEDVVLMVETELTSAGLNLLPNVRVGPVTVIMPCKSEWARVMFLTQPA
                     GGFAAPCRFFAMPMGEDVLVGAIDPMLMTIMPGVMGSPAVTMLQEARQVMLGILEAVG
                     GVPHRLGP"
     gene            590319..591608
                     /locus_tag="TCCBUS3UF1_RS02915"
                     /old_locus_tag="TCCBUS3UF1_6000"
     CDS             590319..591608
                     /locus_tag="TCCBUS3UF1_RS02915"
                     /old_locus_tag="TCCBUS3UF1_6000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfide dehydrogenase"
                     /protein_id="WP_014515008.1"
                     /db_xref="GI:504327906"
                     /translation="MAKVNRRDLLKAGAALAATGALGGGAWAQEFYSRPPTLLPRTRK
                     PRVVVIGGGWGGTTVARKLVQAGVEAEVVLVEQRPIFMSCPMSNLYLAGAKPLEWMVF
                     DYTNVVEDGVVFVQERVLDIQRDKRLIRTTGGYLGYDFLVLAPGIDYMYEAIPGYTEA
                     KHLLPVGFKPFEHIALRRMLDRFDETGGELVMYIPNPPYRCPPGPYERAAMLAWRIKS
                     KGVKGKIIVLDANPQPISKAAGFLAAFNDLYKGVLEYVPNTRITGIDYAKKQVLTELG
                     EVPFTLANIIPPMKAGELVRIAGLGERWANIRLPYFLSEKDDRVYLLGDIVGNTPYPK
                     SGMVAYVSGTIVARHLAERLKGKPLAQIPYELPTNICYSFVDSEEAIWVAHQHSWDEA
                     AKRIVQQSSVDNQRSKANGQAAYGWAEGIWNDMFGPA"
     gene            591677..592960
                     /locus_tag="TCCBUS3UF1_RS02920"
                     /old_locus_tag="TCCBUS3UF1_6010"
     CDS             591677..592960
                     /locus_tag="TCCBUS3UF1_RS02920"
                     /old_locus_tag="TCCBUS3UF1_6010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018461394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin binding oxidoreductase"
                     /protein_id="WP_014515009.1"
                     /db_xref="GI:504327907"
                     /translation="MDRRKFFRLLGAGGLLGFLKAKAQTPPWDEETFAPMRTLGAPLS
                     EYGGRSPYEEGVVRYISPNLRTRHSGADFAPLEKLEGVITPNGLHFERHHGGVPQVDP
                     AKYRLVIHGMVERPLVFTLEDLKRFPSVTRTYFIECAGNGQNGYRNPPDPNLTATRSR
                     GLASNASWTGVPLALLLKEAGVKPGARWLIPEGMDAAAYTRSLPLEKAMEDVLVAYAQ
                     NGEALRPEQGYPVRLVVPGWEGSIQVKWLRRILVTDLPAMAKDETSEYTDVMADGKVL
                     AFTWVMDPESIITYPSGLQRIRPGFHEIRGLAWSGYGRITKVEISLDEGKTWRQATLE
                     PPVERYAFVRFKMPWYWDGKEVVLWSRAWDEKGNTQPTREAFFKKWGRNNRYHYNAIQ
                     AWRILPDGRVVNGDRPLGQEAFGPAGGCGGEVFDV"
     gene            592953..593501
                     /locus_tag="TCCBUS3UF1_RS02925"
                     /old_locus_tag="TCCBUS3UF1_6020"
     CDS             592953..593501
                     /locus_tag="TCCBUS3UF1_RS02925"
                     /old_locus_tag="TCCBUS3UF1_6020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_014515010.1"
                     /db_xref="GI:504327908"
                     /translation="MFRRLGVLLALLGLAVGARYQLGTPISEELVAQYDLRPVVLPDG
                     RGLPPGEGRVEEGERIYAEKCASCHGGRGEGYPFNRLVAEPFPITPDTDPVEFAIGNY
                     WQYATTLYDYIRRAMPFGAPGTLTDQEVYHLVAWLLYMNGIIEADTPINQKTLPQVRM
                     PARELLDLDPETKRRFPWLTLP"
     gene            593511..594179
                     /locus_tag="TCCBUS3UF1_RS02930"
                     /old_locus_tag="TCCBUS3UF1_6030"
     CDS             593511..594179
                     /locus_tag="TCCBUS3UF1_RS02930"
                     /old_locus_tag="TCCBUS3UF1_6030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmH"
                     /protein_id="WP_014515011.1"
                     /db_xref="GI:504327909"
                     /translation="MSLSLGAAFLAGVLSFLSPCVLPLVPTYLFYLGGERGRPLFNAL
                     FFVLGFGVVFFLLGLPFTLLGGLLFEHRQTLARVGGGVLLLLGLYMLGLRPRWGVNLR
                     YEGETGRPWGAFLLGATLGLGWTPCIGPILGAILTLTAVGGGVGFLLAYILGLALPFL
                     LVALFAERLKGWLRRAGRLSHHVERLAGVVLLLVGALLLTGTYSSLNAFFLRITPEWL
                     QKYL"
     gene            594226..594804
                     /locus_tag="TCCBUS3UF1_RS02935"
                     /old_locus_tag="TCCBUS3UF1_6040"
     CDS             594226..594804
                     /locus_tag="TCCBUS3UF1_RS02935"
                     /old_locus_tag="TCCBUS3UF1_6040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014515012.1"
                     /db_xref="GI:504327910"
                     /translation="MLLRLQALSKRFGRDWVIRDLSFTLERGEVVALLGPNGSGKTTL
                     LRLMAGLLKPTRGRVERGGRPLFLANPPAFHRHLTAGEHLRYDLLFHGFHGQEGDWRG
                     ALARFGLPEDLPLAAFSSGMRKRLALARLSLLKPDIWLLDEPETALDGEGRGLLLEVL
                     AEARGQGGVVLATHDRALAEGVADRTLELGAA"
     gene            594801..595523
                     /locus_tag="TCCBUS3UF1_RS02940"
                     /old_locus_tag="TCCBUS3UF1_6050"
     CDS             594801..595523
                     /locus_tag="TCCBUS3UF1_RS02940"
                     /old_locus_tag="TCCBUS3UF1_6050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein B"
                     /protein_id="WP_014515013.1"
                     /db_xref="GI:504327911"
                     /translation="MRPSLRAAQAPGKGVALTGLRRVLVLALRDLRLEVRDRAGLLSV
                     LAFFTVMLFIMALALGPEEGPLRRAAPGVLWVALAFASTLLSTRAFALEVEDATLDDL
                     LLTPGSKEWIYLGKLLFQMLLLLPLGLLALFMAGGLFYLPLERGLPLGLTLALGMLGY
                     ASVATFYAGLLARLRGREVLLPLLLFSLVVPVVLAAVRATTGLVEGLPLEEVASWWQL
                     LLVFDVVYLTASALLFPVVMEG"
     gene            595580..596266
                     /locus_tag="TCCBUS3UF1_RS02945"
                     /old_locus_tag="TCCBUS3UF1_6060"
     CDS             595580..596266
                     /locus_tag="TCCBUS3UF1_RS02945"
                     /old_locus_tag="TCCBUS3UF1_6060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003044283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c assembly protein"
                     /protein_id="WP_014515014.1"
                     /db_xref="GI:504327912"
                     /translation="MLKAANPDRPDLLTWAFLGLGLLLLPAGLYVALAAPPDVNQGYL
                     VRIMYLHVPTAWLGYLAFFVTFLYSVLYLFRQDPRHDRMALASAEIGLVFMGLALVTG
                     MLWARPTWGVYWTWEPRLTTTAILFAVYVGYFLLRGAIEDPELRAKAAAAVGILGFLN
                     VPISYMSVKWWRSLHQTQSIDLTTGRIEMEPAMLQALLFNLLVFTLLYVGFVRFRGFL
                     AAWEARKEEA"
     gene            596358..596786
                     /locus_tag="TCCBUS3UF1_RS02950"
                     /old_locus_tag="TCCBUS3UF1_6080"
     CDS             596358..596786
                     /locus_tag="TCCBUS3UF1_RS02950"
                     /old_locus_tag="TCCBUS3UF1_6080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein DsbF"
                     /protein_id="WP_014515016.1"
                     /db_xref="GI:504327914"
                     /translation="MRTKYVLGVLLILGALAYMVFGGLGRNLVYFLTPSEYLQDQSRY
                     QNRPVRLGGLVKEGTVRYDKDRLELRFTLTDGVAEVPVVHRGTPPGMFKEGQGVVVEG
                     RFREGVFQGSNLLVKHSESYQAPKAGWTPEEVRKLIEEAK"
     gene            596783..598714
                     /locus_tag="TCCBUS3UF1_RS02955"
                     /old_locus_tag="TCCBUS3UF1_6090"
     CDS             596783..598714
                     /locus_tag="TCCBUS3UF1_RS02955"
                     /old_locus_tag="TCCBUS3UF1_6090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmF"
                     /protein_id="WP_014515017.1"
                     /db_xref="GI:504327915"
                     /translation="MTPALLGNLGVSLALAFSLLGLSLALLAYLQGDGRFLRGARALV
                     LPAFLAALAAFLALEWGLLTHDFSLAYVARNHATQDPLWVTLVTPWAALEGSILLWGL
                     LQTLYTLLASRKALDPWRASLVLAVLFGIQVFFFGVMATIASPFQTLPNPPADGTGPN
                     PLLQNHWMMAVHPVLMYLGFVGLSVPFAYAVAAMVTRRYQTWVEETRWWALIAWGFLT
                     AGKVAGMWWSYEVLGWGGYWAWDPVENASFIPWLLATAFLHTAIVQQARGAFKVWNFA
                     FVTLAFAATVLGTFLTRSGVIMSVHAFAEGPVGPAFLGFFLLATGLGLGLLSRVSREV
                     RDTAVFRPLSREGALLLGAFFFAGWALVVLLGTFYPLLAEAFGGAKVSVGAPFFNQLS
                     APIGAGILLLMGVGPLLPWRRPRAEVFRNLYALLAALVLGTLLGLLRGYTFGASLAVG
                     LFLYNLLAIFLLVREGVVGRVRAGLSPWGYLGNRRRVGSLVVHFAVALMGLGIAFSQT
                     YRLEAEKTLYRGQAWAVGGVRMEFQGVRALNEGRRFAVEALLRTDRFGEVRPRLHFYP
                     QMNAPLPSPKVIYTPGNDYYFLLMDFDREKGEWASVRLIVTPLVFWMWVAGGLMALGT
                     LYILWPQGLGAEAREVSPA"
     gene            598711..599247
                     /locus_tag="TCCBUS3UF1_RS02960"
                     /old_locus_tag="TCCBUS3UF1_6100"
     CDS             598711..599247
                     /locus_tag="TCCBUS3UF1_RS02960"
                     /old_locus_tag="TCCBUS3UF1_6100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014515018.1"
                     /db_xref="GI:504327916"
                     /translation="MRTWLWVLLLLFLGGLFLWGMQRNPRELPSVLARERRPAPDFTL
                     PVLPPYREAWGETFRLSQHLGKRPVVLNFWASWCYPACYEEAPVLEALWRRYRDRVLF
                     LGVNTQDQEPGALRFVAQFGLTFPQVFDPRGRVGVDYGMYGVPETFVIDAQGRVMVRH
                     AGAIDQATLEKYLAEALP"
     gene            599244..599663
                     /locus_tag="TCCBUS3UF1_RS02965"
                     /old_locus_tag="TCCBUS3UF1_6110"
     CDS             599244..599663
                     /locus_tag="TCCBUS3UF1_RS02965"
                     /old_locus_tag="TCCBUS3UF1_6110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmH"
                     /protein_id="WP_041433712.1"
                     /db_xref="GI:752794280"
                     /translation="MRWLALLFLFLSAWAQSGPPPDLSPEVFAIARELRCPVCQGESA
                     AESNAGVAVEMRRIIAEMLQQGKTEAEIKAFFVDRYGDWILYEPPRRGATLWVWVLPL
                     VGLFLLGLGLFAYFRPKRPLPPELLEEAERRLKEPPA"
     gene            599660..600640
                     /locus_tag="TCCBUS3UF1_RS02970"
                     /old_locus_tag="TCCBUS3UF1_6120"
     CDS             599660..600640
                     /locus_tag="TCCBUS3UF1_RS02970"
                     /old_locus_tag="TCCBUS3UF1_6120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine beta-synthase"
                     /protein_id="WP_014515020.1"
                     /db_xref="GI:504327918"
                     /translation="MMATLIFLVLLLLGLLLALRPLLGPKEPFPEPPRREELLRELSV
                     LQEEVAALEGEERKLALARMVELERALEGWRPPEPRPFNPLPVALALGVVLLLGVGLW
                     RYSLPRLPGETTVTQRAEARELKALQDKARRTGAVEDLLAWGRRAYEVQAWDQAAEAY
                     LEVLKKDPRNVEAVRRVGILLFMGGRLEEAEMFLQIAQHADPKAAEGWLFLGNLYFQK
                     GENGAAIAAWERYLEVGGEARERVEGLIAMAKAQAQGAKDGLSVYQARCALCHGAQGE
                     GGVGPRLKGNPILKSPEAVREIVLKGRGQMPPVPLGEEELKTLLDYLAGL"
     gene            600637..601191
                     /locus_tag="TCCBUS3UF1_RS02975"
                     /old_locus_tag="TCCBUS3UF1_6130"
     CDS             600637..601191
                     /locus_tag="TCCBUS3UF1_RS02975"
                     /old_locus_tag="TCCBUS3UF1_6130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcsB"
                     /protein_id="WP_014515021.1"
                     /db_xref="GI:504327919"
                     /translation="MKRRDLFFYVPLAVAGGFFAWFGVRTYNLRFRPRPEAGEPVWRE
                     GARVAVARRGELGVWQAKPFAYPLPQGDLKAFLLRLPAPAPGGLSLGQEHYIAFSRIC
                     THQACTLNFVPDPEVASLLYNFRYERPFLGCPCHFGAFDPLLGGKAIYGPPRYPLPRL
                     RLEAQGETLYATGHEVPLRPMEGL"
     gene            601199..602374
                     /locus_tag="TCCBUS3UF1_RS02980"
                     /old_locus_tag="TCCBUS3UF1_6140"
     CDS             601199..602374
                     /locus_tag="TCCBUS3UF1_RS02980"
                     /old_locus_tag="TCCBUS3UF1_6140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-lyase"
                     /protein_id="WP_014515022.1"
                     /db_xref="GI:504327920"
                     /translation="MEEPLGLSTLAVHAAWAQTPANPPATMPFYPSAAWAFRDLDEVD
                     AVYEGRVKGAVYARNGTPNRWALERLLAGLHGGEAALATASGMAALAALFLAHLRPGG
                     RVVASRDLYGTTWGLLGDLARFGVEAVGVDATDLEAVAAHLRPGSLLLVETLSNPRLR
                     VADLPALAALARERGALLVVDNTFATPYHARPLAQGADLVVESLTKFLSGHHLVLLGG
                     LVGRKDLVEGPLGVAVRAGLVPDPWACWLGAEGAKTLAVRLERASATALRLARFLETH
                     PKVGAVHYPGLPSHPDHATARRVLARGFGAMLAFELPPEREAVNRFLRALRHIRLVLS
                     LGGTETTLSHPATSSHRSLPPSEREALGLHPGFLRLSVGLEDPEDLLEELEEALKAV"
     gene            complement(602371..603678)
                     /locus_tag="TCCBUS3UF1_RS02985"
                     /old_locus_tag="TCCBUS3UF1_6150"
     CDS             complement(602371..603678)
                     /locus_tag="TCCBUS3UF1_RS02985"
                     /old_locus_tag="TCCBUS3UF1_6150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="WP_014515023.1"
                     /db_xref="GI:504327921"
                     /translation="MAEAWTRLSPEEALLLLKRGAEEILPEEELLLKLQEGRPLTVKL
                     GADPTRPDLHLGHAVVLRKMRQFQELGHKVVLIIGDFTGMIGDPSGRSKTRPPLTLEE
                     TRENAKTYVEQAGKILRQEPHLFELRYNSEWLEGLSFKEVVRLTSLMTVAQMLEREDF
                     KKRYEEGIPISLHEFLYPFAQAYDSVAIRADVEMGGTDQRFNLLVGREVQRAYGHPPQ
                     VAFLMPLLVGLDGREKMSKSLDNYIGVAEPPESMFKKLMRVPDPLLKDYFRLLTDLEE
                     EEVEALLKAGPVPAHRVLARLLTAAYAQETIPARLDRAFYESLGYAWEAQGRDREAGP
                     EAVRRAEARYDEVARGGIPEELPEALIPPSELKEGRIWVARLFTLAGLTPSHAEARRL
                     IGNRGLRIDGEVVEDPGLEVDLSRPRVLQRGRDRFVRVRLQEG"
     gene            603701..604078
                     /locus_tag="TCCBUS3UF1_RS02990"
                     /old_locus_tag="TCCBUS3UF1_6160"
     CDS             603701..604078
                     /locus_tag="TCCBUS3UF1_RS02990"
                     /old_locus_tag="TCCBUS3UF1_6160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515024.1"
                     /db_xref="GI:504327922"
                     /translation="MRSLLLLLLLALGLYWYADRYGLAVGYPPFLPVFYWKYTGEARY
                     PLRVTGLYDAVKVKVAGNLEEGRLSLALLREGRQVGERHFAGRFQEEVRFAVTPGEYL
                     LRFRLEGAKGQVRYDWVATKFAP"
     gene            604136..604429
                     /locus_tag="TCCBUS3UF1_RS02995"
                     /old_locus_tag="TCCBUS3UF1_6170"
     CDS             604136..604429
                     /locus_tag="TCCBUS3UF1_RS02995"
                     /old_locus_tag="TCCBUS3UF1_6170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_014515025.1"
                     /db_xref="GI:504327923"
                     /translation="MAQKKPKRNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLA
                     QEGQAEEAIKILRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVHKLLSAVSA"
     gene            604440..604523
                     /locus_tag="TCCBUS3UF1_RS03000"
     CDS             604440..604523
                     /locus_tag="TCCBUS3UF1_RS03000"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62613.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein Thx"
                     /protein_id="WP_008632889.1"
                     /db_xref="GI:495908310"
                     /translation="MGKGDRRTRRGKIWRGTYGKYRPRKKK"
     gene            complement(604553..605293)
                     /locus_tag="TCCBUS3UF1_RS03005"
                     /old_locus_tag="TCCBUS3UF1_6180"
     CDS             complement(604553..605293)
                     /locus_tag="TCCBUS3UF1_RS03005"
                     /old_locus_tag="TCCBUS3UF1_6180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515026.1"
                     /db_xref="GI:504327924"
                     /translation="MEGNLNTIPLTELLELIHAHRRSGVLELRVGFLPLSLRFSAGEV
                     VGAAILDWEGLEALFTFPLHPKEGPFRFQPGAPAAEKPLLPFSTLLGEWARVNDEWDR
                     FRTLVDSPSRVLEAIRPTSPYEVFQGGKSVRAAAKAWEVPLLIAMERAYMGVREGDLY
                     PLRRYAWYALRIRYQGKKGKTLEEFGGLQALLDGTRNLGEVIASGVPVGLVRRYLVQA
                     IGSGELTPQGRGWLLRDLTWEMEKEGEA"
     gene            complement(605278..606156)
                     /locus_tag="TCCBUS3UF1_RS03010"
                     /old_locus_tag="TCCBUS3UF1_6190"
     CDS             complement(605278..606156)
                     /locus_tag="TCCBUS3UF1_RS03010"
                     /old_locus_tag="TCCBUS3UF1_6190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_014515027.1"
                     /db_xref="GI:504327925"
                     /translation="MGHLARLYVPATLANLGSGFDALGVALDLYLEVEAEPAREDAFF
                     YEGEGQVAGTDNLIHQGYRAGMAALGLKAEPLAIRAFNPIPLARGMGSSSAALVAGVA
                     LADRVSGGRLGREGVFQVAARLEGHPDNVAPAVYGGFVAALSEPPLAIPLPRPEGVRF
                     VLAVPPYEVPTPLARAALPPSVPLEEAVFNLARSALWPAALCTGRLEALREASRDRLH
                     QPRRAHLMPGVLEAIQGALEAGALAAFVGGAGPTVAALVRAGEEAPVARALEAYRGEG
                     RTLVLGLGEGYFWKET"
     gene            606640..607008
                     /locus_tag="TCCBUS3UF1_RS03015"
                     /old_locus_tag="TCCBUS3UF1_6200"
     CDS             606640..607008
                     /locus_tag="TCCBUS3UF1_RS03015"
                     /old_locus_tag="TCCBUS3UF1_6200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515028.1"
                     /db_xref="GI:504327926"
                     /translation="MDRFQRLWGFAKRTLALGISVGLGLLALRFEGVLGPATFALGVI
                     SGALLDYVSLGQVRLTNRKEVVALLAATLAVGYFVELVSPGYWTRFLQGPAGTPYFLG
                     LFLGELLFYSYSKAEGKVIR"
     gene            complement(607029..608477)
                     /locus_tag="TCCBUS3UF1_RS03020"
                     /old_locus_tag="TCCBUS3UF1_6210"
     CDS             complement(607029..608477)
                     /locus_tag="TCCBUS3UF1_RS03020"
                     /old_locus_tag="TCCBUS3UF1_6210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Carbohydrate kinase, YjeF protein"
                     /protein_id="WP_014515029.1"
                     /db_xref="GI:504327927"
                     /translation="MRLFTPEAMREADQKAAALGYPTLLLMEWAGMKAARLYRKLFGQ
                     APAVVLAGKGNNGGDGLVLARHLHLEGVAVRVYAAEGQEGDALLARQALAAHGLEIRP
                     LEEASWKGGEVLVDALFGTGLKRPLEGLYAGLVERMNTSGLPILALDLPSGLPYAPHV
                     RATATLAFAALKTPHLLNREACGQLYLAEIGLPRHLLQREDLPEVATPEALRPLLPPR
                     PLTAHKGSVGRVGVLGGYRGEGLRYAGAPLLAALGAYRMGAGLVHLVAPEGTPLEPLE
                     AVFHPVNAPSLPPMRVEALAVGMGGGAWGRAWALEALQAHLPTVLDADALHPEVVELY
                     RRAGVRAVLTPHAGEAGRLLGLPPEGVAKDPLGAARALAEATGQVVVLKGNPTVVAEG
                     GRLSVNPTGNPALATGGTGDVLSGAIAALMAAGLAPFDAARLGVYLHGLAGDLRAGEK
                     GVGLLAREVAEALPRARRLLEGGQAPWPFSRV"
     gene            608501..609247
                     /locus_tag="TCCBUS3UF1_RS03025"
                     /old_locus_tag="TCCBUS3UF1_6220"
     CDS             608501..609247
                     /locus_tag="TCCBUS3UF1_RS03025"
                     /old_locus_tag="TCCBUS3UF1_6220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent protein deacylase"
                     /protein_id="WP_014515030.1"
                     /db_xref="GI:504327928"
                     /translation="MGMVERLEEARRRLREAQRVAVLTGAGISKPSGIPTFRDAEGLW
                     RNFNPLDYATPEAYARNPEKVWAWYAWRIAKVREARPNPAHLALVRLEEALAARGGSF
                     LLVTQNVDGLHARAGSRSLVEFHGNLLRARCEACGERFPLPDPFTPPPFCPRCGHRAR
                     PDVVWFGEFLPEGAWAQAERAFAEADFALVVGTSAEVEPAASLGRIAYAGGAYLVEVN
                     PEPTPLTPLAHLSLRTGAVEGLEALLNDGG"
     gene            609237..609773
                     /locus_tag="TCCBUS3UF1_RS03030"
                     /old_locus_tag="TCCBUS3UF1_6230"
     CDS             609237..609773
                     /locus_tag="TCCBUS3UF1_RS03030"
                     /old_locus_tag="TCCBUS3UF1_6230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515031.1"
                     /db_xref="GI:504327929"
                     /translation="MGVRGFLRVLADLCTLARAAVVLLVLLRVGQGPEALAQVIRLLL
                     LGWTLDVLDGVLARASRRPSPLALWDYPLDAGLAWAGWAYLAGAGLVPLPLAWAHGVL
                     TLVLLLRYPRKSLAMLLQVLPTFAPFLLAHRLAPEAFREALLWALLALLLDGRRFLGV
                     VREFMEDVGLGVPSPRRP"
     gene            complement(609770..611068)
                     /locus_tag="TCCBUS3UF1_RS03035"
                     /old_locus_tag="TCCBUS3UF1_6240"
     CDS             complement(609770..611068)
                     /locus_tag="TCCBUS3UF1_RS03035"
                     /old_locus_tag="TCCBUS3UF1_6240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated GTPase EngA"
                     /protein_id="WP_041433951.1"
                     /db_xref="GI:752794520"
                     /translation="MHKVVIVGRPNVGKSSLFNRLLGKRSAVVADVPGVTRDLKEGVV
                     ETDRGRFLLVDTGGLWSGDHWEKKIQEKVDQALESAELVLFAVDGRAELTQADYEVAE
                     YLRKKGKPVVLVATKVDDPKHEAYLGPLYALGFGDPIPTSSAHARGLEALLEAIWAKL
                     PVRQIESEPEVAAIRLAIVGRPNAGKSSLLNAILGEERVIVSEEPGTTRDAIDVEFFF
                     GGHRFVLVDTAGIRKRPESLVEELAIGRSLRAMAEADVVLLVVDPFQVGDRELKLANQ
                     AMEEGKPVLLVITKWDLVGKEEASKVRRGLREKLIHLDHLPRVYTSAFTRQNLDRIFA
                     EAVRLHELSHTRVPTSELNRWLSVWTAKVQLPNFKGRPLKLLYATQPEVAPPTFVFFV
                     NHPEFVTRAFENYLRNRIGEDLGLKEIPFRLVFRGRREEG"
     gene            611148..611717
                     /locus_tag="TCCBUS3UF1_RS03040"
                     /old_locus_tag="TCCBUS3UF1_6250"
     CDS             611148..611717
                     /locus_tag="TCCBUS3UF1_RS03040"
                     /old_locus_tag="TCCBUS3UF1_6250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_014515033.1"
                     /db_xref="GI:504327931"
                     /translation="MRALAGWLLRLGGWRYHMPPPPCKRYVLIGAPHTSNWDFFVGIL
                     ALWALGIRARWLGKKELFRPPLGWLLTLMGGIPVDRSRRKGLVDQVAAILREREVAIL
                     ITPEGTRGKAPYWRTGFYYMALKAGVPIALGYADFHRKEVGVGGYLWPTGDLKRDFAA
                     IRAFYQDKVGLRPEKQGPIRIREEEEEVA"
     gene            611754..612119
                     /locus_tag="TCCBUS3UF1_RS03045"
                     /old_locus_tag="TCCBUS3UF1_6260"
     CDS             611754..612119
                     /locus_tag="TCCBUS3UF1_RS03045"
                     /old_locus_tag="TCCBUS3UF1_6260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433715.1"
                     /db_xref="GI:752794283"
                     /translation="MGPPSPFSDAARTWAAVAHLAPLLGYFVLIGQILLPLAVLLWGP
                     KDPLVQAHAKESLNGQISYTLYGLALWLLALTVVGLVLAVPLALGLVLLVLWNMVQGA
                     LAAGRGEAYAYRLILRLVP"
     gene            complement(612097..612474)
                     /gene="acpS"
                     /locus_tag="TCCBUS3UF1_RS03050"
                     /old_locus_tag="TCCBUS3UF1_6270"
     CDS             complement(612097..612474)
                     /gene="acpS"
                     /locus_tag="TCCBUS3UF1_RS03050"
                     /old_locus_tag="TCCBUS3UF1_6270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515035.1"
                     /note="Catalyzes the formation of holo-ACP, which mediates
                     the essential transfer of acyl fatty acid intermediates
                     during the biosynthesis of fatty acids and lipids; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_014515035.1"
                     /db_xref="GI:504327933"
                     /translation="MIRAVGADLVEIARVRRLLERHGERALRRLFTEEELAYALRHQD
                     PAPSLAARLAAKEAFQKCWPEGLAWKEVWVGMEGRRPVLRFAPGLSARLEGEGFLAHL
                     SLSHERGHALAVVVLEVRAPGAG"
     gene            612549..613916
                     /locus_tag="TCCBUS3UF1_RS03055"
                     /old_locus_tag="TCCBUS3UF1_6280"
     CDS             612549..613916
                     /locus_tag="TCCBUS3UF1_RS03055"
                     /old_locus_tag="TCCBUS3UF1_6280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_014515036.1"
                     /db_xref="GI:504327934"
                     /translation="MLPKAFLSRMAELLGEEFPPFLKALTQGERAYGLRVNTLKLAPE
                     ALKGIAPWPLEPIPWCPEGFYYPAEARPGPHPFFYAGLYYIQEPSAQAVGVLLDPRSG
                     ERVLDLAAAPGGKTTHLAARMGGKGLLLAGEVDGKRVRGLLENLERWGAGVAVLQAPP
                     RALAEAFGAYFHRVLLDAPCSGEGMFRKDKEAIRHWGPSAPKRASEVQKALLAQAARL
                     LGPYGVLVYSTCTFAPEENEGVVAAFLKAHPEFRLEEARFHPLFAPGVPDWGDGNPDL
                     AKTARLWPHRLRGEGHFLARFRREGGAFSTPRLERPPPLSPEAKRAWGAFLAEAGLEL
                     EGLLLERGGHLYLLPEGLPSLAGLKAPAPGLYLGLVQKGRFRPAKALALAFGATLPWP
                     KLPQVALGPEDPRALALATGEGVAWEGEDMPLALAVLKTPVGDFPLDFAKAKGGVLRP
                     VGMAL"
     gene            complement(613913..614965)
                     /gene="aroB"
                     /locus_tag="TCCBUS3UF1_RS03060"
                     /old_locus_tag="TCCBUS3UF1_6290"
     CDS             complement(613913..614965)
                     /gene="aroB"
                     /locus_tag="TCCBUS3UF1_RS03060"
                     /old_locus_tag="TCCBUS3UF1_6290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515037.1"
                     /note="catalyzes the formation of 3-dehydroquinate from
                     3-deoxy-arabino-heptulonate 7-phosphate; functions in
                     aromatic amino acid biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_014515037.1"
                     /db_xref="GI:504327935"
                     /translation="MQRLEVRNPVPYPILLGEGLLGEVGVPQGPKALLYDRKVEGFAL
                     EVAEALGAEHRLGLEGGEGAKSLEAYGRVLSFLAAKGLPRNATLLVVGGGTLTDLGGF
                     VAATYLRGIRYLSFPTTTLAVVDASVGGKTGINLPEGKNLVGAFHFPLGVYAELRALR
                     TLPPFTFKEGLVEAFKHGLIAGREDLLEVEGLGPESPRLEAYLAEAVAVKVAITEKDP
                     LEAGERRLLNLGHTLGHALEAQTRHALPHGAAVAYGLLYAALLGKALGGEDLTPPVLR
                     LLRWLQPPPLALAPWEDLLPYLARDKKKVSESLHWVVPLAPGRLSVQPLPEGLLREAY
                     ALWQGLLLREGLAQSP"
     gene            complement(614943..615497)
                     /locus_tag="TCCBUS3UF1_RS03065"
                     /old_locus_tag="TCCBUS3UF1_6300"
     CDS             complement(614943..615497)
                     /locus_tag="TCCBUS3UF1_RS03065"
                     /old_locus_tag="TCCBUS3UF1_6300"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q5SII4.1"
                     /note="catalyzes the formation of shikimate 3-phosphate
                     from shikimate in aromatic amino acid biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_014515038.1"
                     /db_xref="GI:504327936"
                     /translation="MARLEVPRPATFVSLTGFMGVGKSRIGRELARALMLHFIDLDRY
                     IERRTGLPIPDIFRHLGEEAFRRMEKEAVRELVGKDYLVLALGGGTFVDPENRQALLH
                     RGPVVALWASPETILERATRKPGERPLLQVENPLERIRTLLQARTPIYREAHVHVSTD
                     HRRVEEVVAEIVEKLWAYAEARGA"
     gene            complement(615513..616664)
                     /locus_tag="TCCBUS3UF1_RS03070"
                     /old_locus_tag="TCCBUS3UF1_6310"
     CDS             complement(615513..616664)
                     /locus_tag="TCCBUS3UF1_RS03070"
                     /old_locus_tag="TCCBUS3UF1_6310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515039.1"
                     /note="catalyzes the formation of chorismate from
                     5-O-(1-carboxyvinyl)-3-phosphoshikimate in aromatic amino
                     acid biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_014515039.1"
                     /db_xref="GI:504327937"
                     /translation="MRFLTAGESHGPELLAIIEGLPAGLPLSEADINPWLEKRQKGYG
                     RGRRMVIETDRVEFRAGVRAGRTTGAPVALALRNADHRNWLEVMDPAPGNEPRKRALT
                     APRPGHADLAGGIKYGHKDLRDVLERASARETAMRVAVGAVALKLLSLLGVEGVGYVP
                     GMAGVWSGVPFSWDLLPRIEESPLRMTDPEAEAEVIRRIDQAKAEGDTLGGVIEARFR
                     GLVPGLGSHVHWDRKLDGRLAQMALSIPAVKGVEIGPAFENAMRRGSEVHDPIYWTPE
                     RGFHRRTNRAGGLEGGMTTGEELVVRAALKPIATLMRPLPTVDVVTHEPADAARERSD
                     TTAVPAASVILYALCAIVLAQAYLEKFGGDTLEEIQERVERYKARALAY"
     gene            complement(616740..618998)
                     /locus_tag="TCCBUS3UF1_RS03075"
                     /old_locus_tag="TCCBUS3UF1_6320"
     CDS             complement(616740..618998)
                     /locus_tag="TCCBUS3UF1_RS03075"
                     /old_locus_tag="TCCBUS3UF1_6320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein"
                     /protein_id="WP_041433717.1"
                     /db_xref="GI:752794285"
                     /translation="MKPLTWALVALGLSALAGSLPQDPRFEAKVNLKVSESQVRAGLT
                     LPLDVVLEALARSVGLQPFIYRAYDASGDPAKALPPLPNVKVDFQGKAFREAWDLLFA
                     TYGTQFNLDYLFLPPDVVVVAPTQVITALVDAPSRAGAAERRPYVVGIPEAAYRQAVQ
                     GQGGQVQVTSSVEAAKGWVQNDLLPFLSREAAGLSVNWIVVEEGGRLKAILSVLATPE
                     QHARFSDILQRAGIDFRPLPALSLPRPRVERAYTLSHATFPELLSFLQAQVPGAQVSV
                     LPTDPKRAIVLATEEDHARLKGLLEAADLPKPVATVRRVYALQNLTYAEVEARLRPLL
                     SRELPKARLESVPGNPKALLLEATEAEQALFAEILKAADVAPQAAPPPQEATTRRLYP
                     LRFADAEKVAPFLAREVPGIVVQTVPGQSVLSVRGTERQLAEVENLLAQIDRAPEQGP
                     PVFQRAYQLSNAKAADLAKVLQEALQARQGQAQGQAQAQPQRQATVVADERTNTLIVT
                     GTQEDLALVEGLIPKLDQAVPQVNLRVRIQEVQANLTQNLGLKWNTVAGGNVVASILD
                     SGLSLIFDSTRSLAALNILATLEALQRQGLSRALRDVNQTVLNNQTARLQSGETFLIR
                     RIVGDRVERVPFDIGIIVEVTPQITADGQILLNIKAEVSGNVQRNPVDGDVDRFTKQV
                     VTTTMRVRDGQTVVLGGLTSQESNQVQQGVPLLMDIPLIGELFKQRTQENTDRELLVV
                     ITADILKETASR"
     gene            complement(619010..619974)
                     /locus_tag="TCCBUS3UF1_RS03080"
                     /old_locus_tag="TCCBUS3UF1_6330"
                     /note="competence protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(619971..620570)
                     /locus_tag="TCCBUS3UF1_RS03085"
                     /old_locus_tag="TCCBUS3UF1_6340"
     CDS             complement(619971..620570)
                     /locus_tag="TCCBUS3UF1_RS03085"
                     /old_locus_tag="TCCBUS3UF1_6340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein"
                     /protein_id="WP_014515042.1"
                     /db_xref="GI:504327940"
                     /translation="MLAKLGQREWALISIALTLAVALLWYFLLIVPLRQETELVRQEI
                     ATLIPERDRGRQAQRALPELRAAIAALQAERQAFLRALPREERLAQVLSEILGEAARS
                     GVSVRSFTRSPTSAPVPEVRAVNLALSLEAPFPETYAYLRRLEGLSRFSSLSGLNLSV
                     QGQDLNPLLSTSLTLTLYMLAKDLEAQTEGGQQGQGGER"
     gene            complement(620560..621183)
                     /locus_tag="TCCBUS3UF1_RS03090"
                     /old_locus_tag="TCCBUS3UF1_6350"
     CDS             complement(620560..621183)
                     /locus_tag="TCCBUS3UF1_RS03090"
                     /old_locus_tag="TCCBUS3UF1_6350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein"
                     /protein_id="WP_014515043.1"
                     /db_xref="GI:504327941"
                     /translation="MIRLNLLPKNLRRRVEPGWWRLVAALFALVVLLTLGFLHYTAQT
                     ELSLAQQERDTLRAEVEALRPFIQEQNRLQQERRTLEALLAIREGLRKNFVPWSEYLA
                     AFIGQIPREGGRFPVALRSVGTRALTEEEANQQAQSGAFDGKKIRVEFNLQGEALNQA
                     ALVGFIQAFEASPRFGIEFQGASLDQNRGLYTFSARVGAVGGEEGAR"
     gene            complement(621176..622309)
                     /locus_tag="TCCBUS3UF1_RS03095"
                     /old_locus_tag="TCCBUS3UF1_6360"
     CDS             complement(621176..622309)
                     /locus_tag="TCCBUS3UF1_RS03095"
                     /old_locus_tag="TCCBUS3UF1_6360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein PilM"
                     /protein_id="WP_014515044.1"
                     /db_xref="GI:504327942"
                     /translation="MVSGFSKLFKPRVEALGLEIGASSLKLVELSGHPPALRAFATRP
                     TPPGMLAEGVVAEPAALAQEIRELLAEARTRKRYVVSAVPNPSVILRTIQVPKMPPKE
                     MEEAVRWEAERYIPFPIDEVVLDFAPLEPLSEVSEGEQTEVMVGVARQEAVAGLLEAL
                     RGAGLMPVVLDVKPFAGLYPLEAELGAEPERVAVAVEIGAESTSLVLTRGDRPLAVRV
                     LTLSGKDFTEAIGKAFGLDFLTAEEVKRTYGLATIPTEDEELLLDFDAERERYSPARI
                     YDAIRPILVDLTQEIRRSLEFFRVQLGDIHPEVGYLYGGGSRLRGLATLLTDTLGVSF
                     TTPDPWQGIQVDPKRFDLEKLKELGPELMVPIGLALRGVSPLD"
     gene            complement(622472..623476)
                     /locus_tag="TCCBUS3UF1_RS03100"
                     /old_locus_tag="TCCBUS3UF1_6370"
     CDS             complement(622472..623476)
                     /locus_tag="TCCBUS3UF1_RS03100"
                     /old_locus_tag="TCCBUS3UF1_6370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515045.1"
                     /note="catalyzes the formation of 2-oxoglutarate from
                     isocitrate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-isopropylmalate dehydrogenase"
                     /protein_id="WP_014515045.1"
                     /db_xref="GI:504327943"
                     /translation="MAYRICLIEGDGIGHEVVPAARKVLEATGLPLEFVEAEAGWETF
                     ERRGTSVPEETVEKILSSHATLFGAATSPTRKVPGFFGAIRYLRRRLDLYANVRPAKS
                     RPIPGSRPGVDLIIVRENTEGLYVEQERRYLDVAIADAVISKKASERIGRVALKLAES
                     RPRKTLHIAHKANVLPVTQGLFLDTVREVAKEYPLVNVQDIIVDNCAMQLVMRPERFD
                     VVVTTNLLGDILSDLTAGLVGGLGLAPSANIGDTTAVFEPVHGSAPDIAGKGIANPTA
                     TILSAAMMLDYLGEKEAAQRVEKAVDLVLEKGPRTPDLGGTATTETFTQAVVEALQAL
                     "
     gene            complement(623545..624054)
                     /locus_tag="TCCBUS3UF1_RS03105"
                     /old_locus_tag="TCCBUS3UF1_6380"
     CDS             complement(623545..624054)
                     /locus_tag="TCCBUS3UF1_RS03105"
                     /old_locus_tag="TCCBUS3UF1_6380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433719.1"
                     /db_xref="GI:752794287"
                     /translation="MAEGGLAYGTYRGWFAPEWAGPLAKGLVLLLVGYGLYQNRHLRS
                     LYLVLLGLSLNTLAIFANGGHMPVSLAALERAGVEGWEEALKTRADAVHTLLEEGSRL
                     PFLGDVIPLPPLRKAVSPGDLFILAGIAGVVAEGAMRASPKRLPRRQAALRVLVYLVL
                     VLLLLALRG"
     gene            complement(624090..625520)
                     /locus_tag="TCCBUS3UF1_RS03110"
                     /old_locus_tag="TCCBUS3UF1_6390"
     CDS             complement(624090..625520)
                     /locus_tag="TCCBUS3UF1_RS03110"
                     /old_locus_tag="TCCBUS3UF1_6390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase"
                     /protein_id="WP_014515047.1"
                     /db_xref="GI:504327945"
                     /translation="MLATLSFSLGTKKFVLELPPFKVFALILTTFLFFVGLELYLLHA
                     FQQSSRLSLWDLIFWALLIFWSVRLEVRLPLSASVSQLFIFALAFMVLAPPWLVPLWS
                     FLFQPRGDIWYKQLFNRSQDALATALATLTWLFFQKNPLYLGHLNLSAGVGIALSALV
                     FFVVNTFLVTTVIYFSTQTPLREIWRKNFGWVALSYLVLSPLALLLARAYETPLIGNW
                     GGWTVLFFLIPLYYSRYYWDEKVRLEQAFDTTLEVLMNALEAKEQETRFHSERVADIA
                     RDLARAHYKNEAKAQEIYRAARLHDIGKIAIPEALLLKPGSLTPEEYALIQSHTTKGV
                     KLLSPAKKVAFDALVYNVILYHHERWDGRGYPERLAGQDIPEEARIVGLADAYEAMTA
                     GRPYRKAKTSEEALKEVQEASGHQFDPKLVQLFTELWHQNPIWRDREAYLAAKEGSVS
                     RSTLPPHSSASDLPSPSEPGQRTSEG"
     gene            complement(626211..626286)
                     /locus_tag="TCCBUS3UF1_RS03115"
                     /old_locus_tag="TCCBUS3UF1_t470"
     tRNA            complement(626211..626286)
                     /locus_tag="TCCBUS3UF1_RS03115"
                     /old_locus_tag="TCCBUS3UF1_t470"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(626251..626253),aa:Phe,seq:gaa)
     gene            complement(626288..626364)
                     /locus_tag="TCCBUS3UF1_RS03120"
                     /old_locus_tag="TCCBUS3UF1_t460"
     tRNA            complement(626288..626364)
                     /locus_tag="TCCBUS3UF1_RS03120"
                     /old_locus_tag="TCCBUS3UF1_t460"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(626328..626330),aa:Asp,seq:gtc)
     gene            626430..626795
                     /locus_tag="TCCBUS3UF1_RS03125"
                     /old_locus_tag="TCCBUS3UF1_6400"
     CDS             626430..626795
                     /locus_tag="TCCBUS3UF1_RS03125"
                     /old_locus_tag="TCCBUS3UF1_6400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515048.1"
                     /db_xref="GI:504327946"
                     /translation="MSSLSWSEVFAYHRTRRGIGERSLLVDRGESGYTNFFLPDGRIL
                     YMGEGKRGHQEPLGGNLRLLMAYREGRPLRVFLRERPGLWRDLGLYRVGGWRYALWPE
                     EGRYVYWFTLEPGGCEGVP"
     gene            complement(626758..627516)
                     /locus_tag="TCCBUS3UF1_RS03130"
                     /old_locus_tag="TCCBUS3UF1_6410"
     CDS             complement(626758..627516)
                     /locus_tag="TCCBUS3UF1_RS03130"
                     /old_locus_tag="TCCBUS3UF1_6410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_014515049.1"
                     /db_xref="GI:504327947"
                     /translation="MLLAVDIGNTSTALGVFAGEELVAHFRIHTDRMRMESEYRVLLK
                     NLFALDGLPTPKAALLSSVVPPVEREMKEAIEKLFGIQARVVDAEATGLEVLIDNPKE
                     AGADRLVNAVGALAYPSPTGRYIVVDFGTATTFDLVEAPNRYLGGAITIGPQTAADAL
                     AARTAKLPRIDLVPPKGVVGKNTLEALRSGLVLGYAALVEGMVRRMKEEAGEALVIAT
                     GGFAQTLKDLCPSFDVVDEDLTLKGLLRIHRARG"
     gene            complement(627517..627942)
                     /locus_tag="TCCBUS3UF1_RS03135"
                     /old_locus_tag="TCCBUS3UF1_6420"
     CDS             complement(627517..627942)
                     /locus_tag="TCCBUS3UF1_RS03135"
                     /old_locus_tag="TCCBUS3UF1_6420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="WP_014515050.1"
                     /db_xref="GI:504327948"
                     /translation="MTKKVVLYNLVGHRFLGVNEQGDKVMIDGDQPAAGPRPMELLLM
                     ALGACTAYDVVDIMRKKKQPLARYRVEVEGVRAETHPKRYTHITITHIASGPGVTLEA
                     LERAVHLSHTKYCSVSANLNAEITTRVVLEPWEGEEAQG"
     gene            627981..629087
                     /locus_tag="TCCBUS3UF1_RS03140"
                     /old_locus_tag="TCCBUS3UF1_6430"
     CDS             627981..629087
                     /locus_tag="TCCBUS3UF1_RS03140"
                     /old_locus_tag="TCCBUS3UF1_6430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_041433721.1"
                     /db_xref="GI:752794289"
                     /translation="MRWMRLWLWPLALLWSLALAFPRVGVHEGFTRLAFDLPSKEVRH
                     TLAQEVGALTLVLEGVSAPAQDQVVNSREVASVQILPEMGRVRVVVRLKGPVEATVRR
                     FSDPERLVVDLALKAQTAPSPPAAPAALPHRAPKPPRPVVLLDPGHGGVDPGMVGYVV
                     EKEVVLDVALRLKRLLEGEGVEVRLTRERDAHLSPDKREDLSRRAALADSSQVNLFIS
                     IHVNATPTHTGRGVEVFYFGRAQDPRVLSQVIRENGGGELGKRLTQEAQSVAERILSD
                     IVAQANQRYSQRLAETLGRKLSQATGSPYRGSFPGDFFVLRYAKVPAVLVEIGFGDHP
                     VEGRRLAEPAYREKVAQGLLLGVLTFLANGAYAR"
     gene            complement(629084..629857)
                     /locus_tag="TCCBUS3UF1_RS03145"
                     /old_locus_tag="TCCBUS3UF1_6440"
     CDS             complement(629084..629857)
                     /locus_tag="TCCBUS3UF1_RS03145"
                     /old_locus_tag="TCCBUS3UF1_6440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_014515052.1"
                     /db_xref="GI:504327950"
                     /translation="MRAVSLAGKTLLNRYRVVRALGRGALATVYLAFDRFGTPYALKV
                     FPPGAEARRDREFWVGKQLAHPNLNPVLERLDLEEGPSLLLDYAPGEELGRWMLRRPE
                     RPRALFVFRQLLQALAHMHQKGLVHRDVKPENIIVAGTDEARLVDFDLSGPALEAFKK
                     PLRVGTLPYLAPEQVLGKSPGPEADVYAAGVILYWILSGEHPFVGEPEEVLLGHLQEP
                     IPSIPGLEAEAQGFLERLLAKRPEERFPTAGEALEAFPF"
     gene            629906..630661
                     /locus_tag="TCCBUS3UF1_RS03150"
                     /old_locus_tag="TCCBUS3UF1_6450"
     CDS             629906..630661
                     /locus_tag="TCCBUS3UF1_RS03150"
                     /old_locus_tag="TCCBUS3UF1_6450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019551729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_014515053.1"
                     /db_xref="GI:504327951"
                     /translation="MRGLALSGGGARGLAHIGALEVFLEAGLDFQVVAGTSMGAIVGA
                     LFAAGKTPEEILAIARKTPWLGLLGLSPREGIFSRRKLLDFLAEHLPPTFAGLSRPLA
                     VTAVDVVSGRLLFLTQGDLPSAVLASAAYPGLLAPVEREGRLLFDGGVLDNLPVDAAR
                     LLGATEVYAVDVTPERAADEAPRGLLALARRAVDLMQAHLTSVRLSLYAPEVYVRPSL
                     PGVGIEDFRRLEEIVEAGREAARRLWTGRVGGV"
     gene            630658..631464
                     /locus_tag="TCCBUS3UF1_RS03155"
                     /old_locus_tag="TCCBUS3UF1_6460"
     CDS             630658..631464
                     /locus_tag="TCCBUS3UF1_RS03155"
                     /old_locus_tag="TCCBUS3UF1_6460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_014515054.1"
                     /db_xref="GI:504327952"
                     /translation="MKGFWDYLFKEWFRQVGEALLVAFLVTTFVFTTVGVVGQSMFPT
                     LRNGERVLVPKWETWLVRFGLTEWRRGEIAILKPPEGTPYATARFPVLGFSFRAFFIK
                     RIVAVPGDEVYVERGVVYVNGKALEERHITDHLSPWPDSFPGVCYKEGRMTRIITQQG
                     DFPVDLLPAYLRPLKEMLLPPSPEVLARSQTAEACEVGRIKLKPGYYFVMGDNRTLGG
                     SEDSRTFGPVPVEAIAGRANFVWWPILVREEGGWRLNLRRLAPPEAYGLR"
     gene            complement(631457..632017)
                     /locus_tag="TCCBUS3UF1_RS03160"
                     /old_locus_tag="TCCBUS3UF1_6470"
     CDS             complement(631457..632017)
                     /locus_tag="TCCBUS3UF1_RS03160"
                     /old_locus_tag="TCCBUS3UF1_6470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515055.1"
                     /db_xref="GI:504327953"
                     /translation="MEARNRILARVRRALQGRPKALLPGHPHPPSSPEALDLFLKRLG
                     ENGAEGHLVDLEGAKELLKALSQGLPGAAFGRGVPPALRLLPELPPEEAPLGVSWALF
                     AVAETGTVALASKDGRRAQLLPPTHLVLVEGEKVYPSLLEAFLDLKALPRALGLHSGP
                     SKSADIGQVMVKGVHGPGRLVVAVLT"
     gene            complement(632007..633404)
                     /locus_tag="TCCBUS3UF1_RS03165"
                     /old_locus_tag="TCCBUS3UF1_6480"
     CDS             complement(632007..633404)
                     /locus_tag="TCCBUS3UF1_RS03165"
                     /old_locus_tag="TCCBUS3UF1_6480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="WP_014515056.1"
                     /db_xref="GI:504327954"
                     /translation="MRAKARLYPKEAARLLRERPGVREAVTGATLHFERNRLRAYGEI
                     DAEAWRDRAKAVKDHLLSHLDHYLELAERRLRENGVKVHWAETPEEAHRVLREVVARH
                     GVRRAVKAKSMLTEELGINPLLESLGVEVLETDLGEYLIQLLGEPPSHIVGPAIHLSL
                     AEIQRLFHARFGTPLDAPPEALAQVARKVLREAFLTAELGISGANFLVAETGTLALME
                     NEGNIRLSTSLPRVHVALVGLEKLLPRFQDLALFLPLTARAATGQRLATFVSLIQGPA
                     APGEEGPEEVHVVLVDNGRTALLQDPEAWEVLRCLRCGACLNACPVYRQTGGHPYGYV
                     YSGPIGAVLDPGLLGLEEAYPLPYASTLCGACQEACPVRIPIPKLLLTWRQRAVAEGL
                     SPAWERGAMTAFAKVMASPALYRLFSRGLRGLPLPQDLLPLLRAWSEGRGPLTPSPRP
                     FHQIWPELKEERHGG"
     gene            complement(633388..634104)
                     /locus_tag="TCCBUS3UF1_RS03170"
                     /old_locus_tag="TCCBUS3UF1_6490"
     CDS             complement(633388..634104)
                     /locus_tag="TCCBUS3UF1_RS03170"
                     /old_locus_tag="TCCBUS3UF1_6490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515057.1"
                     /db_xref="GI:504327955"
                     /translation="MRVALFITCLADQFYAEAGVAAVRLLRALGVEVDFPEGQTCCGQ
                     PAFNAGYWQEARLLAKRTLEVFQEAEYVVLPSGSCASMVRNHYPELLPAKGEALGMAE
                     KTYELSAFLVRVLGVERLGEGLRGRRVAYHHGCHALRELGVKEEPLLLLKNAGAELLP
                     WEAAEECCGFGGLFSVKLPEVSLGMADRKLATLPQAEVLTSTDAGCLLHLSGRLRKQG
                     KTLRVAPLATLLWEAYAGQG"
     gene            complement(634148..635407)
                     /locus_tag="TCCBUS3UF1_RS03175"
                     /old_locus_tag="TCCBUS3UF1_6500"
     CDS             complement(634148..635407)
                     /locus_tag="TCCBUS3UF1_RS03175"
                     /old_locus_tag="TCCBUS3UF1_6500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014515058.1"
                     /db_xref="GI:504327956"
                     /translation="MPPLSFRLRLFLSFSLLWLLFLVGALYLAGRGVERALRGHLEAT
                     LLEDAARAAEAYRKGQAGTLLPTGGVYLHLYAEDGEALVLTRGEHRLPKEALRGVGER
                     PQVVWQADFAAALVRTPLGLLVLTQDTAPIDLSLLALRRALLEAFFLLFPLGMLLVYL
                     TARLATRPLERAAREIAARSPERLDPVPITLPKDAFGGMVEAVNRLLLALKEAKEKER
                     TFLAEASHELRTPLTVLLGHLDRLKRNPLDLEALQTAQATAERMRRLVEDLLALARGE
                     AERTLNPHIVDLRALAAEAAREYGVAFSGEAVEVLGDPDRLLQMLRNLIANGVRAAGK
                     EGVWVALRREGEVALLEVADTGPGIPQDLLPHLFQRFARGPGGGAGLGLAIAQAIARA
                     HGGEIAVESRPGRTIFRVRLPLLEEEA"
     gene            complement(635418..636101)
                     /locus_tag="TCCBUS3UF1_RS03180"
                     /old_locus_tag="TCCBUS3UF1_6520"
     CDS             complement(635418..636101)
                     /locus_tag="TCCBUS3UF1_RS03180"
                     /old_locus_tag="TCCBUS3UF1_6520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014515059.1"
                     /db_xref="GI:504327957"
                     /translation="MKRILVIEDDPEVARLVELELKEAGFAVEWAKSGMEGLVRHRER
                     KPDLVVLDLGLPDLDGAEVARRIRATDDTPILVLTAQDAVERKVGLLAEGADDYLVKP
                     FHPAELLARIQVQLRHKGGSEVLAVGKLELYPKRRQVFFGEEEVRLSPKEFELLQLLM
                     SRPGRVFPRQEIEERIWGRPLGRESNVLDVHVANLRAKLREAGAYGYLRTVRGLGYAV
                     RPGRGEEEG"
     gene            complement(636098..636457)
                     /locus_tag="TCCBUS3UF1_RS03185"
                     /old_locus_tag="TCCBUS3UF1_6510"
     CDS             complement(636098..636457)
                     /locus_tag="TCCBUS3UF1_RS03185"
                     /old_locus_tag="TCCBUS3UF1_6510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515060.1"
                     /db_xref="GI:504327958"
                     /translation="MRPLALLLLLGVALASPPALLGPALPPGTELRLLSQDLRTLHGA
                     WRVEGRRLLALSSPVPPRVGQEVQLLLVLPGEKPRPFPGVADRGDVLLLLEKERVSLL
                     RILKEAYGLTPPERLWP"
     gene            complement(636469..637116)
                     /locus_tag="TCCBUS3UF1_RS03190"
                     /old_locus_tag="TCCBUS3UF1_6530"
     CDS             complement(636469..637116)
                     /locus_tag="TCCBUS3UF1_RS03190"
                     /old_locus_tag="TCCBUS3UF1_6530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014515061.1"
                     /db_xref="GI:504327959"
                     /translation="MRLRQRFLAGLVTLLPLLVTLYFLGWVYTYSGGYLEGFLRLLNL
                     EVPPSYLPFLPFVGLFLAAVLVYLVGTLTENYLGRSLLLSLERSLLLLPIVRDIYKAV
                     QQIAHTLFGQKEVKFSRAAVIEYPRRGLYTLCFVVQPVGVRLPPLPEGYTVVLVPTSP
                     VPASGMVVLVPSEEVIPLEISVEEALKYVVSAGFLLPEKPSGPLTSLPLKARGPS"
     gene            complement(637177..637785)
                     /locus_tag="TCCBUS3UF1_RS03195"
                     /old_locus_tag="TCCBUS3UF1_6540"
     CDS             complement(637177..637785)
                     /locus_tag="TCCBUS3UF1_RS03195"
                     /old_locus_tag="TCCBUS3UF1_6540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_014515062.1"
                     /db_xref="GI:504327960"
                     /translation="MTQARETVSFKPGEVILYPGVPGPRDRVFRVLEGLVRLEAVDEE
                     GNALTLRLVRPGGYFGEEAWAGLERTYFAEAVTEVVAEALPKEPRPEELQEVLAQLSQ
                     ALSESYRRIERLATQRLKNRMAAALLELAETPLAREEEGQLVLRATHDELAAAVGSVR
                     ETVTKVIGELSREGYIRSGYGKIVLRDLKGLKELAQARGDGR"
     gene            complement(637876..638187)
                     /locus_tag="TCCBUS3UF1_RS03200"
                     /old_locus_tag="TCCBUS3UF1_6550"
     CDS             complement(637876..638187)
                     /locus_tag="TCCBUS3UF1_RS03200"
                     /old_locus_tag="TCCBUS3UF1_6550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003044436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="divalent ion tolerance protein CutA"
                     /protein_id="WP_014515063.1"
                     /db_xref="GI:504327961"
                     /translation="MEEVVLITAPSLEVARTLARALVEEGLAACVNLVPGVTSVYRWQ
                     GEVVEEGEVLLVAKTTTFAFPRLKERVLALHPYQVPEILALPVAEGHGPYLAWLRENV
                     G"
     gene            complement(638188..640605)
                     /locus_tag="TCCBUS3UF1_RS03205"
                     /old_locus_tag="TCCBUS3UF1_6560"
     CDS             complement(638188..640605)
                     /locus_tag="TCCBUS3UF1_RS03205"
                     /old_locus_tag="TCCBUS3UF1_6560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_014515064.1"
                     /db_xref="GI:504327962"
                     /translation="MSQVLPVEITEELKQSFINYAMSVIVDRALPDVRDGLKPVQRRI
                     LFGAYQEGVLPNRKHVKSAKITGEVMGKYHPHGDAAIYEALVRMAQPWNLRYPLMDGQ
                     GNFGSIDGDPPAAQRYTEARLSPLGAEMLLDIDKETVDFRPNYDGSLKEPEVLPSAIP
                     NLLVNGASGIAVGMATSLPPHNLSEVVDALVAMIDHPGITLEEVMRLLPGPDFPTGGK
                     LSRRGIREAYATGRGSLKVRAKVRIEEKGQRPVLVVTEIPYQVNKASLIAQIAALVKA
                     KKLEEIVALRDESDRQGLRIAIELKRGANPQVVLNQLYKHTALQTSFTVNLLAIVDGE
                     PKVLPLLELMRHYLDHRKEVVRRRSLFDLKKAEERAHVLEGLLIALNHIDEVIALIRA
                     SEDAAAARGRLVARFALSEVQAQAILDMRLQRLVALEREKLLEEYRGLMEEIARLRAI
                     LEDEGRLWAEVKADLLRVKEKYGDPRRTLLTEFEENFNPEDLIEDEPMVITLTAQGFL
                     KRLPLESYRAQGRGGKGLIAGKPKEEDEATQVFVAGAHDDLLLFTSRGRVYRIKVYDL
                     PEMGRQARGVHVKGLLPLTEEEEVAALLSVRGLEGEGYLVFATERGLVKRTALREYAN
                     LGAAGLIAIKLQEGDRLIGVGLSDPEDEAILATAEGQAIRFPLEEVRATGRDSQGVTG
                     IRFKKPGDRVVSLVVVKPGEEVDLLSVSTRGYGKRTPLAEYPLQGRGGMGVITYAVSL
                     KVGRLAALLKVRGTEDLLVLSRRGLAIRTPVSEIRQYSRATAGVKVMHLPEEDEVASA
                     FAVDEEK"
     gene            complement(640710..641153)
                     /locus_tag="TCCBUS3UF1_RS03210"
                     /old_locus_tag="TCCBUS3UF1_6570"
     CDS             complement(640710..641153)
                     /locus_tag="TCCBUS3UF1_RS03210"
                     /old_locus_tag="TCCBUS3UF1_6570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_014515065.1"
                     /db_xref="GI:504327963"
                     /translation="MVLILNGPNLNLLGQREPEVYGRTTLEELEALCEAWGAELGLGV
                     AFRQTNYEGQLIEWVQQAHREGFMAIVLNPGALTHYSYALLDAIKAQPLPVVEVHLSN
                     LHAREPFRQHSVTAGACRGIVSGFGPLSYKLALTYLAETLEVGPA"
     gene            641178..642149
                     /locus_tag="TCCBUS3UF1_RS03215"
                     /old_locus_tag="TCCBUS3UF1_6580"
     CDS             641178..642149
                     /locus_tag="TCCBUS3UF1_RS03215"
                     /old_locus_tag="TCCBUS3UF1_6580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_014515066.1"
                     /db_xref="GI:504327964"
                     /translation="MGRLGALFLLFLSAWAQTHTVAPGETLFSIARRYGTTVEALAHL
                     NGLEDPNRLRAGQVLRIRAGLELPLPQGRLRLLPPVQGQALGLRVEGYRAGWAEFLGV
                     RYPLALGEGGLWGFLAVGALVAPGEYPLVLVLEGEEVSLPLRVAPGGYAKETLALTPS
                     LEQLLRDPGLKAERRKVVEACPKAGSLRLQGPLRPPLEGGRVTSPFGTRRRYGTLFTS
                     YHEGLDFAASLGTPVRAAAPGVVVLSERLKARGEAVVLTHGMGLCTGYWHLSQRWVRV
                     GEEVRAGQVLGLLGNTGLSTGPHLHLEVRLQGVPVDPAPWFQALPLP"
     gene            complement(642141..643364)
                     /locus_tag="TCCBUS3UF1_RS03220"
                     /old_locus_tag="TCCBUS3UF1_6590"
     CDS             complement(642141..643364)
                     /locus_tag="TCCBUS3UF1_RS03220"
                     /old_locus_tag="TCCBUS3UF1_6590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA methyltransferase"
                     /protein_id="WP_014515067.1"
                     /db_xref="GI:504327965"
                     /translation="MKVLTVEKLVPGGYGLARTEEGAVLVRGALPGEVVRGRPVRRKG
                     ALFLEEVEVLEGRPDRYPHPLPPSADLPLRYESQLPLKEGLVRDALERIAKLSFPLAP
                     IRPSPRALGYRTAAQYARHPLGGLAYRQPEGWSLLRLEEDPLLAEPLAWAFALLQTWP
                     LPVEEVALRGSLLEGRVLLGLIGGHPEALKRPAKALVKEGFAGVVWGEASPKGRFRGR
                     TMPLHGERTLLERFGPLTATVSVESFSQVNPLAAGELLEEAQGLVSGGRRALELYAGS
                     GLLSLLLAPRFRKVVAVEISKEAVRRGEEDRKRLGVANVRFHRGDAREAARLGAFDLV
                     VLDPPRSGLSPEVRAYLLEARPEEVLYMACNPATWARDVGELVRGGYRLAFARPYDFF
                     PFTHHVEVLSLLRLG"
     gene            643407..644060
                     /locus_tag="TCCBUS3UF1_RS03225"
                     /old_locus_tag="TCCBUS3UF1_6600"
     CDS             643407..644060
                     /locus_tag="TCCBUS3UF1_RS03225"
                     /old_locus_tag="TCCBUS3UF1_6600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_014515068.1"
                     /db_xref="GI:504327966"
                     /translation="MIRVVLADDHALFRQGLKSLLEAEGDFRVVGEAKDGWEALRHAL
                     EAKPDVILMDIQMPGLDGVQATQAILKEWPQAKVIILTMYRQDAYVFEAVKAGARGYL
                     LKDTDASDLIGAIRRVHAGEVLLDAELAGRIIQDFRAKKEASTPLHAELSEREIQILK
                     LVAQGYTNLEIAAELQLSEKTVRNRLSEIFQKLHLNNRTQAALYAIREGLAQPEPEE"
     gene            644060..645049
                     /locus_tag="TCCBUS3UF1_RS03230"
                     /old_locus_tag="TCCBUS3UF1_6610"
     CDS             644060..645049
                     /locus_tag="TCCBUS3UF1_RS03230"
                     /old_locus_tag="TCCBUS3UF1_6610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="WP_014515069.1"
                     /db_xref="GI:504327967"
                     /translation="MDPVRFLLELAPLAGEEARGAYVAAHLPGARRDGLGNVWAGEGK
                     VLLLAHLDTVLPPEPPRRAGERLYAPGVGDNSSGVAVLLSLPERPGVVRGFTVGEEGL
                     GNLKGARALVEALAPQVVVAVDGYLPGVVDRALGSVRFRVRFLGRGGHAWGDRGTPNP
                     VFALAEGLWGLWALFREEGEASLNASGLEGGEAVNAIPREASALLELRALLPEDLARL
                     YRAAQEVLEGAARRHGVELEVELLGERPAGATATPRLRQAAERALAAIGERPQFQPGS
                     TDASAAIERGIPALGLGVYRGGGAHTPEEWVLPQSLWQGRQALLALLEALGVG"
     gene            645055..645891
                     /locus_tag="TCCBUS3UF1_RS03235"
                     /old_locus_tag="TCCBUS3UF1_6620"
     CDS             645055..645891
                     /locus_tag="TCCBUS3UF1_RS03235"
                     /old_locus_tag="TCCBUS3UF1_6620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433723.1"
                     /db_xref="GI:752794291"
                     /translation="MRVGVLKGFLSRRYLGFWEAYLGALGVEVVRAEVPPDRRQPYCL
                     PVQGLLAQVEALKAQGVDYLLLPDLQGGVESERGGGACPWLLDLEAALLRYYPGLPPV
                     LKVPAELSERTLGRAGEVGQILTQNPMLVGRALDRAKGLLKPPPPPKTPLGSVGVVAQ
                     PYLLEDEAFRQEVGEALARVDLLPYFPDLPPERLREEGQKLLPMDLPTDRELLGMLHY
                     LGRLGRVKGLLLVVSYACPPIPSLLRRAARRLSKPYRLLTLGEDWQEPLRSLKGEMTG
                     EA"
     gene            645944..647680
                     /locus_tag="TCCBUS3UF1_RS03240"
                     /old_locus_tag="TCCBUS3UF1_6630"
     CDS             645944..647680
                     /locus_tag="TCCBUS3UF1_RS03240"
                     /old_locus_tag="TCCBUS3UF1_6630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014515071.1"
                     /db_xref="GI:504327969"
                     /translation="MTGQSPSPLRRLLPYLAPYGWRYALGVALGLLSILFFVLTPYFL
                     RLAVDAVGHGGPYGRYALLLLLSAGVSALLSYFMRRLAVVASRQVEYDLRRDLFHHLL
                     RLDRGFYHATRVGDLMNRLNTDLSAVREMVGPGIMMGSRLSFLVLLAFLSMYAVDARL
                     AFYLTLILPAIALAIFYLLRLIDRRYREAQEAFDAISTLAQEAFSGIRVVKGYALEGR
                     MLSRFQELNRAYMAKSLALAKVEGPMQALLGFLMGFAFLTVLWVGGGMVVQGAMSVGE
                     LVQFNAYLAQLTWPILGLGWVMAMYQRGLTSLRRLLELLDQKPAIQDQDPLPLRPKDL
                     SGEVRFQGVGLRLGGRWLLKDITLTLPEGMTLGITGRTGAGKSLLAALIPRLLDPTEG
                     TVYVGGYEARRIPLAVLRRVVGVAPQEPFLFSETLWANIAFGLETPDRTRVEWAAKLA
                     GIHEEILAFPKGYETVLGERGVTLSGGQRQRVALARALAKTPRILILDDALSAVDTET
                     EARILQGLKTVLGRQTTLLISHRTATLRHADWIIVLDGGRIVEEGTHESLLEAGGLYA
                     ELDRIQRMEVEE"
     gene            647677..649482
                     /locus_tag="TCCBUS3UF1_RS03245"
                     /old_locus_tag="TCCBUS3UF1_6640"
     CDS             647677..649482
                     /locus_tag="TCCBUS3UF1_RS03245"
                     /old_locus_tag="TCCBUS3UF1_6640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xenobiotic ABC transporter ATP-binding protein"
                     /protein_id="WP_014515072.1"
                     /db_xref="GI:504327970"
                     /translation="MTQEDAYSKAFDRVLFARILQYVKPYRFQVGLALFFLLLTTLAA
                     AATPLFFKWAIDGVLVPKEPKPLAERYALLLWISLGFLLVRGVHFAATYGQTYLIGWV
                     GQRVLFDLRSGLFAKLMLLHPGFYDKNPVGRLMTRVTSDVDAINQFITGGLVGVIADF
                     FTLFGLLAFMLALSPKLTLVVLLVVPVLLWVTAWVRNGMRAAYREMRLRLARVNAALQ
                     ENLSGVETIQLFVRERERGEGFDRLAQDLLRAWVEIVRWFALFFPVVGFLGDLAVAGL
                     LYYGGGEVVRGVVSLGLLVAFVDYTRQLFQPLQDLSDKFNLFQGAMASAERIFGVLDA
                     EEELKDPEDPKPIARFRGEVEFRDVWLAYTPKGVEPTEKDWVLKGVSFRIRPGEKVAL
                     VGATGAGKTSVVSLIARFYDPKRGQVCLDGEDVRRYRQEELRRHVGIVLQDPFLFSGT
                     ILDNLRIFDEGIPEERVEEVARFLGVHEAILRLPQGYHTRVGERGAGLSTGEKQLLAL
                     VRALIYSPDILLILDEATANVDSETERRLQEALYKAMEGRTSIVIAHRLSTIRRVDRI
                     LVFRKGRLVEEGTHEELLQRGGYYATLYRLQYAEG"
     gene            649491..650684
                     /locus_tag="TCCBUS3UF1_RS03250"
                     /old_locus_tag="TCCBUS3UF1_6650"
     CDS             649491..650684
                     /locus_tag="TCCBUS3UF1_RS03250"
                     /old_locus_tag="TCCBUS3UF1_6650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="folylpolyglutamate synthase"
                     /protein_id="WP_041433725.1"
                     /db_xref="GI:752794293"
                     /translation="MTYREALEWLFARRRQGERGTGRVREVLRRLGHPEDAFPAVHVL
                     GTNGKGSVVAYLEAAFRAAGLPFGAYTSPHLLDFRERIRTHLGLIPEERVVAFAAWAM
                     GEAWPEPPGFFDLATALAFLHFRERGVALAAVEAGVGGEKDATNALSRVALTVLTHVG
                     EDHLEALGGSLEAVARDKAGAFRPGVPVVTGARGVGLEVAARLARERGAPLYLLDPED
                     PLFALPAPPGLRGAFQEENARLAAAALRLLGFPEGVIAQGLREARNPGRLERFLLGRV
                     EVYLDGAHNPPAAQALAREFAGYHLVFGAFPRKDVAGMLAHLLPKAASVRFAQAGQGA
                     LGRELGEPFFPDPWEALLDAAGKALEDGLPVLATGSLYLVGALRGRLAPFTPGLPPGS
                     SPQDR"
     gene            complement(650641..651690)
                     /locus_tag="TCCBUS3UF1_RS03255"
                     /old_locus_tag="TCCBUS3UF1_6660"
     CDS             complement(650641..651690)
                     /locus_tag="TCCBUS3UF1_RS03255"
                     /old_locus_tag="TCCBUS3UF1_6660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515074.1"
                     /db_xref="GI:504327972"
                     /translation="MRKGLLFPLLLPLLAACQVLEGSGYRVAEAQLLFPEATERWTYF
                     YGEPREVRLAGKPLRLEKALGESLWAVPGALWVEGNPVLREVGPALKPLAEAVRGVSG
                     SLVEVRAQAPLRTTWLYDGVGWVRLTGSLREGERRTLVQPTAYQSPDLYAFTAGETGV
                     LLREILARRGGRQVVLFELYEPVLRPLALDPAPDAYRVGGLLVQYGLRVELVSPPAPL
                     YRVLDQGANAAYAETEARAYLANNPTRFAEVWNLAVGNRLPRPPAPSVDFRTRSVAAF
                     FWGLKPTGGYRLEVAGVTYSAGTARVVLSLASPQPGAIVTQALTSPYVLLELERVSRV
                     VFTDPGGRTLAEARE"
     gene            complement(651737..652756)
                     /locus_tag="TCCBUS3UF1_RS03260"
                     /old_locus_tag="TCCBUS3UF1_6670"
     CDS             complement(651737..652756)
                     /locus_tag="TCCBUS3UF1_RS03260"
                     /old_locus_tag="TCCBUS3UF1_6670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014515075.1"
                     /db_xref="GI:504327973"
                     /translation="MTRPWRRFRRNRLAQAGSLLLLLYLLGALFAPFLAPYSPYAQDL
                     RSAYVPPLAGVSLRGPQGEVGLYVSPAYRHPLEGVQVDWSQKYPVRLLVRGDEWQWLG
                     LRGNLHLFGVEGPVRLYLLGTDEQGRDLFSRILYGIPVSLSIGLVAVSIGLFLGAPLG
                     ALSAYFGGRMDLLVQRLVDVMLAFPGILLAIVLVAILGTGLGNAMIAVGIAAIPIYAR
                     LVRGGVLSLKALDYVEAARALGASHGRILLRHLLPNALGPILIQTSLQMAIAILFAAG
                     LGFLGLGARPPEPEWGLMLARGREYLAVAPHVATFPGLAIVGLVLAFNLLGDALRDAL
                     DPRSH"
     gene            complement(652749..653669)
                     /locus_tag="TCCBUS3UF1_RS03265"
                     /old_locus_tag="TCCBUS3UF1_6680"
     CDS             complement(652749..653669)
                     /locus_tag="TCCBUS3UF1_RS03265"
                     /old_locus_tag="TCCBUS3UF1_6680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter permease"
                     /protein_id="WP_014515076.1"
                     /db_xref="GI:504327974"
                     /translation="MLTYALRRLLIALPTLFGVVLLVFLMVRLAPGDPAVLLAGEFAT
                     PETLEAIRARYGLDRPLPEQFLLYLKALAQGDLGESAKSRRPVLEELKTYFPNTVQLA
                     SAAILVALLTGIPLGILAALRPGSGLDLAVMVLALVGVSMPVFWFGLLAILIFSVELG
                     WFPVAGKGTLAHLVLPAITLGVNATALLARMTRGTLLEVLSQDYIRTARAKGVSERVV
                     ILKHALRNALIPVVTVAGLEFGSLLAGAVITETIFAWPGLGQLLVGSILARDYPVVQG
                     AVLLVAFSFILVNLLVDLLYAWIDPRVRYD"
     gene            complement(653728..655236)
                     /locus_tag="TCCBUS3UF1_RS03270"
                     /old_locus_tag="TCCBUS3UF1_6690"
     CDS             complement(653728..655236)
                     /locus_tag="TCCBUS3UF1_RS03270"
                     /old_locus_tag="TCCBUS3UF1_6690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014515077.1"
                     /db_xref="GI:504327975"
                     /translation="MRNVLLAFGIALLGLAWAQQRLVVAQGTDPITLDAPLAQDSPSA
                     TVVTHISETLFELTPEGRIVPLLAEGHSFSDGGKTLTIRLKRGITFHDGTPFNAEAVK
                     FNLERFVSRELASPFAFLLSELERVEVVDPYTVRLRLKNPFAPVLAHLTHSSTAMQSP
                     AAIQRFGAQYRDNPVGTGPYRFQAWQKGQFVDLVRNENYWGEKPPIPQVRFIPVPEGT
                     TRVALVETGQAHVAVRIPPQDIARLQANRAIEVVRTPSLRTIYIYFNTQRPPFNDVRV
                     RQALNHAVNKEEILQFVLGGIGRVSDAPIAPGIFGYTPVGKYEYNPQRAQELLRQAGV
                     STPFRVTLHCPTGRYFQDIQVCEAIQGQLRRVGVEATIQTLEWGAYLQETQRPLKDNR
                     IQMAMLGWGTVTGDADYGLYPLFHSSQWAPGFNRSFFKNAEVDKLLAQARISTLPQGR
                     QQLYREAMTRIWQNAPWLFLHSEVQVTAVRQEVQGFIVHPTERYLAYKARFR"
     gene            complement(655324..656037)
                     /locus_tag="TCCBUS3UF1_RS03275"
                     /old_locus_tag="TCCBUS3UF1_6700"
     CDS             complement(655324..656037)
                     /locus_tag="TCCBUS3UF1_RS03275"
                     /old_locus_tag="TCCBUS3UF1_6700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003044480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATPase"
                     /protein_id="WP_014515078.1"
                     /db_xref="GI:504327976"
                     /translation="MSLLELKEVHTYYGHIHALKGVSLRVEEGEIVTLIGSNGAGKST
                     TLRTISGLVRPRQGEVLFQGRPIHRLPAHQIVALGVGHVPEGRKIFPRLSVEENLEIG
                     AFLERDRKVVQERKEQVFALFPRLYERRGQKGGTLSGGEQQMLAIGRALMQNPRILLM
                     DEPSMGLAPVLVDFIFETIQRLNQEGKTILLVEQNARLALQIAHRGYVLATGQITLSG
                     AARELAENPEVQKAYLGEG"
     gene            complement(656034..656813)
                     /locus_tag="TCCBUS3UF1_RS03280"
                     /old_locus_tag="TCCBUS3UF1_6710"
     CDS             complement(656034..656813)
                     /locus_tag="TCCBUS3UF1_RS03280"
                     /old_locus_tag="TCCBUS3UF1_6710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003044483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014515079.1"
                     /db_xref="GI:504327977"
                     /translation="MKALEVTHATKRFGGLVAVNDVSLSVEQGEIFSVIGPNGAGKTT
                     FFNLLTGIYTPDEGKILLFGKDVTGLSPDRIAQEGVGRTFQNIRLFGAMTVLENLLVG
                     MHIHIRVPYFHAVFRTPLARREERRAEEEAKRLLEYVGLLHRKDELAKNLPYGEQRKL
                     EIARALALRPRLLLLDEPAAGMNPKETEELQAFIQKLRDELGITIVLIEHDMRLVMRI
                     SDRIAVLEYGSKIAEGTPEEVRQNPRVIEAYLGKGAAGGAA"
     gene            complement(656810..658138)
                     /locus_tag="TCCBUS3UF1_RS03285"
                     /old_locus_tag="TCCBUS3UF1_6720"
     CDS             complement(656810..658138)
                     /locus_tag="TCCBUS3UF1_RS03285"
                     /old_locus_tag="TCCBUS3UF1_6720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_014515080.1"
                     /db_xref="GI:504327978"
                     /translation="MSALSFLLSLAYLGLAFLAPGALSHLLGLLALGVSAFARLSPGA
                     RTLNLALLTLAFTVGLMGSGNTLGLIGLVGILVALTTLPRIPTWIRALLGLAILLLSV
                     PLAGFANTFIFELGIQIGIYAAMALGLNVVVGMAGLLDLGYAAFFAVGAYTWAIFGSE
                     QAKNFLQGEFPLPGEYVYLFMLIAILTTALTGLLIGLPALRLRGDYLAIVTLGLGEVV
                     RILANNLDHPINFTNGPQGITPIARPPIDWFREAMAALGVRLDQTTDYQLFFYLLVLL
                     MIGLVVLVNVNLANSRFGRAWVAIREDEIAARSMGIPLLPTKLLAFMTGAAFSGVMGV
                     IFAAQRTFVSPESFTLLASITILGMVILGGMGSIPGAILGAAALTILNLDILKSFSEF
                     VRTSLPQIPSQVDPAKYERLVFGLILVLMMIFRPEGLIPEKRHKAEMEEA"
     gene            complement(658135..659103)
                     /locus_tag="TCCBUS3UF1_RS03290"
                     /old_locus_tag="TCCBUS3UF1_6730"
     CDS             complement(658135..659103)
                     /locus_tag="TCCBUS3UF1_RS03290"
                     /old_locus_tag="TCCBUS3UF1_6730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008632793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014515081.1"
                     /db_xref="GI:504327979"
                     /translation="MLEQILVLLPQVIFDGFILGFVYAMVALGYTMVYGVLELINFAH
                     SEIFMIGAVVGVEVFRYLAPHVENGFLLLLLALVLGGAISGLTAILVERFAYRPLRKR
                     GTTNRLVPLITAIGVSFILQDLVRLIEGLWHNEFFLRMRTVEDLEGSVELFGGAIFAQ
                     NKSFILMGVSILMLLGLTYLVNRTKLGVAIRAVAQDLSTASLMGIDPDRIISRTFLIG
                     GSLGGVAGVLFALQYTTITPYVGFLPGLKAFTAAVLGGIGNIPGAMLGGLVLGQLENF
                     FGTYLPILTNGNFGTEYKDVVAFLILILILLLRPQGLLGQVVKEKV"
     gene            complement(659169..660341)
                     /locus_tag="TCCBUS3UF1_RS03295"
                     /old_locus_tag="TCCBUS3UF1_6740"
     CDS             complement(659169..660341)
                     /locus_tag="TCCBUS3UF1_RS03295"
                     /old_locus_tag="TCCBUS3UF1_6740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014515082.1"
                     /db_xref="GI:504327980"
                     /translation="MRKIGLLVAGVAALGMALGQANVIKIATQSPLSGPQAALGEQIK
                     LGAELAVEEAKAKFRQLGFDLVLVPYDDQANPDVGVANANRIINDPDILGVVGHLNSG
                     VAIPSSEVYARVGLVMVSPANTNPRVTDRRLPNVNRICGRDDVQGPVGAEYAFNNLKV
                     KNVFVIHDKTAYGQGLAEEFRKRLEALGGKAVAFVGTEETANFVPIINQIRGARPTPE
                     LIYFGGIYSQIGPFVKQLRERGLKTRVMGGDGLDSSEFVRLAGKENAAGTYYTTVAGP
                     VSAFPKAKELAQRFKQKYGKEIEGFGIYAYDSANVILAALEAAIKAAGGKKPTREQVA
                     QEVRKVKLEGLTGSIEFDDKGDNKRAKYFVMQVAASGNWADNKLIRTIELAAPGAR"
     gene            complement(660489..661829)
                     /locus_tag="TCCBUS3UF1_RS03300"
                     /old_locus_tag="TCCBUS3UF1_6750"
     CDS             complement(660489..661829)
                     /locus_tag="TCCBUS3UF1_RS03300"
                     /old_locus_tag="TCCBUS3UF1_6750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003048009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_014515083.1"
                     /db_xref="GI:504327981"
                     /translation="MGYTKAEILKALKEEKVQFLRLQITDILGLVKNVEVPASQFEKA
                     LDGEIMFDGSSIEGFTRIEESDMLLKPDYNTFVILPDLVEDPARGRVARLICDVTYPD
                     GRPFEGDPRYVLKRQVERLQKLGFDNMYAGPEPEFFLFLRTPEGLPTVETHDKAGYFD
                     LAPIDKGEEARRDMVNALVAMGFEIEASHHEVAPGQHEIDFKYADALTTADNIATFKW
                     VVKRIALNHGLHATFLPKPIRGINGSGMHTHLSLFKEGQNAFFDPNAEYQLSQTALHF
                     IAGLLEHAEGMVAITNPLVNSYKRLTPGYEAPTNIAWSASNRSAMIRIPARRGVGTRA
                     ELRMPDPSSNPYLALAVMAAAAMDGIERKLLPPPPIQRNIYQMSVRERRKHKIRELPG
                     TLREALEALKKDPVIREALGEHVYTHFLQAKQMEWDDYRVTVHQWELDQYLATY"
     gene            662017..663684
                     /locus_tag="TCCBUS3UF1_RS03305"
                     /old_locus_tag="TCCBUS3UF1_6760"
     CDS             662017..663684
                     /locus_tag="TCCBUS3UF1_RS03305"
                     /old_locus_tag="TCCBUS3UF1_6760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_014515084.1"
                     /db_xref="GI:504327982"
                     /translation="MTKAFRRRDLLKAGGALGLAGLGLGRAQGAFTLTLVHTNDTHAR
                     LEPTELTLSGQRVKVGGVAQRIAFFDRLRGQRRNLLFLDAGDVFQGTLYFNQYRGLAD
                     RYFMHRALYRVMALGNHEFDLGPGPLAEFLKGAKFKVVSANLGLEREPRLQGLVAPYA
                     VLSVGGERVGVIGLTTPDTREIANPGPTVDFLDPYESAQKAVFALLKQGVNKIVVLSH
                     LGYGEDLKLARRLVGAQVIVGGHSHTLLGSFPHRELSPAGPYPTVVKNPEGKDVLVVQ
                     AWEWGKVVGLLEVTFDAKGEVVAYKGQPFLMTPEVAPEDFFAKEALMAYAQPVMALMA
                     QVIAEARVDLVGERAIVRRRESNLGNLIADGMLWKTRNAGTQIALQNGGGIRASIPKG
                     PITVGKVYEVLPFGNTLVVMDLKGREIKAALENGVSQWEAQAGRFLQVAGLRYAFDLS
                     RPAGDRVVRVEVRTPGGFVPLNLEATYRVVVNNFIAAGGDGFTVLKEAQGYRVDTGFS
                     DAESFMDYLRELKAVEPRLEGRIEVLNEPKGEKPAYWAFQMPEGVGV"
     gene            complement(663718..664161)
                     /locus_tag="TCCBUS3UF1_RS03310"
                     /old_locus_tag="TCCBUS3UF1_6770"
     CDS             complement(663718..664161)
                     /locus_tag="TCCBUS3UF1_RS03310"
                     /old_locus_tag="TCCBUS3UF1_6770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosysynthesis protein"
                     /protein_id="WP_041433727.1"
                     /db_xref="GI:752794295"
                     /translation="MRGRVVSLHLGVGPGLPKDPVAALELVAGLGAKGDRHAGKDPDR
                     AVLVAGLPAYGKAQEAGINLPYGALGENLLLDLDPHTLPPGARLQVGEAVLELTSLCT
                     VCRSLSQFDLRLPKLLYGGRGVYARVLQGGWVRVGDGVKVLTLAE"
     gene            complement(664158..664847)
                     /locus_tag="TCCBUS3UF1_RS03315"
                     /old_locus_tag="TCCBUS3UF1_6780"
     CDS             complement(664158..664847)
                     /locus_tag="TCCBUS3UF1_RS03315"
                     /old_locus_tag="TCCBUS3UF1_6780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C552"
                     /protein_id="WP_041433728.1"
                     /db_xref="GI:752794296"
                     /translation="MKRFLAPMGLLALGLAGYLALGQYTLPEGPGKDLVLAKCQACHD
                     IGFVARERLSRERWDAILTEMVSRGLQITPEERAAILDYLALYLGLQPPPAPPPVQAQ
                     AKTGAQVYASCAGCHGPQGEGNPPTFPPLKGHVEKLLRVEGGRNYLLLAVLYGVQGPI
                     KVEGQEYSGIMPGFTWLSDEELALVLNHLLTWGAPQGVRPYTPAEVKAAREKPLGPEE
                     VLKARQGLKLP"
     gene            complement(664907..666130)
                     /locus_tag="TCCBUS3UF1_RS03320"
                     /old_locus_tag="TCCBUS3UF1_6790"
     CDS             complement(664907..666130)
                     /locus_tag="TCCBUS3UF1_RS03320"
                     /old_locus_tag="TCCBUS3UF1_6790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfite oxidase"
                     /protein_id="WP_014515087.1"
                     /db_xref="GI:504327985"
                     /translation="MGKVNRRTTLKLMGLGAAFLAVGGRGLAQQAPTADQLVRGKDRR
                     LLVLSQRPIVLETPYELLAANAERTPKEILYIRNNVDLPGYNTVEGANLEGWKVQVGG
                     LVDKPFTFEAKELLSLPQQEVTMVLQCSGNGRTLYQPRPSGNPWKRGGVGNVTFRGVR
                     LRDLLAAKGAKLLDKAFHITAHASRQGNAPEFVRSVPIHALENALLALSMNGEPLPAV
                     HGGPVRLVFPGYFGVNHVKWVEKIEFTEGENTTTEQMPRYRVPAIPNTQLPFLPQEPG
                     KTYPYSFQNSRPNWLVTLNSFIFAPLEGQTVRGPYVRVEGVAFNDGIAPIVSVELSTN
                     GGRSWHRAELERTEKTFGWVRWRGTVYLRPGEHEVMARAWDAAGRSQPLDGNVAWNER
                     GYEYSGVMRVRFTVS"
     gene            666311..668737
                     /locus_tag="TCCBUS3UF1_RS03325"
                     /old_locus_tag="TCCBUS3UF1_6800"
     CDS             666311..668737
                     /locus_tag="TCCBUS3UF1_RS03325"
                     /old_locus_tag="TCCBUS3UF1_6800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_014515088.1"
                     /db_xref="GI:504327986"
                     /translation="MLKGEGPGPLPPLLQQYVELRDRYPDYLLLFQVGDFYECFGEDA
                     ERLARALGLALTHKSSKDFTTPMAGIPIRAFDAYAERLLKLGFRLAVADQVEPAEEAE
                     GLVRREVTQLLTPGTLVQESLLPKEANYLAALATGDGWGVAFLDVSTGEFKGTVLHGK
                     SALYDELFRHRPAEVLLAPELRENPEFVEEFQKRFPVMLSEAPFDPVGEGPLALRRAQ
                     GALLAYARATQGGTLSVRPFRFYDPGAFMRLPEATLRALEVFEPLRGQDTLFGVLDET
                     RTAPGRRLLQGWLRHPLLDPGPLEARLSRVERFVREGALREGVRRLLFRLADLERLAT
                     RLELGRAGPRDLAALRRSLALLPELKALLGEEVGLPDLSALLGELQAALVEDPPLKLS
                     EGGLIREGYDPHLDLLRRAHREGVAYFLELEEGEKARTGIPTLKVGYNAVFGYYLEVT
                     RPYYDRVPPEYKPIQTLKDRQRYTLPELKERERELYRLEAQIRRREEEVFLEVRERAK
                     GEVEALREAARVLAELDVYAALAEVAVRYGYTRPRFGGRLRIVAGRHPVVERRTAFVP
                     NDLEMAGELVLVTGPNMAGKSTFLRQTALIALLAQVGSFVPAEEAELPLFDRILTRIG
                     ASDDLAGGRSTFMVEMEEVALILKEATERSLVLLDEVGRGTSSLDGVAIATAVAEALH
                     ERRCYALFATHYFELTALPLPRLKNLHVAAKEEEGGLTFYHQVLPGPASKSYGVEVAR
                     LAGLPPAVVERAQALLQAMAARREGLAAEVLERLLALDPDRLTPLEALRLLHELRALA
                     LGTPLGTMKG"
     gene            668734..670353
                     /locus_tag="TCCBUS3UF1_RS03330"
                     /old_locus_tag="TCCBUS3UF1_6810"
     CDS             668734..670353
                     /locus_tag="TCCBUS3UF1_RS03330"
                     /old_locus_tag="TCCBUS3UF1_6810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_014515089.1"
                     /db_xref="GI:504327987"
                     /translation="MIRPLPEALRGLLARGEVLLSVRDAVRELLENALDAGARRVVVE
                     LHGGGLERLVVEDDGAGIPLEELPLAVEPFATSKLEDPSRIATLGFRGQALYALRQAA
                     SLRIRSRPRGQLGGGLLVVQGERVELKEVPAPPGTRVEVVGLFRGEGREAGRELKGVL
                     DLLRRYLLHHPSLSLALFAEGEARLLFPGAGLLQAAQLAFGRVLADRLLPLEAREGGL
                     HLGGLLSGPQASRTRPDLLFLAVNGRPVAWPEGLLKALRRAYQGLLPEGHFPVGVVNL
                     YLPPDLYRLRLDARKEEVALAKEVEDFLEGALRGLFRRLDLARALPEPKPLFPLAPPT
                     PSGLPRLRYLGQFRDSYLLAEGGDTLYVVDQHAAHERLLYEAFWAQLQAEGPKPLAYP
                     VLVDLAPEEEGLLGGEALDALFAYEPFGPGRVRLLAAPAFLHPYPLLLPEVFREALKG
                     EERSLKDLLARLACLPAVKAGHPLGQAEGQALLDALVACQTPWVCPHGRPVLLALKEE
                     ELIRRFGRRSGARAGGEARPRPLPESFPGGS"
     gene            complement(670262..670756)
                     /locus_tag="TCCBUS3UF1_RS03335"
     CDS             complement(670262..670756)
                     /locus_tag="TCCBUS3UF1_RS03335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014629343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="WP_041433730.1"
                     /db_xref="GI:752794298"
                     /translation="MELITTDLSDAHPEADTLPMVYKSFGGRKRFAGRVRTLRVREDN
                     ALVRQVLEEEGKGQVLVVDCGGSLRTALLGGNLARLAWERGWTGVVVHGAVRDTAELQ
                     SLSLGILALAATPKKSAKEGQGEVDVPLELWGVRILPGSFLVADEDGLLLLPAPPSGG
                     QSGG"
     gene            670775..671632
                     /locus_tag="TCCBUS3UF1_RS03340"
                     /old_locus_tag="TCCBUS3UF1_6820"
     CDS             670775..671632
                     /locus_tag="TCCBUS3UF1_RS03340"
                     /old_locus_tag="TCCBUS3UF1_6820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016328782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_041433731.1"
                     /db_xref="GI:752794299"
                     /translation="MEEARLLITCPDRPGIVAAVSGFLYAHGANITDLQQHSTDPEGG
                     TFFMRLAFTTPHLDLSRPALERAFQEVVAARFAMEWRLAYAAEKKRAAILVSKPAHAL
                     LELLWRYRVGELPMDLRLVVSNHPDHREEVERFGIPYHHVPVEKGRKEEAEEAILARL
                     EAEGVELVILARYMQVLSPAFVARYPMRIINIHHSFLPAFAGANPYRQAYERGVKLIG
                     ATAHYVTAELDAGPIIEQDVVRVSHRHSVAEMRRLGQELERTVLARAVRWHLEDRIIV
                     HGNKTVVFV"
     gene            671679..672902
                     /locus_tag="TCCBUS3UF1_RS03345"
                     /old_locus_tag="TCCBUS3UF1_6830"
     CDS             671679..672902
                     /locus_tag="TCCBUS3UF1_RS03345"
                     /old_locus_tag="TCCBUS3UF1_6830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_014515091.1"
                     /db_xref="GI:504327989"
                     /translation="MNLGRSFVGFLVLSLMAGAVLWWGLSNGQTGRPQTPQAAPTAEA
                     GLLEYERNTVEIVEKYGDGVVYVGVVTRPQSVQLPPGFEFFAPFLQTPPQEGTGSGFV
                     IDKEGYILTNYHVVEGASRITVKFHNDPQEYQARLVGAAPPLDLALLKVNAPKERLSP
                     LVLGDSDRIRVGQKAIAMGNPFGLEFTVTQGIVSAIRENPGAIGDDSGLVPQVIQTDA
                     AINPGNSGGPLLNSRGEVIGINTAIFTPTGQFGAAQFAGVGFALPINLVKQYLPDLRA
                     GKTLTAEEIVRSRPRLGVSLIPLSLYPERLRQQYGLPAVGLMVQEVERNSPAARAGLR
                     PPSRLAYIQLPSGEALQVGVDGDVLLKADGVPLTAIAQLRQVLYAKKPGEAVSLEVWR
                     QGRTLTLKVVPQVLR"
     gene            complement(672899..673291)
                     /locus_tag="TCCBUS3UF1_RS03350"
                     /old_locus_tag="TCCBUS3UF1_6840"
     CDS             complement(672899..673291)
                     /locus_tag="TCCBUS3UF1_RS03350"
                     /old_locus_tag="TCCBUS3UF1_6840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433733.1"
                     /db_xref="GI:752794301"
                     /translation="MARLLRSWAFWVFLALLALVRVVEVEGEGRRYLLLLPWEEGRVE
                     FVNSVTGRPVLLEFGLAWDFRGFRAFTDPETEAYYTGGEYPWNQALAQERRRELRFCS
                     EVGLAVRLGGTWFRAEGACLRLRLLWPP"
     gene            complement(673332..674309)
                     /locus_tag="TCCBUS3UF1_RS03355"
                     /old_locus_tag="TCCBUS3UF1_6850"
     CDS             complement(673332..674309)
                     /locus_tag="TCCBUS3UF1_RS03355"
                     /old_locus_tag="TCCBUS3UF1_6850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter"
                     /protein_id="WP_014515093.1"
                     /db_xref="GI:504327991"
                     /translation="MKKVLLALLALWGLAVAQKPRVVIATGGVGGVYFYYGTTLAEIW
                     NKAGVAEAQAIQTAASIDNLLLLENRTGGGTYYCGTVLPDSAYLAYTGQHDRFKERPA
                     KSARILFAMYPNFLHIVTREGAGIRVVQDLKGKRVSTGAPGSGTEVEALLVLQAAGLS
                     PKDFAKQERLGAQESANALAEGNIDAFFWSGGLPTGAITELSAALARKGQRIYLVPID
                     PKSTVAQTFQRRFPGLAGPGVIPKATYGARTDTPSLAFWNLFVCPESLPAEAAYALTK
                     ATFENLATLRQAVAAARDTTLENAVRFVGGTIPYHEGALRYFREAGALR"
     gene            complement(674334..676499)
                     /locus_tag="TCCBUS3UF1_RS03360"
                     /old_locus_tag="TCCBUS3UF1_6860"
     CDS             complement(674334..676499)
                     /locus_tag="TCCBUS3UF1_RS03360"
                     /old_locus_tag="TCCBUS3UF1_6860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_041433734.1"
                     /db_xref="GI:752794302"
                     /translation="MSWAPPGPGPFWRQRMELEHPSTPQTPLARLAQGILILGALYSL
                     YLVLHPFTPLARAEIPILDIVQLQRSTHVLFLLLGGYLVSFYLPRKRTLGAWVYFLFT
                     LVPLYNFLFPGVPGVSLPWEAKAVGLLYWAVAALPALLPGLKRPADLLAVLLALFPTL
                     YQLRYFEELVYRAVLPQPWDMAMSFGLIMLVLGLVYRLLGPVMPVLVLFFFSYNLYAD
                     LFPGAFRGSRQGIDLLLGKTFNETEAGIYGLITGVSAKYLVYFTLLSGMIGALGLGKV
                     VANLALALVGKHPATPGRVTGLASVFMGMFSGSGAADTQFVAALTKPLFEKARYHQLT
                     AAGLVATAGTIALITPPVMGSIAFIMVEILQIPYLKVIIMALGPALLYLTAVLAFNEF
                     YSRKAGLPPVGAELGMGRRAYALRYSTLFLPILLIIVMLYLGYEVRTAASLALVLFVL
                     IAYLDPTLRPKGVAPILQGLAEGFRTLLPIGTAVTAANLIFAMMVISGLPSKFSQLLQ
                     QVSGESLFLATLITAVFSLVLGMGVPPTATYVLTSALTAPAIIALAKQNGIPDSAALL
                     ATHMFLFYYAVLADVTPPVALSAYAASSVFGTNPLQTGVYAARVALSKYLVGFFFLLS
                     YSGTALLIVPVLENSPPGEAWPMILERFFSVAAGIIYLSASGAGYTRRPLKRWEAWAL
                     GTLAVLLFVPHGPLNLAAFLLGLPFFSRGKGLTRAGRGA"
     gene            complement(676516..677499)
                     /locus_tag="TCCBUS3UF1_RS03365"
                     /old_locus_tag="TCCBUS3UF1_6870"
     CDS             complement(676516..677499)
                     /locus_tag="TCCBUS3UF1_RS03365"
                     /old_locus_tag="TCCBUS3UF1_6870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter"
                     /protein_id="WP_014515095.1"
                     /db_xref="GI:504327993"
                     /translation="MKRALLLISLVALGLALAQKPKVVIGTGSTGGVFFYYGTALADI
                     LNKAGVAEAQPVQTGGSYDNLQLLRDRTGGGTYYCALSTTDSAYVAYTGEEPRFKDRP
                     AKGQRILFYMYPSFIHIVTTEKSGIKVVQDLKGKRVSTGQPGSSTENLALLVLQGAGV
                     KPESFAKRERLPVAEGAKALAEGTLDAFFWVGGVPTSSIVELSQTLARKGDRVYLIPV
                     DPKSTTAQVVTKRFPGLVDSYTVPKSVYNTRTDVPGLATGNIVVCPESLPAEAAYGVI
                     KAVFENLDTLRTAVAAAKDTSLEATAKLYGKLPIPFHPGAERYLKEKGLIK"
     gene            complement(677532..678635)
                     /locus_tag="TCCBUS3UF1_RS03370"
                     /old_locus_tag="TCCBUS3UF1_6880"
     CDS             complement(677532..678635)
                     /locus_tag="TCCBUS3UF1_RS03370"
                     /old_locus_tag="TCCBUS3UF1_6880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M50"
                     /protein_id="WP_014515096.1"
                     /db_xref="GI:504327994"
                     /translation="MLQRGLLLFPVLGIPIYLDLSFLVVLPLWAFLIGSNLPLYLQLF
                     GLGTDPSLLQGPWPFLLGLLAALGLFLSVLLHELGHALAARSLGVATRRITLWLLGGV
                     AQMERIPREPPKELKIALAGPGVSFALALLFRLVWGEGGAWGFLSHYLAWVNLMLGLF
                     NLLPALPLDGGRVYRALLALRRPYLRATRQAVALSQGVAVALGLLGLLVLNPFLILVA
                     FFVYMASRAEAEATLLAQALEGLKVRDLMTQDPIAIPPHLPVAEALSLALAYRVSGFP
                     VVEGGQVLGVVGLEGLEGADLQAPVARYLQVPLILSPEDEALSALERMAERGYARGLV
                     LKGGRLVGILSKTDLLRAFQVRLLGLDRPTGVG"
     gene            678702..679895
                     /locus_tag="TCCBUS3UF1_RS03375"
                     /old_locus_tag="TCCBUS3UF1_6890"
     CDS             678702..679895
                     /locus_tag="TCCBUS3UF1_RS03375"
                     /old_locus_tag="TCCBUS3UF1_6890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014515097.1"
                     /db_xref="GI:504327995"
                     /translation="MLALALLKDPLYRPYWLALFTSQMGTWMQSAAQGWLVLLLTGSA
                     ERLGLVVALQFLPSLLFSLPAGVLADRYPKRNLLLLTQGGMMLLALLMGLLILTGWVR
                     YGHVLLFAFLYGALNAMDLPVRQSFTVELAGRERYPGAIALNSFGFNTSRLLGPALSG
                     FLIALFGVGVAYLANALSFLPLLLVLRRVPPGPRGEGDGRWWREAQEGVRFVLEHPLV
                     RRVVGLVLFASLLGMNFQTLVPAYARLVLGLSATGYGFLVSSVGLGALGAALVMAFTG
                     RPKPVRLLLGVFLLALAHLGLFLPKPALAPLFLALGGFGMISVLINANTLVQLSVPDR
                     LRGRVMAVYSLVMLGTGPLGAYLTGLLFEALGGRWAALALGGVVLLVGLYQLRPWPKG
                     PSPPA"
     gene            complement(679870..680988)
                     /locus_tag="TCCBUS3UF1_RS03380"
                     /old_locus_tag="TCCBUS3UF1_6900"
     CDS             complement(679870..680988)
                     /locus_tag="TCCBUS3UF1_RS03380"
                     /old_locus_tag="TCCBUS3UF1_6900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 2-epimerase"
                     /protein_id="WP_014515098.1"
                     /db_xref="GI:504327996"
                     /translation="MKRVVLAFGTRPEATKMAPVYLALRGLPHLEPLILLTGQHREQL
                     RQALSLFGLREDRNLDVMQERQTLPDLAARILPQAARALREMRADYVLVHGDTLTTFA
                     VAWAAFLEGIPMGHVEAGLRSGNLKEPFPEEANRRLTDVLTDLDFAPTPLAKANLLRE
                     GKGEAGILVTGQTGVDAVLLAARLGRLPEGLPPGPYVTVTMHRRENWPILGELARALR
                     RVAEAFPHLTFVYPVHLNPVVREAVYPVLKGVRNFVLLDPLEYGPMAALIRESLLLVT
                     DSGGLQEEGAALGVPVVVLRNVTERPEGLEAGILKLAGTDPEGVYRTVKGLLESPEEL
                     SRMRQAKNPYGDGKAGERVARGVAWRLGLGPRPADWDP"
     gene            complement(680985..682079)
                     /locus_tag="TCCBUS3UF1_RS03385"
                     /old_locus_tag="TCCBUS3UF1_6910"
     CDS             complement(680985..682079)
                     /locus_tag="TCCBUS3UF1_RS03385"
                     /old_locus_tag="TCCBUS3UF1_6910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_014515099.1"
                     /db_xref="GI:504327997"
                     /translation="MSELLKRIGVAEPTGTGWVTVAFAFLLALFFTWRFLPHVRRFAL
                     KVGWADQPNERRLNREPLPNAGGLAVYAGVVLALVVAAFLRPILVEQVLIQVLAILLG
                     GAWLVLVGFMDDQFGLPPLFRLFVQTLAALLLMAVGIRFEAAFGTPLDPALGLLLTWL
                     WVVGITNALNLMDGLDGLAGGIAYISAVSLLFVSAQFPFWAAGTLVLAALAGAALGFL
                     RHNLHPSRIILGDAGAYFLGYTLAATALLGNLKLTTFLGLLPPILFLLLPILDTTQVV
                     VRRLLKGQNPLSTPGKDHIHHRLLARGLSQRRVAFALWGVALAFNLLAMAYLGMPLEA
                     VGASLLASVLGLAWVTYRRLKALWRGEVGG"
     gene            complement(682076..682702)
                     /gene="upp"
                     /locus_tag="TCCBUS3UF1_RS03390"
                     /old_locus_tag="TCCBUS3UF1_6920"
     CDS             complement(682076..682702)
                     /gene="upp"
                     /locus_tag="TCCBUS3UF1_RS03390"
                     /old_locus_tag="TCCBUS3UF1_6920"
                     /EC_number="2.4.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515100.1"
                     /note="Catalyzes the formation of uracil and
                     5-phospho-alpha-D-ribosy 1-diphosphate from UMP and
                     diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_041433736.1"
                     /db_xref="GI:752794304"
                     /translation="MRITLVDHPLVQHKLAHLRDKRTGAKDFRELAEELSLLMAYEAM
                     RDLELRETLVETPVAPARVKVLSGKKLALVAILRAGLVMVEGILKLVPHARVGHIGLY
                     RDPESLKPVQYYAKLPPDIAERRVFLLDPMLATGGSASHALGLLKARGAKGVKLMCLI
                     AAPEGLERIRQDHPDTEVVVAAIDERLNEHGYIVPGLGDAGDRIYGTK"
     gene            complement(682713..683555)
                     /locus_tag="TCCBUS3UF1_RS03395"
                     /old_locus_tag="TCCBUS3UF1_6930"
     CDS             complement(682713..683555)
                     /locus_tag="TCCBUS3UF1_RS03395"
                     /old_locus_tag="TCCBUS3UF1_6930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_014515101.1"
                     /db_xref="GI:504327999"
                     /translation="MALSALQGLLSPQVLAHLTPLGGFEARVYTDGERVYKVYRPEEA
                     HLAALEARRMARAGLGSFVLGVEVVEGQGVLITRRFPGKPFSPEAFTQKTLAALSHLF
                     LSLHRLPEPGGVRREALLERLERFRESLHPFPEALALLEALEREVDLAAGAEHRFCHR
                     DAWAGNLLLKEAGQEGPEVMLVDWVRAGGDDPARDLALLKTGSLDLLGEGAAREALFR
                     LARLYPKEVRERLAFYVPLTYLHDLHWFRTKHPEGFAEALKEKLPRAASFLRDCLPRR
                     GGAC"
     gene            683574..684647
                     /locus_tag="TCCBUS3UF1_RS03400"
                     /old_locus_tag="TCCBUS3UF1_6940"
     CDS             683574..684647
                     /locus_tag="TCCBUS3UF1_RS03400"
                     /old_locus_tag="TCCBUS3UF1_6940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014515102.1"
                     /db_xref="GI:504328000"
                     /translation="MELLRPEATLLSLGERVLSFDREGRPYHYFRQGRTYKRSLDGSL
                     HLRHREGERRRRRLGEEEALQVYQEILALAEAHLQDPTRRAEVLRWTPEALLDPTPYR
                     RAYPWPVSILPPEAYLSVVLQATTGCTWNRCAFCAFYQDRPFQKRTPEVFAEHLERVL
                     ALLGRGRLLRRGVFLADGNALSLGEPLLPLLEAVGRAFPGEAVQGFLDLFTGLRKEAS
                     WWERLRALGLRRVHLGLETGHAPLLRLLNKPGHPQEAIPLVRALKGAGLSLGVIFLVG
                     AGGKAFAEAHRRESLALLAQLSLDRGDVVYLSPFQEAPGTPYALWGLEPLEDLEGEVR
                     AWAQGVRRLGLRAARYDVREFLY"
     gene            complement(684641..685069)
                     /locus_tag="TCCBUS3UF1_RS03405"
                     /old_locus_tag="TCCBUS3UF1_6960"
     CDS             complement(684641..685069)
                     /locus_tag="TCCBUS3UF1_RS03405"
                     /old_locus_tag="TCCBUS3UF1_6960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009107905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515103.1"
                     /db_xref="GI:504328001"
                     /translation="MSPYLLSMALVVASLTLYQVAQRAMPPTANPFALLVLVYGVALA
                     LSALGLLLYPAKGGLADLLREPSWAPWALGLAVVGIELGYLLVYRTGWPLALAPVVAN
                     VGTLLLLVPLGFLFFRESLSPGQLLGLLLALLGFILLRSQ"
     gene            complement(685066..685275)
                     /locus_tag="TCCBUS3UF1_RS03410"
                     /old_locus_tag="TCCBUS3UF1_6950"
     CDS             complement(685066..685275)
                     /locus_tag="TCCBUS3UF1_RS03410"
                     /old_locus_tag="TCCBUS3UF1_6950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-binding protein"
                     /protein_id="WP_014515104.1"
                     /db_xref="GI:504328002"
                     /translation="MRLRFRENGPYVLDLPQGTPFRWQGEERKREGPSWPFAALGYSR
                     EKPFCDGSHKEAGFQGEGGEVPGEG"
     gene            complement(685340..685627)
                     /locus_tag="TCCBUS3UF1_RS03415"
     CDS             complement(685340..685627)
                     /locus_tag="TCCBUS3UF1_RS03415"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433738.1"
                     /db_xref="GI:752794306"
                     /translation="MEEGVADLPGQGLEVLPPLPGDPPHLHPLGAEGKAQTLGQGADE
                     GQVLPAFRAEGVVQVGHHPLPPGPAHQVGQGHGIPAPGHRQDQGVLRGQAG"
     gene            complement(686471..>686818)
                     /locus_tag="TCCBUS3UF1_RS03420"
     CDS             complement(686471..>686818)
                     /locus_tag="TCCBUS3UF1_RS03420"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433740.1"
                     /db_xref="GI:752794308"
                     /translation="LPEPGEEIPQKLSTGALQDATPHPTPLAEAGEGPFLEVFRPVDH
                     LHPGLLQGVVAHAAGLEGHVKPPPPGLLARLAQEKEFRMGRGVLEGLHPVVGPEDPSP
                     HHQNRPHRHLPLP"
     gene            686815..686906
                     /locus_tag="TCCBUS3UF1_RS03425"
                     /old_locus_tag="TCCBUS3UF1_t70"
     tRNA            686815..686906
                     /locus_tag="TCCBUS3UF1_RS03425"
                     /old_locus_tag="TCCBUS3UF1_t70"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:686849..686851,aa:Ser,seq:cga)
     gene            complement(686932..687537)
                     /locus_tag="TCCBUS3UF1_RS03430"
                     /old_locus_tag="TCCBUS3UF1_6980"
     CDS             complement(686932..687537)
                     /locus_tag="TCCBUS3UF1_RS03430"
                     /old_locus_tag="TCCBUS3UF1_6980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515106.1"
                     /db_xref="GI:504328004"
                     /translation="MSPQEAWRALELDLADYLAHKGVKPSCQAGCFACCFGLVTLSRL
                     EGEALLPQLTEGQRARLLEEGPRRLALLAEGKDQADFPSRFFRSRTPCPFLEGGLCGV
                     YPHRPLACRGLLTAHDPSLCHPEAQTPPDHFLKVPWRMAHLRMERLWEEEQRRYGFAV
                     IGELGSLLYLLLRGLPPEREGVEALLQTLGVLGGSWGFQVV"
     gene            complement(687534..687740)
                     /locus_tag="TCCBUS3UF1_RS03435"
                     /old_locus_tag="TCCBUS3UF1_6990"
     CDS             complement(687534..687740)
                     /locus_tag="TCCBUS3UF1_RS03435"
                     /old_locus_tag="TCCBUS3UF1_6990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515107.1"
                     /db_xref="GI:504328005"
                     /translation="MEPLALFGLALLLYLLYLLRPKPPARCPRCGLPRALAEEVRRHR
                     RFCPHLAFRACPFDPRKGVYRLRR"
     gene            687771..688259
                     /locus_tag="TCCBUS3UF1_RS03440"
                     /old_locus_tag="TCCBUS3UF1_7000"
     CDS             687771..688259
                     /locus_tag="TCCBUS3UF1_RS03440"
                     /old_locus_tag="TCCBUS3UF1_7000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515108.1"
                     /db_xref="GI:504328006"
                     /translation="MPAPFLEPLVPGVPPAVSAWIRGLEEVALHLEGWAFDLPEEAFW
                     WRPKEEANPIGGLVRHIAGSSLRLGAYALGLGLPGWATRGREWELRGEAEPKAVVVAR
                     FREAWDGLLAAFREVREEALSEEVAVGHLGVRAPRAHVLHHLVEHAQHHAGQVIYARK
                     LL"
     gene            688298..688708
                     /locus_tag="TCCBUS3UF1_RS03445"
                     /old_locus_tag="TCCBUS3UF1_7010"
     CDS             688298..688708
                     /locus_tag="TCCBUS3UF1_RS03445"
                     /old_locus_tag="TCCBUS3UF1_7010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515109.1"
                     /db_xref="GI:504328007"
                     /translation="MERIGLRAAPRLTLEALKEALKGFRLPEAKVYLVTDWQDRREKA
                     RYALLLHGGKKDLLTPDAFGPAFPGGEEALAELVAYLLQGGARRFYEAVVSPGEMTAL
                     LDLPPEVLLKRVGAIANPTDPGIYLRGGLPVKGP"
     gene            complement(688688..689545)
                     /locus_tag="TCCBUS3UF1_RS03450"
                     /old_locus_tag="TCCBUS3UF1_7020"
     CDS             complement(688688..689545)
                     /locus_tag="TCCBUS3UF1_RS03450"
                     /old_locus_tag="TCCBUS3UF1_7020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA lyase"
                     /protein_id="WP_041433741.1"
                     /db_xref="GI:752794309"
                     /translation="MGAVKWVECPRDAWQGFSRFIPTEEKVAFLEKLLAAGFRHLDLT
                     SFVSPRWVPQMADAEEVLAALPPPQGRTYLAIVANEKGLERALATQNLTHVGYPFSLS
                     ETFQRRNTNRSLEESWPLVAEMVRATRGRLGLVVYLSMAFGNPYGDPWDAERVLEAIA
                     RLREVGVGEIALADTYGLAEPERIFAVLQKAVERFGPEGLGAHLHARPEGVLAKVEAV
                     LEAGVLWLEGALAGVGGCPFAGDELVGNLPTERVLPFLEARGLRTGVDLETLPGLAGE
                     AARLRALYG"
     gene            complement(689550..691211)
                     /locus_tag="TCCBUS3UF1_RS03455"
                     /old_locus_tag="TCCBUS3UF1_7030"
     CDS             complement(689550..691211)
                     /locus_tag="TCCBUS3UF1_RS03455"
                     /old_locus_tag="TCCBUS3UF1_7030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylcrotonoyl-CoA carboxylase"
                     /protein_id="WP_014515111.1"
                     /db_xref="GI:504328009"
                     /translation="MPGERAHKLPLEDPGQKANKDAWVALVRDFKESLERVRQGGGPK
                     AVERQHQKGRLTARERIARLIDPGTEFYELMAFAGYGMYGEWGGAPAGGVVTGLGRIA
                     GRDWMIIANDATVKAGAFFPITAKKVIRAQTIALENRIPTVYLVDSAGVFLPLQDEVF
                     PDQDDFGRIFYLNARMSALGIPQISAIMGNCVAGGAYLPVMTDILLMTEGSGLYLAGP
                     ALVKAAIGQEVSSEELGGARMHAEVSGTVDFYEPTDEAALERIRKLAALYPPPRLAPW
                     AEGRKEPQEPRYPPEDLYGLVAPDGSRPYDLREVIARLVDGSEFLEYKGGYGETLVTG
                     FARIGGFPVGIVGNQRLVLKKKGRIEVGGVIYPEAADKAARFILEVNQVGIPLLFLQD
                     VSGFMVGKEAEQAGIIRRGAKLVNAVSNSRVPKITLILGGSFGAGNYALAGKAYGPRF
                     LFAWPSAKYAVMGGAQAAKTLLELEVEKLKREGKEPSDEDLKELYERIKGRYEETLDP
                     RYAAARLWVDGVIFPHETRKWLIKALEACALNPEMEPFRVGVFQV"
     gene            complement(691266..691730)
                     /locus_tag="TCCBUS3UF1_RS03460"
                     /old_locus_tag="TCCBUS3UF1_7040"
     CDS             complement(691266..691730)
                     /locus_tag="TCCBUS3UF1_RS03460"
                     /old_locus_tag="TCCBUS3UF1_7040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="WP_014515112.1"
                     /db_xref="GI:504328010"
                     /translation="MKRVELFTDGASLGNPGPGGWAALLRYAGREKLLFGGEACTTNN
                     RMELTAALEGLRALKEPCEVDLYTDSQYLQKALDEGWLERWAKNGWRTREGKPVKNQD
                     LWQALLQAMAGHRVRFHWVRGHAGHPENGRVDREARRQAQEQKAKVQAPCPP"
     gene            complement(691738..692118)
                     /locus_tag="TCCBUS3UF1_RS03465"
                     /old_locus_tag="TCCBUS3UF1_7050"
     CDS             complement(691738..692118)
                     /locus_tag="TCCBUS3UF1_RS03465"
                     /old_locus_tag="TCCBUS3UF1_7050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018460741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="WP_014515113.1"
                     /db_xref="GI:504328011"
                     /translation="MEVLETSVYARDLEGARAFYEGVLGLPCFQFKPPRHAFFRAGRG
                     VFLVFNPELTEGDETLPPHGARGSVHVAFRVAEEELPLWERRLLAAGFPVWWAQWPKG
                     KSLYTRDPEGNLVELAPASIWGLE"
     gene            complement(692120..692407)
                     /locus_tag="TCCBUS3UF1_RS03470"
                     /old_locus_tag="TCCBUS3UF1_7060"
     CDS             complement(692120..692407)
                     /locus_tag="TCCBUS3UF1_RS03470"
                     /old_locus_tag="TCCBUS3UF1_7060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019550282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GYD protein"
                     /protein_id="WP_014515114.1"
                     /db_xref="GI:504328012"
                     /translation="MPTFIVLSTLTDDGAETLVKNPERIKEVNQELERDFGVKVVAQY
                     AVLGPYDFVNIVEAADATSVARAMLHLASRGSVKTTTLEAIPVADLIAKLK"
     gene            complement(692498..694009)
                     /gene="guaA"
                     /locus_tag="TCCBUS3UF1_RS03475"
                     /old_locus_tag="TCCBUS3UF1_7080"
     CDS             complement(692498..694009)
                     /gene="guaA"
                     /locus_tag="TCCBUS3UF1_RS03475"
                     /old_locus_tag="TCCBUS3UF1_7080"
                     /EC_number="6.3.5.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515116.1"
                     /note="contains glutamine-hydrolyzing domain and glutamine
                     amidotransferase; GMP-binding domain; functions to produce
                     GMP from XMP in the IMP pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP synthase"
                     /protein_id="WP_041433952.1"
                     /db_xref="GI:752794521"
                     /translation="MVLVLDFGSQYTRLIARRLRELRAFSLILPGTAPLEEVLRHNPQ
                     ALILSGGPNSVFDPHAPRPDPRVLRLGLPTLGICYGMQLLAQELGGKVERAGRAEYGK
                     ALLTRHTGPLFRGLEGEVQVWMSHQDAVTELPPGWRVSGETEENPVAAMEAPDGKTFA
                     VQFHPEVAHTPKGMQMLENFLELAGVRRDWTPEHILEERVREVRERVGGERVLLALSG
                     GVDSSTLALLLAKAGVDHLAVFVDHGLLRLGEREEVEGALRALGVNLRVVEAKGRFLK
                     ALKGVEDPEEKRKIIGRAFVEVFSGVAREEGPFRFLAQGTLYPDVIESAGGHGAAKIK
                     SHHNVGGLPEDLGFELLEPFRLLFKDEVRELALLLGLPDPIRLRHPFPGPGLAVRILG
                     EVTEERLSILRQADDLFTSLLREWGLYGQVAQALAVLTPLRSVGVAGDERKYGYVLAL
                     RAVTTEDFMTADWARLPLEFLDEVARRITRRVPEIGRVVYDITSKPPATIEWE"
     gene            694041..694508
                     /locus_tag="TCCBUS3UF1_RS03480"
                     /old_locus_tag="TCCBUS3UF1_7090"
     CDS             694041..694508
                     /locus_tag="TCCBUS3UF1_RS03480"
                     /old_locus_tag="TCCBUS3UF1_7090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="WP_014515117.1"
                     /db_xref="GI:504328015"
                     /translation="MAEVESFALDHTKVRAPYVRLAGRKPLGGGVVEKYDLRLAQPNR
                     EAIPTASLHTLEHLLAGYLRDHLEGVIDLSPMGCRTGFYLVAEGPLGEEAVLVALERA
                     LRDVLVHQGPIPGAGFRACGNYRDHDLQGAKAWAEKVLREGLKVQPTVPLEGA"
     gene            694505..695167
                     /locus_tag="TCCBUS3UF1_RS03485"
                     /old_locus_tag="TCCBUS3UF1_7100"
     CDS             694505..695167
                     /locus_tag="TCCBUS3UF1_RS03485"
                     /old_locus_tag="TCCBUS3UF1_7100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylhomocysteine nucleosidase"
                     /protein_id="WP_014515118.1"
                     /db_xref="GI:504328016"
                     /translation="MTAFFAAEPEEARALRQALGAEETLEAPFPLHLGPGVLVAETGV
                     GKVAAAMAVAHVLTRFAPEAGFFLGVAGALDPGLRALDLLLAERAVQWDVDLTPFGRA
                     PGETALGLRFFPSDPLLLGRAEAAARALGFSARRGVVATGDRFLASREEAERLRALHG
                     ASAVEMEGAAALMVAWRFRRPMALVRAVTDGAGEGAAADFQAFLEEASRRLGLLARAL
                     VY"
     gene            695183..696106
                     /locus_tag="TCCBUS3UF1_RS03490"
                     /old_locus_tag="TCCBUS3UF1_7110"
     CDS             695183..696106
                     /locus_tag="TCCBUS3UF1_RS03490"
                     /old_locus_tag="TCCBUS3UF1_7110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_014515119.1"
                     /db_xref="GI:504328017"
                     /translation="MGIRLFTGSAHPDLARRVAEALGVPLGQALVDRFPDGEVRVRLL
                     ESVRGDDVYLIQPTSPPVNDHLMELLLLADAARRSSAGRINAVIPYFGYARQDKQTEG
                     REPVSAKLVANLLEAVGIHRVVAIDLHAPQIQGFFDIPVDHLSAVRLFARYLRERGYG
                     ENAVVVSPDAGRAEEARRLSERLGLPFAMLAKRRHGPRETEVTYVIGDVAGKRPLVVD
                     DIVSTGGTIRRGVEALLQAGALPEVVVLATHPVLVGGAKENLAHPAIREVVFTDTIPL
                     RDGGYTVLSTAELLAQAIRHVHTNQSVSALI"
     gene            696181..696801
                     /locus_tag="TCCBUS3UF1_RS03495"
                     /old_locus_tag="TCCBUS3UF1_7120"
     CDS             696181..696801
                     /locus_tag="TCCBUS3UF1_RS03495"
                     /old_locus_tag="TCCBUS3UF1_7120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25"
                     /protein_id="WP_014515120.1"
                     /db_xref="GI:504328018"
                     /translation="MEYRLKAYYREGERPSALRRAGKLPGVMYNKSLNRKVYVELGEF
                     DKVFRQAAIHHVIVLELPDGQELPTLVRQVNLDKRKRRPEHVDFYVLSDEPVEMYIPL
                     RFVGTPQGVREGGVLQEVHRDILVRVSPRNIPEFIEVDVSGLGIGDSLHAADLKLPEG
                     VRLAVSPEETIAAVVPPEDVEKLAAEALEAPAEPEVIKKGKKEEEA"
     gene            696853..697425
                     /locus_tag="TCCBUS3UF1_RS03500"
                     /old_locus_tag="TCCBUS3UF1_7130"
     CDS             696853..697425
                     /locus_tag="TCCBUS3UF1_RS03500"
                     /old_locus_tag="TCCBUS3UF1_7130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_014515121.1"
                     /db_xref="GI:504328019"
                     /translation="MFLVVGQGNPGEAYAKTRHNVGFMVLDRLGLAFRRKGEALWAEA
                     ELGGKRGIFLKPLTYYNLTGRAVASLVRFYRIPPERILVVHDEMDLPLGRLRLRAGGS
                     PAGNRGVASIAEALGTEAFHRLRIGIGKPPSRGEGAAYVLSPFSPEEEPLVERVLAVA
                     AEAVACWVREGLLPCAGRYNGLDLRQGDKL"
     gene            697428..698396
                     /locus_tag="TCCBUS3UF1_RS03505"
                     /old_locus_tag="TCCBUS3UF1_7140"
     CDS             697428..698396
                     /locus_tag="TCCBUS3UF1_RS03505"
                     /old_locus_tag="TCCBUS3UF1_7140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase"
                     /protein_id="WP_014515122.1"
                     /db_xref="GI:504328020"
                     /translation="MALPRVLLIAGGRSPEHEVSLLSARGVLEHMPFPTELAVIAKDG
                     GWLLGERALGALGAGQALQGEHPFPPDLDWNRYDVVFPLLHGRWGEDGTLQGFLELLG
                     RPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVALYPGERPFLPFEPPYFVKPANT
                     GSSVGIRRVESHAGLEEALEEAFRHDGKAVVEKALLGVRELEVGVLGNVFAEASPVGE
                     VRYQAPFYDYETKYTPGRAELLIPAPLDPGTQETIQEMALKAYRLLGIRGMARVDFFL
                     VEGEVYLNEINTIPGFTPTSMYPKLFQAAGVSYPELLKRLVELALA"
     gene            698447..699238
                     /locus_tag="TCCBUS3UF1_RS03510"
                     /old_locus_tag="TCCBUS3UF1_7150"
     CDS             698447..699238
                     /locus_tag="TCCBUS3UF1_RS03510"
                     /old_locus_tag="TCCBUS3UF1_7150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515123.1"
                     /db_xref="GI:504328021"
                     /translation="MEVLARLGLEGRRVLILHHDDLGLTHAQNAAYQALGFPTGSVMV
                     PGAWAGGVRGRDLGVHLTLTSEWSAPRMRPLTQGESLRDGAGFFPGSLEALWTQACPE
                     EVERELRAQIEAAFRLFAPTHLDVHQGAALRPDLAEIYLRLAIAYRLPPLLPESLEGL
                     GVPPAFLPHLERLLAQAPFPKVRFLDPYGLPPEERLGFYLGLAGLPPGLYQLVHHSAL
                     PTPEGRALPDWPTREADYFALAHPEVRRVLAEFHPLTWAEIREAL"
     gene            699235..700488
                     /locus_tag="TCCBUS3UF1_RS03515"
                     /old_locus_tag="TCCBUS3UF1_7160"
     CDS             699235..700488
                     /locus_tag="TCCBUS3UF1_RS03515"
                     /old_locus_tag="TCCBUS3UF1_7160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014515124.1"
                     /db_xref="GI:504328022"
                     /translation="MKPWRYASGQLGLTLVSESFGTYLAFFYLERLGLSAAFYALART
                     AYAFWDAVNDPLLGHLSDRTKTPWGRRRPWLLLGIPLFLLFYLLVFWVPDWARNPGVL
                     PYYFALAIVLYETAATVVWTNHGALFPEMFRNLPERARAAALKRGTELFGLILGIALA
                     PVVYAQVGFFGMALLFAGLSLFAFLFFLGGVAEDPRAGSGLGLLPSFRLVLGNRAFWV
                     AALVGLLFEFGRTVIQTGMAFYAKYSLGLPEAATTFLFAAVFLVALPSVFLWGRLAQA
                     LGGKRAWRLAHLLMGLAALLLFLPQSLPAALLVGALVGAGFAGVRVTGEVVMAKVIDL
                     DAERTGTRREGAYYSLVGLLGRASGALVGLSFALLGPLFGYVSGENPGPNPGLAFRFL
                     LSVVPGAAILLAYGLTALFPHEVRE"
     gene            700502..702550
                     /locus_tag="TCCBUS3UF1_RS03520"
                     /old_locus_tag="TCCBUS3UF1_7170"
     CDS             700502..702550
                     /locus_tag="TCCBUS3UF1_RS03520"
                     /old_locus_tag="TCCBUS3UF1_7170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="WP_014515125.1"
                     /db_xref="GI:504328023"
                     /translation="MRLERALFLAHGALDPGGLPPEGWREVALPHQWALEGLEAEVGW
                     YRLSLPPGGPRRFLRAWGDYFQEAWLEGRYLGRHEGYFLPWTLELPPGEVLYLRVSAP
                     KEPPGQWPRFKRQIKGVLGQHDCRPGGSGPRGQERGTGGLWGGVEVLFREGVALLGLT
                     HRLHPRPGGWRLLLRFLVDAPGPFREAVRLRLRPENFPGEALEKTLTLEGEGGRAWRE
                     GVWDLPEMPLWEVWERGFPHLFRLEAELLGANATAPLGFRTVALDGEGWLLLNGRRLF
                     LRGTNHIPTQWLAGYTEAQAQRDVALLKEAHLNAVRIHAHVTHPAFYQACDREGVLIW
                     QDFPLQWGYAPDEAFAQEALRQARGMVDLLGAHPSLYLWCAQNEPTHNRHALGPLLGA
                     ALRAQDPTRPVKEASDFREHPYPGWYWGHYRDFLALPGSPLPSEFGAQALPRAELLRR
                     VLGEAAWPPQWEVWAYHNFQPHETFRVAGVRMGESLEAFVENSQAYQARLLEFAIHAY
                     RRAKGRVVGYFQFLFAEPWEGITWAVLDVERVPKKGFFALKEASSPVLLSLIPYREAV
                     EVGSAPLQEAWLVSDLERPLTLWVYLRLEGPENLDLFHDEVGLAPGEVRRFFSLGELW
                     ESPLEVQARWQPLQEALRRLPPGAYRLVGEAWEEERLWSRHVLELTYLEPLLPLEAAW
                     "
     gene            702611..703657
                     /locus_tag="TCCBUS3UF1_RS03525"
                     /old_locus_tag="TCCBUS3UF1_7180"
     CDS             702611..703657
                     /locus_tag="TCCBUS3UF1_RS03525"
                     /old_locus_tag="TCCBUS3UF1_7180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="galactose-1-phosphate uridylyltransferase"
                     /protein_id="WP_014515126.1"
                     /db_xref="GI:504328024"
                     /translation="MREVYRLHHRKRDGRELILYGFSPVAEAPLPELEEAFHPTPHLR
                     YHPLRGEWVVYAAHRQERTFLPPKEHCPLCPSRPGGFPTEIPFPRFQVAVFENRFPAL
                     VQNPPPAPEGLPIPTGQAGGRSEVVVYTPGHEGSLATLSEEERLLLAWVWRERYQALY
                     AQEGVRFVMPFENRGEAVGVTLHHPHGQIYAYPFVPPVVQREAQAFREGPVLLELLPA
                     LEAYAVDQEEGFLAFVPPFARYPYEVWVVPRARHPGPWTFSEAEMAAFARLLGRVVAR
                     YDALFAEPFPYVMVFHAAPLGEERTFHFHVEFYPPRRTRDRLKFLAGTELGAGTFVVD
                     ALPEDTARKLKEAL"
     gene            703654..705138
                     /gene="glpK"
                     /locus_tag="TCCBUS3UF1_RS03530"
                     /old_locus_tag="TCCBUS3UF1_7190"
     CDS             703654..705138
                     /gene="glpK"
                     /locus_tag="TCCBUS3UF1_RS03530"
                     /old_locus_tag="TCCBUS3UF1_7190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515127.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_014515127.1"
                     /db_xref="GI:504328025"
                     /translation="MTYLLALDQGTTSSRAILFTPEGRPVALAQRGFTQHYPRPGWVE
                     HDPLELWESQLWAAQEALRRAGVGAGEVAALGIANQRETTLVWERGTGRPLHPAIVWQ
                     DRRTAPLCQALRERGLEGVFRERTGLLLDPYFSATKLLWLLENVPGLKEKGERGEALF
                     GTVDTWLLYRLTGGQVHATDPTNASRTLLFNLHTGSWDEELLGLLGIPRAMLPEVRPS
                     DGAFGETLPELLGAPIPIRGVLGDQQAALLGQGGLEAGAAKCTYGTGAFLLLHTGERP
                     VLPPQGLLATPAYAPRGGRAYALEGSVFVAGAAVGWLEEVGLLGKGEAEALAGQVEDA
                     GGVYFVPAFTGLGAPYWDPYARGGILGLTRGTTRAHLVRAALEGVAFSVGEVVRAMAE
                     AAGLALGALKADGGMAGNDLFLQIQADLLGVPVLRPGVTETTALGAAWAAGVGVGLLA
                     PEDLKGLWREAARFSPRMPEAKREARYRGWRRAVDRVRGWAEEG"
     gene            705140..706678
                     /locus_tag="TCCBUS3UF1_RS03535"
                     /old_locus_tag="TCCBUS3UF1_7200"
     CDS             705140..706678
                     /locus_tag="TCCBUS3UF1_RS03535"
                     /old_locus_tag="TCCBUS3UF1_7200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_014515128.1"
                     /db_xref="GI:504328026"
                     /translation="MEVSREAFWQRLEGPLDLLVIGGGATGAGVLWEATLRGLRAALV
                     EARDFASGTSSRSTKLLHGGVRYLELALRRLDRRQLRLVVEALRERRVVMDLAPHLAR
                     PLPLLTPLFRPLDLPYYGAGLALYDLLAGRRRLGPSRYLPPRAVARLFPHLPPTLGGV
                     LYLDGQFLDHRLNLLLILSALARGGMALNYAEVRGFLLKGGRVAGAVVRDGLTGKEVE
                     VRAKAVVNAAGPQADGVRRLLDPGLPPLLSPSSGAHLVLDYPLEVGLLLPRTRDGRVL
                     FLLPYRGKALLGTTDLPAPPTACPRPQEAEVAYLLEEVRPYLGDLSGRVRAAWAGLRP
                     LVGQGETRLLVRDHLIREERGLYTLTGGKWTTFRLMAQDLLDRLDQDLAWGLPPSPSH
                     ATPLLGTGPRPSLGLPQGVQEHLYAAYGALAGEVAALGDRPLLPGLPYLEGEVVWAVR
                     REMAQKPLDVLARRLGLALLDQGLAERALPRVVALMAPLLGWGQGQREALLEEARRAL
                     PGLC"
     gene            complement(706680..708527)
                     /locus_tag="TCCBUS3UF1_RS03540"
                     /old_locus_tag="TCCBUS3UF1_7210"
     CDS             complement(706680..708527)
                     /locus_tag="TCCBUS3UF1_RS03540"
                     /old_locus_tag="TCCBUS3UF1_7210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="WP_041433953.1"
                     /db_xref="GI:752794522"
                     /translation="MPQRINPFTLVFLLLLGYLAYTAFTGPPAPTLSYTEFRTLVREG
                     KVAEVTLEETRILGLLKEPQRFPTPQGGSQVARRFAVPLPPAQVADPELLRFLEASGV
                     KIVTKAPSLWPQLLLYVGPTLLLIVFFWFFFLRAQGGAGQVMQFGQSRAKLYGKEKQV
                     STTFKDVAGHEEAKRELMEVVDFLKNPKKYLELGAEIPKGVLLVGPPGTGKTLLARAV
                     AGEAGVPFFSVSASEFMEMFVGVGASRVRSLFEDARRNAPSIIFIDELDSIGRKRGAG
                     IGGGHDEREQTLNQILSEMDGFEKDTSVIVLAATNRPDILDPALLRPGRFDRQVVVGL
                     PALEERKDILLVHMRGKPVAEDVDALELAHLTPGFSGADLKNLVNEAALLAAREGVKA
                     IRKDHFLKALDKIVLGLERPALKLSEEERRAVAYHEAGHAVVGEVLPHADKTEKVSIV
                     PRGMALGARWSKPEERVLVSREHLMDELSVLMAGRVAEELFTGTVTTGAQDDFKRATQ
                     LAKRMVLDWGMGEHFKNIAWGSDSGPIFLGEEIAKKKDHSEETARLIDEDIRKILDEA
                     YAKARQVLLEHAEAMHRIAEELLREETIPGERVRAILREVQPVQRAGED"
     gene            708601..709953
                     /locus_tag="TCCBUS3UF1_RS03545"
                     /old_locus_tag="TCCBUS3UF1_7220"
     CDS             708601..709953
                     /locus_tag="TCCBUS3UF1_RS03545"
                     /old_locus_tag="TCCBUS3UF1_7220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515130.1"
                     /db_xref="GI:504328028"
                     /translation="MRGVLEALHQGDYDTAIERLTRTALFGRPEEAREALLLLAEVHS
                     LYGEEGLDKAHRALEEAYELGELEYSPLYRALLGELLALEGRPEREVLPLFLPTEEPR
                     ARYHQAQALFYLGRFEEALATLKEGLPAFLAWRAEGLRGRALERLGRHAEAAQAYERG
                     AELALGLERYWLLLDAAAMWIEAGEGERALRSLEGAAMAVGEEGAEDAATRHYLLARA
                     HLLLDNPNQALEEVRKALGWEEESGHKAYGTPLLEGQILLRLGRYAEAMERFQEALRR
                     AEAGERAYVLHEMGVAALDQGAYLEAEEHLRALLREEGYPYRAQALADLAEALYRQGR
                     YAEAEEAAREAMAEGALAAGELILGHVAYDLMHLEEALQHYRKAAEAAEEGSREWVGA
                     QEMVVDTLAQLGYRSPEEMLARAEAVLPHVHPADEWHEALLAYRERAEAILRQGRRPN
                     "
     gene            complement(709950..710984)
                     /locus_tag="TCCBUS3UF1_RS03550"
                     /old_locus_tag="TCCBUS3UF1_7230"
     CDS             complement(709950..710984)
                     /locus_tag="TCCBUS3UF1_RS03550"
                     /old_locus_tag="TCCBUS3UF1_7230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018110928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_014515131.1"
                     /db_xref="GI:504328029"
                     /translation="MIRATLEELDLGELLKALEANRRSAVVSFQGRIYGRVHLLSGRI
                     VYARTEPGPHLGEYLVRLGHLTLEEVQELVERQGRENPGTPLGALALELGLIAEEELK
                     EALEAQVLEALATLLGEKEGEILAEPLGEGSQVALPHTLDTGAALMEAARRLDEWRRG
                     QVGPDEVLHLVEDPTRHPLTPEAWTVLELLDGVRRARSVALLSGLPEEEVYHLLHELK
                     SRGLVRPSTLLLEDPLVMVLAESGVVRRLLLYLLEAHRFRVQLPRDLEMALRLLQERP
                     KAVILQGEKALEAARRIRAHPEGKLASLYLVSDTPPGLLFRPLRVLHLPKPLRAQEVL
                     RALSPLRRGG"
     gene            complement(710994..711971)
                     /locus_tag="TCCBUS3UF1_RS03555"
                     /old_locus_tag="TCCBUS3UF1_7240"
     CDS             complement(710994..711971)
                     /locus_tag="TCCBUS3UF1_RS03555"
                     /old_locus_tag="TCCBUS3UF1_7240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="WP_014515132.1"
                     /db_xref="GI:504328030"
                     /translation="MEALPDLALRPKTLDEYIGQEKLKRKLKVYLEAAKARGEPLEHL
                     LLFGPPGLGKTTLAHVIAHELGVNLRVTSGPAIEKPGDLAAILANSLEEGDVLFIDEI
                     HRLSRQAEEHLYPAMEDFKMDIVIGQGPAARTIRLELPRFTLVGATTRPGLITAPLRS
                     RFGIVEHLEYYTLEELAEGVRRDARLLGVGISEEAALEIARRSRGTMRIAKRLFRRVR
                     DFAQVAGEEAISGERAKEALAALGLDELGLERRDREILEVLILRFGGGPVGLQTLATA
                     LSEDPGTLEEVHEPYLIQQGLLKRTPRGRVATERAYRHLGLPLPLEPLL"
     gene            711996..712781
                     /locus_tag="TCCBUS3UF1_RS03560"
                     /old_locus_tag="TCCBUS3UF1_7250"
     CDS             711996..712781
                     /locus_tag="TCCBUS3UF1_RS03560"
                     /old_locus_tag="TCCBUS3UF1_7250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003045068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_041433742.1"
                     /db_xref="GI:752794310"
                     /translation="MRRTVKEFREAKGKRLVYLTAYDYPTARLAEAAGVDALLVGDSL
                     GMVVLGYPSTVPVTLEEILHHTKAVRRGAPDTFVVADLPYLSYATLDRALRAAERLLK
                     EGGADAVKLEGGEEVAEVVAGLTRAGVPVLGHVGLTPQTASQLGGYRLQGRRPEEAER
                     ILRGALALEAAGAYGVVLEMVPALLAKEITERLSVPTIGIGAGPHTDAQILVFHDVVG
                     LYEAFKPRFAKRYLEGGRLIQEALARYAQEVREGLFPGEEHSF"
     gene            complement(<713031..>713297)
                     /locus_tag="TCCBUS3UF1_RS03565"
     CDS             complement(<713031..>713297)
                     /locus_tag="TCCBUS3UF1_RS03565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015935918.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433954.1"
                     /db_xref="GI:752794523"
                     /translation="PSVPSPSPKPPTPSPSPSRSPTSKKLPSSPVKTSPTPSPTPTPS
                     APATTTKISTPPSASPPTPTPSAKSPPRPPSPPPPALPSWQKSSP"
     gene            713483..>715894
                     /locus_tag="TCCBUS3UF1_RS03570"
                     /old_locus_tag="TCCBUS3UF1_7270"
     CDS             713483..>715894
                     /locus_tag="TCCBUS3UF1_RS03570"
                     /old_locus_tag="TCCBUS3UF1_7270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016329717.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041433955.1"
                     /db_xref="GI:752794524"
                     /translation="MFSALERVHAALLEEPRVATATRRLLEVLVEELGVERAALFLYN
                     PEERELQGEVAFGRGPHYTVSTLSFPLEGDGQVPQAFFAPPEGIRQGGDWFLPVVASP
                     EAPCWVEPERLCRLAPRTSLQERSRVCPFCAHFKALGVLLLEKVPKEMEALAPLLARL
                     TALAVRSAHLYEEVFRSRERLSQEVRVLDQVAQFSREIIRHKSPEPLVLALAQTLKAI
                     FGFYRITVALVRGKELRGVLTLKEEEVFWTEDRTRIRFPLEAPDPLAQAARLMKPLLI
                     PREELPSFLRGKHQSLGVVPLVGYVPIADREQVLGVVAVDHGPKGPSVTWHELRYVDA
                     LARVAGVALKNAYAHQELFELSEALARERERLARALEDLPVAVVVLEEERYTGFANRL
                     AREALGLGREVLLDRLPPEVYPALEGKRFHVELGGRTYLASAQRDSGLWILSLTDISE
                     TQLLLKELETRETRFRTLLEHNQDVVYLLDEQGTIRYVTPNVRPVLGYDPLGYQREPV
                     SGLEFVFPEDRSLAANLFRQVLAAPGQEVVGEVRVVNAQGEPRWFEVWARNLLHEPGV
                     GGIVVTLHDLSARKEAERVKEEFIAAVSHELRTPLGVIIGLAEVLQLSPLPERERSHV
                     DLILDSALRLKTMVDNLLDASRLEAGRFEVYRRPTNLASVLEEMARSFQAVAQMARVR
                     FTVEISPSLPAEADPDRVAQVLGNLLSNAFKFTPRGGEVRLWAKAEAGWVEFAVSDTG
                     PGIPEEEVPNLFQRYYRARSQASRGAPGSGLGLYISKAIVEAHGGEIRVDSRPGQGAT
                     FTVRIP"
     gene            715908..716294
                     /locus_tag="TCCBUS3UF1_RS03575"
                     /old_locus_tag="TCCBUS3UF1_7280"
     CDS             715908..716294
                     /locus_tag="TCCBUS3UF1_RS03575"
                     /old_locus_tag="TCCBUS3UF1_7280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_014515136.1"
                     /db_xref="GI:504328034"
                     /translation="MARILVVDDEPFMQHLVALLLEPLGHQVEVASSGEEALGLLDQN
                     SYDLAVCDLVMPGMGGLALLRELHRRGGPPAIALSASVSPSMEAEARQAGAVAFLGKP
                     FPRQELIRTVEAVLGGDHAHDPGGGR"
     gene            716266..716946
                     /locus_tag="TCCBUS3UF1_RS03580"
                     /old_locus_tag="TCCBUS3UF1_7290"
     CDS             716266..716946
                     /locus_tag="TCCBUS3UF1_RS03580"
                     /old_locus_tag="TCCBUS3UF1_7290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011173744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulatory protein"
                     /protein_id="WP_014515137.1"
                     /db_xref="GI:504328035"
                     /translation="MPTILVVDDEPAFREMVSRLLEQEGYRILQAENGEEALGLLGRA
                     DLVVLDINMPKLNGLELLEIIREYDRELPVLMLTAYDKEEDRVTGLTLGADDYMGKPL
                     RAREFLARVKALLRRSKRFEVLRVGSLELDPFTEEARLEGRLLDLSSTEFRLLLALAR
                     HPGATLPRAHLFAQVWGLEEEVDERVVDTTVARLRKKLGDNPKNPRYIATVFGRGYRL
                     LVDQGASP"
     gene            716953..717894
                     /locus_tag="TCCBUS3UF1_RS03585"
                     /old_locus_tag="TCCBUS3UF1_7300"
     CDS             716953..717894
                     /locus_tag="TCCBUS3UF1_RS03585"
                     /old_locus_tag="TCCBUS3UF1_7300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudouridine synthase"
                     /protein_id="WP_041433743.1"
                     /db_xref="GI:752794311"
                     /translation="MGSVVRFRAEGVRLDQAVAEACGVSRARAQDWIQGGRVRVGEKV
                     VAKPAYRLKGEEVLVDPPEEAALVVPEDLPLPVLYEDEDLLVLNKPPGLLTHPAPGVY
                     TGTVVNALLGRYFPPVEAERPELVRPGIVHRLDKDTSGVLVVAKHPGALEALARAFRD
                     RLVMKRYLALTEGYPKEGTLVAPIGRHPVERHKMHVGGVAPRYAETHFQVLATAGPYA
                     LVEARPHTGRTHQIRVHLKHLKAPILGDEVYGRKSPHIGRQALHAYELRIPHPRTGRL
                     LEFLAPVPADMVRAWEALGGSWPEGIGREATEPQGVP"
     gene            complement(717891..719084)
                     /locus_tag="TCCBUS3UF1_RS03590"
                     /old_locus_tag="TCCBUS3UF1_7310"
     CDS             complement(717891..719084)
                     /locus_tag="TCCBUS3UF1_RS03590"
                     /old_locus_tag="TCCBUS3UF1_7310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-aminoadipate aminotransferase"
                     /protein_id="WP_014515139.1"
                     /db_xref="GI:504328037"
                     /translation="MKTLDWSTLFGQRAGRIQASTIRELLKLTARPGVISFAGGLPAP
                     ELFPKEEAAEKAAAILREKGEVALQYGPTEGYLPLRAWVAEWLGVSPEEVLITTGSQQ
                     ALDLLGKVFLDEGSPVLLEAPSYMGAIQAFRAYGPRFLTVPAGEEGPDLTLLEAVLKG
                     ERPRFLYLIPSFQNPSGGLMPLAARQRLLELAMAQGLVVVEDDAYRELYFGQARLPSL
                     FELSREAGYPGVVYLSSFSKVLAPGLRVAFVVAHPEVILKLTQAKQGVDLHTPVLNQI
                     LVHELVREGFPERLERIRAVYRAKAEAMLEALGREMPEEVRYTRPKGGMFVWMELPKG
                     LSAERLFQKAIEENVAFVPGGPFFAAGGGENTLRLSYATMDRARMEEGVRRLGKALKG
                     LLAMV"
     gene            complement(719115..720245)
                     /locus_tag="TCCBUS3UF1_RS03595"
                     /old_locus_tag="TCCBUS3UF1_7320"
     CDS             complement(719115..720245)
                     /locus_tag="TCCBUS3UF1_RS03595"
                     /old_locus_tag="TCCBUS3UF1_7320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515140.1"
                     /note="dGTPase family type 2 subfamily; presumably
                     hydrolyzes dGTP to deoxyguanosine and triphosphate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosinetriphosphate triphosphohydrolase"
                     /protein_id="WP_014515140.1"
                     /db_xref="GI:504328038"
                     /translation="MLFPRERLLEWEAERLAPYAQRSAHTRGREYPEPESPYRTPYQK
                     DRDRILHTTAFRRLEYKTQVFPNWAGDYYRTRLTHTLEVAQVSRSIARALGLNEDLTE
                     AIALSHDLGHPPFGHAGERVLHELMREHGGFEHNAQALRLLTRLEVRYPGFPGLNLTY
                     EVREGVATHEAAYALGSKGDYPGQGTLEAQVVDLSDAIAYAAHDLDDGLRSGLLRPEE
                     LLEVPLLQALAQEEGLDLARLSELARRILVREVLGYLITHAILATHERVERAGVKSAD
                     GVREHPERLAALTPEAERAHGELKAFLRERLYRHPEVLRERRKAEAVLEGLFQAYTRY
                     PETLPKEVQARIPEEGLERAVCDYLAGMTDRFALEAYRKLFP"
     gene            complement(720246..721472)
                     /locus_tag="TCCBUS3UF1_RS03600"
                     /old_locus_tag="TCCBUS3UF1_7330"
     CDS             complement(720246..721472)
                     /locus_tag="TCCBUS3UF1_RS03600"
                     /old_locus_tag="TCCBUS3UF1_7330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_041433744.1"
                     /db_xref="GI:752794312"
                     /translation="MRRVVVTGLGPLTPIGVGAEAYHKAQLEGRSGVGPITRFDASVL
                     PVRIAAEVRVNPEDYLDKKELRRLDRFVQYALIAAELALQDAGLEPEKLPPERVGTLV
                     GTGIGGMETWEAQSKVFLERGPNRISPFFIPMMIANMASAHIAMRYGFRGPSSTVVTA
                     CATGSDAIGSALRMIQLGEADIVLAGGAEAAITPMAIGAFAVMRALSTRNEEPEKASR
                     PFTRSRDGFVMGEGAGVLVLEEYEHARRRGARIYAEVIGFGRSADAHHITEPHPEGQG
                     AALAMRRALEDAGVSPEQVGYINAHGTSTPVGDRAEVLAIKAVFGEHAKKLMVSSTKS
                     MTGHLLGAAGGIEAIATVQALFHGVIPPTINMEDPDPELDLDFVPEPREARVDYALSN
                     SFAFGGQNAVLLFRRV"
     gene            complement(721549..721791)
                     /locus_tag="TCCBUS3UF1_RS03605"
                     /old_locus_tag="TCCBUS3UF1_7340"
     CDS             complement(721549..721791)
                     /locus_tag="TCCBUS3UF1_RS03605"
                     /old_locus_tag="TCCBUS3UF1_7340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_014515142.1"
                     /db_xref="GI:504328040"
                     /translation="MTEQEIFEKVKAVIADKLSVEPEKITLEARFVEDLGADSLDTVE
                     LIMGLEDEFGLEISDEEAEKIRTVKDAVAYIQAKLG"
     gene            complement(721822..722559)
                     /locus_tag="TCCBUS3UF1_RS03610"
                     /old_locus_tag="TCCBUS3UF1_7350"
     CDS             complement(721822..722559)
                     /locus_tag="TCCBUS3UF1_RS03610"
                     /old_locus_tag="TCCBUS3UF1_7350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014630108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_014515143.1"
                     /db_xref="GI:504328041"
                     /translation="MRKALITGASRGIGRAIALRLAREGYALVIHYGQNREKAEEVAE
                     EARRLGSPLVGVLGANLLEAEAAMALVHGAAEILGGLDTLVNNAGITRDTLLVRMKDE
                     DWEAVLEANLSAAFRTTREAVKLMMKARFGRIVHITSVVGILGNPGQANYVAAKAGLI
                     GFTRAVAKEYAARGITVNAVAPGFIQTEMTAKLPKEVQEAYLKGIPAGRFGRPEEVAE
                     AVAFLVSEAAGYITGQTLCVDGGLTPH"
     gene            complement(722552..723469)
                     /locus_tag="TCCBUS3UF1_RS03615"
                     /old_locus_tag="TCCBUS3UF1_7360"
     CDS             complement(722552..723469)
                     /locus_tag="TCCBUS3UF1_RS03615"
                     /old_locus_tag="TCCBUS3UF1_7360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-ACP transacylase"
                     /protein_id="WP_014515144.1"
                     /db_xref="GI:504328042"
                     /translation="MYAALFPGQGSQRVGMGQDLYRAFPAAREVLDRAEAALPGLLKL
                     LWEGPEEALTLTENQQPALLAVGYAAYRAFLEQGGKEPLLAAGHSLGEWTAHVAAGTL
                     ELEDALRLVRLRGRYMQEAVPPGQGAMAAILKLPLEAIREALSDLEGVEIANLNAPEQ
                     TVISGRKEAVEKAAEKLRGLRARVVFLPVSAPFHSSLMAPARERLAAELARVPLRRPR
                     FPVYANATAEPQEDPERIRALLLEQITAPVRWVEILKDMERRGLRRFLEFGSGEVLKG
                     LLARTLPGAEAHSVTDRESLNRALEVADA"
     gene            complement(723469..724437)
                     /locus_tag="TCCBUS3UF1_RS03620"
                     /old_locus_tag="TCCBUS3UF1_7370"
     CDS             complement(723469..724437)
                     /locus_tag="TCCBUS3UF1_RS03620"
                     /old_locus_tag="TCCBUS3UF1_7370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716501.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="WP_014515145.1"
                     /db_xref="GI:504328043"
                     /translation="MSGILALGAYAPSRVMKNEEFEAYLDTSDEWIVTRTGIRERRIA
                     AEDEYTSDLAFRAVEDLLARHPGALEGVDGVIVATNTPDALFPDTAALVQARFGLSAF
                     AYDLLAGCPGWLYGLAQAHALVEAGLARKVLVVGAEALSKILDWNDRATAVLFGDGGG
                     AAVVGKVREGFGFRSFVLGADGTGGKELYHACVAPRLPDGTSMRNRLYMNGREVFKFA
                     VRVMNTATLEAIEKAGLTPEAIKAFIPHQANLRIIDAARERLGLPWERVVVNVDRYGN
                     TSTASIPLALKEAVDGGRIREGDHVLLVSFGAGLTWAAAVLTWGGA"
     gene            complement(724528..724710)
                     /locus_tag="TCCBUS3UF1_RS03625"
                     /old_locus_tag="TCCBUS3UF1_7380"
     CDS             complement(724528..724710)
                     /locus_tag="TCCBUS3UF1_RS03625"
                     /old_locus_tag="TCCBUS3UF1_7380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003048117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="WP_014515146.1"
                     /db_xref="GI:504328044"
                     /translation="MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMRPPHT
                     VCPECGYYDGRKVLEV"
     gene            complement(724773..725309)
                     /locus_tag="TCCBUS3UF1_RS03630"
                     /old_locus_tag="TCCBUS3UF1_7390"
     CDS             complement(724773..725309)
                     /locus_tag="TCCBUS3UF1_RS03630"
                     /old_locus_tag="TCCBUS3UF1_7390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515147.1"
                     /db_xref="GI:504328045"
                     /translation="MEHHEVASINLARLLKEGGTARATGVVREAFQVGEERFPLEGEA
                     RWQVAVSSVGGEEYWLSGEVEGWALMECRRCLKPTPTHVHAHFQHLLRYQQGLGEVVF
                     HEEAEEEYYAFGEPDLDLLPFLTEAFVSEMPYTVLCQEGCQGLCPVCGADRNLEDCGH
                     QVEVHHPLLGLKDLLSEL"
     gene            725301..726269
                     /locus_tag="TCCBUS3UF1_RS03635"
                     /old_locus_tag="TCCBUS3UF1_7400"
     CDS             725301..726269
                     /locus_tag="TCCBUS3UF1_RS03635"
                     /old_locus_tag="TCCBUS3UF1_7400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginase"
                     /protein_id="WP_014515148.1"
                     /db_xref="GI:504328046"
                     /translation="MFHPYKYSPQRAFFLGVRHKLPGRCMGLSATMPPMDRVAVIGVP
                     MDLGSGRRGVDMGPSALRYARLLEELEALGYGVEDLGDVRVPLAETLRARKGPYLEEI
                     RQAALELQERLRALPRGVFPIVLGGDHSLSMGSVSGVARGRLGVVWVDAHADFNTPET
                     SPSGNIHGMPLAVLSGLGHPRLVEAFRSVDPKDVALIGVRSIDPGERRLLGEAGVLVY
                     TMHEVDRLGIARIAEEVLERLSGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHL
                     LMEILAQSGRVQSLDLVEVNPILDERNRTAEMMVGLALSLLGKRIL"
     gene            complement(726270..726638)
                     /locus_tag="TCCBUS3UF1_RS03640"
                     /old_locus_tag="TCCBUS3UF1_7410"
     CDS             complement(726270..726638)
                     /locus_tag="TCCBUS3UF1_RS03640"
                     /old_locus_tag="TCCBUS3UF1_7410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515149.1"
                     /db_xref="GI:504328047"
                     /translation="MDRLSPELLRKDPLAYVARGAEALPKELRGAWLLGVTSGFLWPE
                     APPPKDLPAFFRRLEGAWREAEAFFLETGLDFPVLVSEWARKALEPLLHRKRRPGYPR
                     LRQAFLLGRALGQALRERQP"
     gene            complement(726718..728001)
                     /locus_tag="TCCBUS3UF1_RS03645"
                     /old_locus_tag="TCCBUS3UF1_7420"
     CDS             complement(726718..728001)
                     /locus_tag="TCCBUS3UF1_RS03645"
                     /old_locus_tag="TCCBUS3UF1_7420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014515150.1"
                     /db_xref="GI:504328048"
                     /translation="MTLLVLALFSVVLTLLGFFVSVGIFKRLTLLGLSLGVLALLATW
                     GRAEAFGPYQVDGVSRAFTLLALLGGLWTVGLVRTRRFEFYLLVLYAVTGMHLLASTK
                     NLILMLVALEALSLPLYALATWRRGEGLEAALKYFLLGALAAAFFLYGTALHYGATGS
                     LLAGTPGEGPLYALALGLLLVGLGFKVALAPFHFWTPDVYQGSPTPVVLFMATGVKAA
                     AFAALLRVAAPGAPEALGLLIALSVLVGNLAALAQKEAKRLLAYSSIAHAGYMALALY
                     TGNAQALGFYLLTYVLATGLAFAVLSELSPDRIPLEGLRGLFHRDPLLGLALLVAALS
                     LLGLPPLAGFWGKYLVFTEAAKAGQWGLLVLALLTSAVSAYYYLGLGLAVFQKGEAAT
                     APRPLARGVAFLVALFLLLLGLFPGALLPAFALGG"
     gene            complement(727998..729407)
                     /locus_tag="TCCBUS3UF1_RS03650"
                     /old_locus_tag="TCCBUS3UF1_7430"
     CDS             complement(727998..729407)
                     /locus_tag="TCCBUS3UF1_RS03650"
                     /old_locus_tag="TCCBUS3UF1_7430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014515151.1"
                     /db_xref="GI:504328049"
                     /translation="MVVLAILLPILFGILLLLGLPRVLGLLGAGLGFLLNLYLFLTHP
                     GGVAHGVELPLLPGAGVYWAFGLDGLSALFFLTLGLTVFLGALVARVEGRFLGLALLM
                     EGLLLGLFAARDLVVFYLFFEAALIPALLMLLLYGGAGRVRALYTFLLFTLAGSLPML
                     AAILAVKVLGGSPTFLLSDLLAHPVKGSAAFWVFLGFALAFAIKTPLFPLHAWLPLFH
                     QENHPSGLADALGTLYKVGVFAFFRFAIPLAPEGFAELQGLLLLLAALGALYGAWVAF
                     SAQDFKTLLAYAGISHMGVAALGVFSGTEEGALGGLYLLAASGIYTGGLFLLAGRLYE
                     RVHTLEIGRYRGLAQSAPGLAALALFLFLAMVGLPGLSGFPGEFLTLLGAYQASPWLT
                     ALAFLSVIAGAAYALTAFQRVFWERGDKGVKDLAQEEWPFAFLAVAALVLMGVFPGFF
                     LEGLRPLAEAFAQLLGGGA"
     gene            complement(729401..731221)
                     /locus_tag="TCCBUS3UF1_RS03655"
                     /old_locus_tag="TCCBUS3UF1_7440"
     CDS             complement(729401..731221)
                     /locus_tag="TCCBUS3UF1_RS03655"
                     /old_locus_tag="TCCBUS3UF1_7440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018111773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014515152.1"
                     /db_xref="GI:504328050"
                     /translation="MALLLTILLPLLGFALLGLFGKRMREPWPGVLASGLVLASFLLG
                     VGLLLQGGARFQVEWLPGIPFSLLLDNLSGFMLMIVAGVGFLIHVYAIGYMHGDPGYS
                     RFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYQNTQYADSARKAFI
                     VNRIGDLGFMLGMAILWALYGTLSISELKEALEGPLKNPSLLALAGLFLFLGAVGKSA
                     QVPLMVWLPDAMAGPTPVSALIHAATMVTAGVYLVARSSFLYSVLPDVSYTIAVIGLL
                     TAFYGALSAFGQNDIKKIVAYSTISQLGYMFLAAGVGAYWVALFHVFTHAFFKALLFL
                     ASGSVIHALGGEQDVRKMGGLWKHLPLTRWHGLIGALALGGLPLLSGFWSKDAILTAT
                     LTYPFGGVGFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLA
                     LGSVLAGYLALPHPLPNLLMPYLKPALAELEHHHLSLGAEWGLIALSGAVALLGLWLG
                     YTFFQRKALPAWYQAFEAWSRESFYVDRLYNALLVNPLKALAEALFYGDAGLLRGYFG
                     LGGGVRSLGQGAARLQAGYLRVYALLFVVGVLVLLGVMRW"
     gene            complement(731224..731511)
                     /locus_tag="TCCBUS3UF1_RS03660"
                     /old_locus_tag="TCCBUS3UF1_7450"
     CDS             complement(731224..731511)
                     /locus_tag="TCCBUS3UF1_RS03660"
                     /old_locus_tag="TCCBUS3UF1_7450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515153.1"
                     /note="Catalyzes the transfer of electrons from NADH to
                     quinone; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone oxidoreductase subunit K"
                     /protein_id="WP_014515153.1"
                     /db_xref="GI:504328051"
                     /translation="MSYLFASALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVG
                     FARAYGLEGQVAALMVIAIAAAEVAVGLGLIVAIFRHRESTAVDDLSELRG"
     gene            complement(731508..732047)
                     /locus_tag="TCCBUS3UF1_RS03665"
                     /old_locus_tag="TCCBUS3UF1_7460"
     CDS             complement(731508..732047)
                     /locus_tag="TCCBUS3UF1_RS03665"
                     /old_locus_tag="TCCBUS3UF1_7460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515154.1"
                     /db_xref="GI:504328052"
                     /translation="MSPWEALALFLLLGTGVLVVTLRNAIHAALALIANFLVLAGAYV
                     ALDARFLGFIQIIVYAGAIVVLFLFVIMLLFAAQGEVGFDPLVRSKPLAALLALGVGL
                     FLLSGMVGLGLSFQKDLGGGLPQALGPLLYGDWLLVLLAVGFLLMAATVVAVALVQPS
                     RPLDALRPEERKEEKEVVG"
     gene            complement(732044..732592)
                     /locus_tag="TCCBUS3UF1_RS03670"
                     /old_locus_tag="TCCBUS3UF1_7470"
     CDS             complement(732044..732592)
                     /locus_tag="TCCBUS3UF1_RS03670"
                     /old_locus_tag="TCCBUS3UF1_7470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(4Fe-4S)-binding protein"
                     /protein_id="WP_014515155.1"
                     /db_xref="GI:504328053"
                     /translation="MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLT
                     RHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCG
                     LCEEACPTGAIVLGYDFEMADYQYSDLIYGKEDMLVDIQGTKPQRREAKMTGKPVKPG
                     YVVPYVRPELEGFQAPTEGGKR"
     gene            complement(732589..733680)
                     /locus_tag="TCCBUS3UF1_RS03675"
                     /old_locus_tag="TCCBUS3UF1_7480"
     CDS             complement(732589..733680)
                     /locus_tag="TCCBUS3UF1_RS03675"
                     /old_locus_tag="TCCBUS3UF1_7480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515156.1"
                     /db_xref="GI:504328054"
                     /translation="MSYPLDPYWMVALKAFLVVVGLLTAFAFMTLIERRLLARFQIRQ
                     GPNRVGPWGLFQPIADAIKSIFKEDLVVERADKVLFVLAPLLGVVFALLAFGAIPFGP
                     PGSFFGYQPWVVNLDLGLLYLFAVSEMAIYGIFLAGWASGSKYSLLGSLRSSASLISY
                     ELGLGIALLAPVLLVGSLNLNDIVNWQAEHGWLFLYAFPAFVVYTIAALAEAARTPFD
                     LPEAEQELVGGYHTEYSSIKWALFQMTEYIHFITASALIPTLFLGGWTMPFANVPYLW
                     MFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPVALLWFLVTALVVALGLPKTY
                     LLYLSGLSFLVLLGGLLYSPKPVRKGGGA"
     gene            complement(733677..736028)
                     /locus_tag="TCCBUS3UF1_RS03680"
                     /old_locus_tag="TCCBUS3UF1_7490"
     CDS             complement(733677..736028)
                     /locus_tag="TCCBUS3UF1_RS03680"
                     /old_locus_tag="TCCBUS3UF1_7490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515157.1"
                     /db_xref="GI:504328055"
                     /translation="MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGA
                     CRMCLVRIGLPKRGPDGKPLLTPEGEPEIAWQPKLAASCVTAVAEGMVVDTLSEVVRE
                     AQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKEPLELPVYTRFEFT
                     RRHVDKHHPLSPFVVLDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGL
                     PSGFSGNITDICPVGALLDLTARFRARNWEMEETPTHCALCPVGCGITADTRSGELLR
                     VRAREVPEVNEIWLCDAGRFGHEWADQGRLKTPLVRRGERLVEATWEEAFAALQAGLR
                     GARKEEVGIYLAHDATLEEGLMAAELAKALSTPHLDFEGRTAAPASLFPPATLEDLLR
                     ADFALVLGDPTEEAPLLHLRLSEFVRDLKPPHRYAHGTPFADLSIKERMPRRTDKMAL
                     FAPYRAPLMRWAALHGVHAPGEEREILLALLGEKEGSEAIRRAKEAWERAERPVLILG
                     AGVLQDAVAAERARLLAERKGAKVLAMTPAANARGLEAMGVWPGEKGAAWDEAGAPYA
                     YYGYVPPEGALRGKRFVVLHLSHLHPLAERYAHVVLPAPTFYERRGHLVNLEGRVLAL
                     HPAPVENGEAEGAIQALALLAQALGVKPPFRLALEVERELKARKVPPPMGLLAYRSKA
                     LRPKPQEGRLYLRPSMWRGQQLQGRVAQAVAPELWAHPETAKKEALLEGAKVAVETPM
                     GPVEARVVLREDLPGGFLYLTALGPLAGWRQEASLLVPTGGDA"
     gene            complement(736031..737344)
                     /locus_tag="TCCBUS3UF1_RS03685"
                     /old_locus_tag="TCCBUS3UF1_7500"
     CDS             complement(736031..737344)
                     /locus_tag="TCCBUS3UF1_RS03685"
                     /old_locus_tag="TCCBUS3UF1_7500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515158.1"
                     /note="part of NADH-ubiquinone oxidoreductase complex I;
                     shuttles electrons from NADH, via FMN and iron-sulfur
                     (Fe-S) centers, to quinones in the respiratory chain; NuoF
                     is part of the soluble NADH dehydrogenase fragment, which
                     represents the electron input part of NADH dehydrogenase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit F"
                     /protein_id="WP_014515158.1"
                     /db_xref="GI:504328056"
                     /translation="MTGPIVSGKDPRFTRTLYAHVGQEGSWTLDYYLRHGGYETAKRV
                     LKEKTPEEVIEEVKRSGLRGRGGAGFPTGVKWGFMPKDGQQHYLICNADESEPGSFKD
                     RYILEDVPHLLIEGMILAGYAIRATVGYVYIRGEYRRAADRLEAAIREARERGYLGKN
                     LFGTGFSFELHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTIN
                     NVETLAAVVPILERGADWFASMGTEQSKGMKLYQISGPVRRPGVYELPMGTTLRELIY
                     EWAGGPLEPIQALIPGGSSTPPLPFTDEVLDTPMSYEHLQAKGSMLGTGGVILIPERV
                     SMVDAMWNVTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPL
                     IEGRSFCPLADAAVWPVKGSLKHFKDQYLALAREKRPVPRPSLWR"
     gene            complement(737341..737886)
                     /locus_tag="TCCBUS3UF1_RS03690"
                     /old_locus_tag="TCCBUS3UF1_7510"
     CDS             complement(737341..737886)
                     /locus_tag="TCCBUS3UF1_RS03690"
                     /old_locus_tag="TCCBUS3UF1_7510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016328966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515159.1"
                     /db_xref="GI:504328057"
                     /translation="MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPD
                     RIEEIAALVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGADELWDYLTE
                     RLGIGPGEVTPDGLFSVQKVECLGSCHTAPVVQVNDEPYVECVTRARLEALLEGLKAG
                     KRPEEIPLPGRCGHHVHEVEV"
     gene            complement(737897..739120)
                     /locus_tag="TCCBUS3UF1_RS03695"
                     /old_locus_tag="TCCBUS3UF1_7520"
     CDS             complement(737897..739120)
                     /locus_tag="TCCBUS3UF1_RS03695"
                     /old_locus_tag="TCCBUS3UF1_7520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515160.1"
                     /note="Catalyzes the transfer of electrons from NADH to
                     quinone; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase subunit D"
                     /protein_id="WP_014515160.1"
                     /db_xref="GI:504328058"
                     /translation="MKDYLDLDPVETLEEPKELRTEVMTLNVGPQHPSTHGVLRVVVT
                     LSGEEVLDLVPHIGYLHTGFEKNMENRTYTQVITYTPRMDYLHSFAHDLAYALAVEKL
                     VGAVVPERAQTIRILLNELSRLASHLVFLGTGLLDLGALTPFFYAFREREAILDLFEW
                     VTGQRFHHNYIRIGGVKEDLPEEFVPELKKFLEVMPHRIDEYEALFAESPIFYERARG
                     VGVIPPEVAIGLGLTGGSLRASGVNYDVRKAYPYAGYETYTFDVPLGEHGDVFDRMMV
                     RIREMRESVKIIRQALERLEPGPIRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFH
                     PPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMV
                     AIIASLDPVMGDVDR"
     gene            complement(739117..739737)
                     /locus_tag="TCCBUS3UF1_RS03700"
                     /old_locus_tag="TCCBUS3UF1_7530"
     CDS             complement(739117..739737)
                     /locus_tag="TCCBUS3UF1_RS03700"
                     /old_locus_tag="TCCBUS3UF1_7530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515161.1"
                     /db_xref="GI:504328059"
                     /translation="MRLERVLQEARAKGYALEDNGLGNLWVVLPRERFKEEMARYKEA
                     GFNYLADIVGLDYLEYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEGDPRLP
                     TVTDLWGSANFLEREVYDMFGILFEGHPDLRKILTPEDLEGHPLRKDFPLGETPTLFR
                     EGRFIVPSEFRAAITGKSPGLTLYRGGSRKGYRALWADLTKAKEGR"
     gene            complement(739741..740286)
                     /locus_tag="TCCBUS3UF1_RS03705"
                     /old_locus_tag="TCCBUS3UF1_7540"
     CDS             complement(739741..740286)
                     /locus_tag="TCCBUS3UF1_RS03705"
                     /old_locus_tag="TCCBUS3UF1_7540"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q56218.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515162.1"
                     /db_xref="GI:504328060"
                     /translation="MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLA
                     CCAIEMMASTDARNDLSRFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDP
                     KWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
                     QAYDEGGRKLPPVAAWQRARG"
     gene            complement(740277..740636)
                     /locus_tag="TCCBUS3UF1_RS03710"
                     /old_locus_tag="TCCBUS3UF1_7550"
     CDS             complement(740277..740636)
                     /locus_tag="TCCBUS3UF1_RS03710"
                     /old_locus_tag="TCCBUS3UF1_7550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase"
                     /protein_id="WP_014515163.1"
                     /db_xref="GI:504328061"
                     /translation="MAPIAEYVNVLIYLGVALFIGVAALVVGALLGPKKPGKAKLMPY
                     ESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLL
                     LFVGFLYEWWKGVMRWH"
     gene            complement(740803..741621)
                     /locus_tag="TCCBUS3UF1_RS03715"
                     /old_locus_tag="TCCBUS3UF1_7570"
     CDS             complement(740803..741621)
                     /locus_tag="TCCBUS3UF1_RS03715"
                     /old_locus_tag="TCCBUS3UF1_7570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_014515165.1"
                     /db_xref="GI:504328063"
                     /translation="MPERLTSPQAVRELLLRHGLFADKRFGQNFLVSEAYLRRIVEAA
                     QPLSGPVYEVGPGLGVLTRALAQAGAEVTAIEKDLRLKPVLEETLEGLPVRLVFGDAL
                     RFPWEEVPPGSLLVANLPYHIATALITRLLLTGRFARLVFLVQKEVAERMVARPGTPQ
                     YGLLTLRVAHHARAEKLLDLPPGAFFPPPKVYSSLVRLTPQGVPDDPQLFGLIAAAFR
                     QRRKTLKNALLAGGYPKGKVEEGLALLGLSEKVRAEEVSLEGFRRLRDILYTKV"
     gene            complement(741614..742360)
                     /locus_tag="TCCBUS3UF1_RS03720"
                     /old_locus_tag="TCCBUS3UF1_7580"
     CDS             complement(741614..742360)
                     /locus_tag="TCCBUS3UF1_RS03720"
                     /old_locus_tag="TCCBUS3UF1_7580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_014515166.1"
                     /db_xref="GI:504328064"
                     /translation="MRVVAVGDLHGNFPALWRLLRLEGLADPLLQPTEELRSGRTRLV
                     LLGDLVHPKTQRDYERLTGLTPFDPQDPNHLRLAAGAQIRELFRLKALQEASEGHLTI
                     LLGNHDEAALKGEPLLGNRHLKHLEFHPEYGGKALPHGLKAWMEGFPRELLLNGVHFA
                     HVGPVPWLQEYDALFYAQSEPKTWWFRTPDYVERMGYRFGVYGHVPMREGILLKERFA
                     LIDALDLGEYLELFPEEEPLLLRVKRLPHA"
     gene            complement(742357..742998)
                     /locus_tag="TCCBUS3UF1_RS03725"
                     /old_locus_tag="TCCBUS3UF1_7590"
     CDS             complement(742357..742998)
                     /locus_tag="TCCBUS3UF1_RS03725"
                     /old_locus_tag="TCCBUS3UF1_7590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rad52/22 double-strand break repair protein"
                     /protein_id="WP_014515167.1"
                     /db_xref="GI:504328065"
                     /translation="MDEAWRKLAEPFPPGEVQWRIEALSKDRKRALVVPYVDARTVLD
                     RLDRAVGPEGWQDSYEVLADEERTLRDERGERRERLCEVKCRLTVLGVTKEDVGEGDS
                     LKAAFSDALKRAAVKFGVGRYLYRLEKQWVDYDPEKGRFTPPRLPEAATPEEAEEEEK
                     PEAYRLIDQLLERLKEKGLGREAARIVTKYGGYGKTPEETKRLYGELRSLLKG"
     gene            743061..743399
                     /locus_tag="TCCBUS3UF1_RS03730"
                     /old_locus_tag="TCCBUS3UF1_7600"
     CDS             743061..743399
                     /locus_tag="TCCBUS3UF1_RS03730"
                     /old_locus_tag="TCCBUS3UF1_7600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515168.1"
                     /db_xref="GI:504328066"
                     /translation="MRSLILVLPLLVSAWALEVRLSATLAFDLFPQGVVVERVAEPRG
                     MVVVYNFSRAEAVFRHHDEDLRRRGWVRVKYEVKKGEWKAEYRKGKAKATLSVKDKKG
                     RVEVRLKEGD"
     gene            743437..743512
                     /locus_tag="TCCBUS3UF1_RS03735"
                     /old_locus_tag="TCCBUS3UF1_t80"
     tRNA            743437..743512
                     /locus_tag="TCCBUS3UF1_RS03735"
                     /old_locus_tag="TCCBUS3UF1_t80"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:743470..743472,aa:Ala,seq:cgc)
     gene            complement(743574..745457)
                     /locus_tag="TCCBUS3UF1_RS03740"
                     /old_locus_tag="TCCBUS3UF1_7610"
     CDS             complement(743574..745457)
                     /locus_tag="TCCBUS3UF1_RS03740"
                     /old_locus_tag="TCCBUS3UF1_7610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515169.1"
                     /db_xref="GI:504328067"
                     /translation="MRRTLALLLLLGSSLAQGLVLPFAGPEGFRLAQAFAQGLKAPPP
                     TLLSLLLPDLPWRNSYDFTGGLYTAAGARLAQAATGADWVLLGQQEPRGLRLFLADGK
                     GVRGGLFPTPELGWLWLQGQGLAPRFTPLPSPTLPEARLRALAEGQDPDPLHRSALDL
                     REGRGAGLLEGLLPKRLLRLWQGQLPPAYEAFRLLSEGKREEALGRAKALLQGDVLER
                     TAGHLLLRALEDEGWKASARKLAQAFPELPLAWEEVSFAAFAEGQGQEAREALLKALA
                     LRPDYWLYWTNLGWAYYLTGDLPRALLASERAVALNPNATAYYNLGLFRAIYGDYLGA
                     KAAYDRALRLDEGEDFPEALKDLEERKEPLTLFFRAYLAERAGLAAQELYRAFLESHP
                     THPAAPAAARALKRLGGEVRLRLERLTLIPGDLEARPFRAGEAVFPEVFLEGSPYLER
                     GRLRTLLLREGQVLKEEEKPLGFPPLTAALRETAPAVILPEPGRYTLEVDYGKARLQV
                     SLEVGPESLARRLYALGLEVRDLSGQLLLSPKEALGDEGDQILLERTLAALREAAPLA
                     SATRFTTPLPRGPYAGKSVQELLQNPSPEMVRAFFRAVLDSPELLAESDVVNALVDWL
                     LSQ"
     gene            complement(745467..746171)
                     /locus_tag="TCCBUS3UF1_RS03745"
                     /old_locus_tag="TCCBUS3UF1_7620"
     CDS             complement(745467..746171)
                     /locus_tag="TCCBUS3UF1_RS03745"
                     /old_locus_tag="TCCBUS3UF1_7620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetyl-D-mannosaminuronic acid
                     transferase"
                     /protein_id="WP_014515170.1"
                     /db_xref="GI:504328068"
                     /translation="MERLTLLGLPLDPVDMEEALRRIGGFLEGQGTHQVVTLNPEIAV
                     RAQEDQALRRAIGEAELVTPDGVGILWAARRLLGVELRERVTGVDLTLALFHRFPGLR
                     VYLLGGRPGVAERAAAEARRLGAEVVGFHHGYFSEEEPVVEAVRRLAPDLLLVGMGER
                     QEAFIHRHKAHLGAKVAMGVGGTLDVLAGEVQRPPLWAQRLGVEWLLRVGLDPKRWRR
                     APRLFRFAYMVLREKR"
     gene            complement(746159..746872)
                     /locus_tag="TCCBUS3UF1_RS03750"
                     /old_locus_tag="TCCBUS3UF1_7630"
     CDS             complement(746159..746872)
                     /locus_tag="TCCBUS3UF1_RS03750"
                     /old_locus_tag="TCCBUS3UF1_7630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphosulfolactate phosphohydrolase"
                     /protein_id="WP_041433745.1"
                     /db_xref="GI:752794313"
                     /translation="MCRVDLCLTPAQGPLILVEVLPAGSVLSFLLARGATEVWTVPGP
                     KVARLLAGELGPDTLLLGEAEGFPLEGFHGRPSLLDLEGTQVAGKRAVLVAPLLNQSL
                     LPGEEEVYLAGFRNAKAVMDLFQGSQPTLRPAGAPEPLLSAVVAAGFLQKKLCPKAPT
                     SLATALLRAFPDPQEALFQSLEGQALHRQGRTEELAWASLIGVDPVVPRLAGVRFFPK
                     EAFGLSQDRYAQRFIPWNA"
     gene            746900..747838
                     /locus_tag="TCCBUS3UF1_RS03755"
                     /old_locus_tag="TCCBUS3UF1_7640"
     CDS             746900..747838
                     /locus_tag="TCCBUS3UF1_RS03755"
                     /old_locus_tag="TCCBUS3UF1_7640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="WP_014515172.1"
                     /db_xref="GI:504328070"
                     /translation="MRLKDLGERGLLARLAPLGYPEDAPLPPGDDAGGVWVGEEAWLL
                     KTDGFLYREVALDGMGPFAVGWRGVAATASDLLAKMARPLGFTLGLFLPPDLEEAFAL
                     ELVQGAAEAARRLGAPLLGGDTNAASEVALTVSGFARTRTPLPRRALPGDLLYLAGDR
                     WGRVGAAIRAHYQGRSLEAFPAIRQAAFYPLPRLELLALAGSLRGSLDSSDGLAETLW
                     QLSELGVRVDLEALPLLPDVLAFAGSEAAALELVLYGGEEFEAVLVVPPEGEAQLLAQ
                     AKAVGLPLFRAGRVGEGRGVYLRGEPVPRRGYERFR"
     gene            747852..748895
                     /locus_tag="TCCBUS3UF1_RS03760"
                     /old_locus_tag="TCCBUS3UF1_7650"
     CDS             747852..748895
                     /locus_tag="TCCBUS3UF1_RS03760"
                     /old_locus_tag="TCCBUS3UF1_7650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="WP_014515173.1"
                     /db_xref="GI:504328071"
                     /translation="MRAFKAHLRGLSPYPYRKVEAPVKLDQNESPLDLPAALKEEALS
                     RLARLPWNRYPEIHAESLRRRLAAQVGWPEEGVVLAPGSNLLILALSLAAEEVLDLSP
                     SFPHYAHAAQVAGTPYRAVPLGEGFALDLEALLQAFSGGVLFLPNPHAPTGALFPQAA
                     LEALAARAREVGGLLVVDEAYREFAGTDFSPLGRENPHVAFLRTFSKAFSLGGIRAGY
                     LLAAPEVARVVREVLPPFVLPAHTGVILEVVLENPAYVQEVVEGVRRERERAYQSLLS
                     HPTWRPYPSHTNFLLVRTPDAAEAHRHLLAQGILVRRQDHLPGLRGCLRVTVGGKEEM
                     DAFLRAAFEVAYA"
     gene            748888..749472
                     /locus_tag="TCCBUS3UF1_RS03765"
                     /old_locus_tag="TCCBUS3UF1_7660"
     CDS             748888..749472
                     /locus_tag="TCCBUS3UF1_RS03765"
                     /old_locus_tag="TCCBUS3UF1_7660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_014515174.1"
                     /db_xref="GI:504328072"
                     /translation="MREASVERATAETWVRVRLGLDGPVGGKVGTGLAFLDHMLLQLQ
                     RHGRFLLEVEAKGDLEVDVHHLVEDVGIALGMALKEALGEGVGLERYAEAYAPMDETL
                     VLCVLDLSGRPHLAYHPEDWPVVGAAGGVNHYHLREFLRGLVNHGRLTLHLRLLAGRE
                     AHHVLEASFKALARALHRATRLTGEGVPSTKGLL"
     gene            749486..750082
                     /locus_tag="TCCBUS3UF1_RS03770"
                     /old_locus_tag="TCCBUS3UF1_7670"
     CDS             749486..750082
                     /locus_tag="TCCBUS3UF1_RS03770"
                     /old_locus_tag="TCCBUS3UF1_7670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase"
                     /protein_id="WP_014515175.1"
                     /db_xref="GI:504328073"
                     /translation="MRALLMDYGSGNLRSAAKALEAAGFAVAVSRDPKAHPEADLLVL
                     PGQGHFGQVMAAFRESGFVERVLFHLERGRPFLGICVGMQVLYQESEEAPGVGGLGLV
                     EGRVRRFPRGRVPQMGWNRVAFGGLFAELSGRHFYFANSYYAPPTPQALGTGTYEGTP
                     FTALLARENLLAPQFHPEKSGQAGLAFLGLARRYFQVL"
     gene            complement(750053..750973)
                     /locus_tag="TCCBUS3UF1_RS03775"
                     /old_locus_tag="TCCBUS3UF1_7680"
     CDS             complement(750053..750973)
                     /locus_tag="TCCBUS3UF1_RS03775"
                     /old_locus_tag="TCCBUS3UF1_7680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="WP_014515176.1"
                     /db_xref="GI:504328074"
                     /translation="MRFFVLGDVSVDLLFFVERIPEPGEEIPSRRALMKPGGAGGTLA
                     AQLASLGHRVYLAGRVGQDPLAELALSRVQEAGVDLRHLQEDPDHTTSSVLILVVPGG
                     ERAMVSAEGASRYLDPALFKPRYLDQADAVVLSAYALVGGPSRSYAVEVLEAARKREM
                     PIFADLGTGAVRAAGQELLKYLRGVAWLLMNQTELLALTGAASLSEGVARLRQEGFSH
                     LAIKVGAMGSIVVTPQGEELLEPFPIEDIVDSTGAGDAYTAAFAHAILSGKSPLEAGR
                     LANLAGALAATAIGAQGRLLRLEDLEVAAR"
     gene            complement(751083..752219)
                     /locus_tag="TCCBUS3UF1_RS03780"
                     /old_locus_tag="TCCBUS3UF1_7690"
     CDS             complement(751083..752219)
                     /locus_tag="TCCBUS3UF1_RS03780"
                     /old_locus_tag="TCCBUS3UF1_7690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F390 synthetase"
                     /protein_id="WP_014515177.1"
                     /db_xref="GI:504328075"
                     /translation="MERIARLREVIRSAKAHPVYREKLKDVDPEGVDLDNLHTLPLTT
                     REEWVAYLKAHPQPPEGASLMHLTPSPLMGWMPEYLSQEDLRHQTEALAQHYRRLGLV
                     GKRVLVAFSYHVFAGGWLFHQALWRAGNLVFPHGPGEAARIAEIGQAYGFEVLVTNPS
                     FALKVGQAGGRFPLLLAGGEPFTSVPGFRERVEAALGGVALDAYGTSELGIVAGESLA
                     KDGLWEIPEMAVLEVLDPETLKPVPDGEKGELVVTALSRTLMPMVRFRTGDLAIAERR
                     EGLTLLPRGVFGRTDLMVKVKGVKLYPTELAPILGGFGLDPKGFQVVVERKLEGTDKL
                     VLRLKAEKVPPGLLEAIQRATGLRVDEVELVGELEGGMVLDRRF"
     gene            complement(752241..753341)
                     /locus_tag="TCCBUS3UF1_RS03785"
                     /old_locus_tag="TCCBUS3UF1_7710"
     CDS             complement(752241..753341)
                     /locus_tag="TCCBUS3UF1_RS03785"
                     /old_locus_tag="TCCBUS3UF1_7710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515178.1"
                     /note="With PurE catalyzes the conversion of
                     aminoimidazole ribonucleotide to carboxyaminoimidazole
                     ribonucleotide in the de novo purine nucleotide
                     biosynthetic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="WP_014515178.1"
                     /db_xref="GI:504328076"
                     /translation="MRVGILGGGQLGRMLALAGYPLGLTFRFLDPSPEACAGQVGELR
                     VGAYGDEEALKGFAEGLDLVTYEFENVPVGAARFLAQNLPVFPPPEALEVAQDRLREK
                     AFMRGLGVPTPAFREVDTPSGLEEALAQVGLPALLKTRRGGYDGKGQALVRTQEEAEA
                     AFWALGGEGLILEAFVPFTREVSLLAVRGRTGEVAFYPLVENHHREGILRLSLAPAPG
                     LTPTLQARAEAYARKALEALGYVGVLALEFFQVGEELLFNEMAPRVHNSGHWTLEGAE
                     TSQFANHLRAILGLPLGSTAPRGYSAMVNLIGLKPSFAKVLAVEGAHLHWYGKAVRPG
                     RKVGHITLRREGPEALAKDLPRLLALAEPSRV"
     gene            complement(753338..753832)
                     /locus_tag="TCCBUS3UF1_RS03790"
                     /old_locus_tag="TCCBUS3UF1_7700"
     CDS             complement(753338..753832)
                     /locus_tag="TCCBUS3UF1_RS03790"
                     /old_locus_tag="TCCBUS3UF1_7700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003045057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="WP_041433746.1"
                     /db_xref="GI:752794314"
                     /translation="MRPLVGVIMGSKSDWATLRHAAETLEALGVPYEVRVVSAHRTPD
                     LMAEYAKSAQARGLMVIIAGAGGAAHLPGMTAAHTPLPVLGVPVESQALKGLDSLLSI
                     VQMPAGIPVGTLAIGKAGAVNAALLAASIVGLSHPEVMERLQAYRKAQTEAVLRHPDP
                     REEA"
     gene            753880..754839
                     /locus_tag="TCCBUS3UF1_RS03795"
                     /old_locus_tag="TCCBUS3UF1_7720"
     CDS             753880..754839
                     /locus_tag="TCCBUS3UF1_RS03795"
                     /old_locus_tag="TCCBUS3UF1_7720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_014515180.1"
                     /db_xref="GI:504328078"
                     /translation="MDALELLRLNLLSPMVLAFALGAVARLVKSDLAFPEAMYTALSV
                     YLLFAIGFKGGVELSKTPLAVLLLPALATLFLGLFRPLVAYGLSRRFLRVGRADAGAL
                     AAHYGSVSAVTFLAALTFAQGVGHRPEGFLPTLVALLEVPGIVLALLLAKRGGGSLGE
                     ALQEVLTGKSVVLLLGGLCVGALSGEAGMERVKPFFVDPFYGALTLFLMDLGMVAASR
                     FAALRQVGFRLVLFGTLLPLFHGALGVYLGHLVGLSVGGATVLGAMAASSSYIAAPAA
                     VRIALPEANPSLYLAASLAVTFPFNLVLGIPLYHALAVWMGGR"
     gene            754839..755141
                     /locus_tag="TCCBUS3UF1_RS03800"
                     /old_locus_tag="TCCBUS3UF1_7730"
     CDS             754839..755141
                     /locus_tag="TCCBUS3UF1_RS03800"
                     /old_locus_tag="TCCBUS3UF1_7730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015716536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014515181.1"
                     /db_xref="GI:504328079"
                     /translation="MDLVPLKLVTIVAESLLEKKLVEEIKRLGAKGYTIVPARGEGSR
                     GMRSVDWEGQNIRLETIVPEEVALKILARLQEAYFPHYAVIAYVENVYVVRGEKYV"
     gene            complement(755146..755664)
                     /locus_tag="TCCBUS3UF1_RS03805"
                     /old_locus_tag="TCCBUS3UF1_7740"
     CDS             complement(755146..755664)
                     /locus_tag="TCCBUS3UF1_RS03805"
                     /old_locus_tag="TCCBUS3UF1_7740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase"
                     /protein_id="WP_014515182.1"
                     /db_xref="GI:504328080"
                     /translation="MLAYLLPALVLFLEVGFPLGFLVPGGDTLLLFLGALAGEGKLSL
                     FPLLPLLFLGSALGHLLGYALGRALGGRLKPRLPQDLWQRGERVLLRFGPSALLLAPF
                     VPGLRTALPLLLGALGFPFLPYLLLSALGSLLWTQGLVLLAYVLGQKVPAWLLWPALL
                     LLALLPLLRKRP"
     gene            complement(755666..756361)
                     /locus_tag="TCCBUS3UF1_RS03810"
                     /old_locus_tag="TCCBUS3UF1_7750"
     CDS             complement(755666..756361)
                     /locus_tag="TCCBUS3UF1_RS03810"
                     /old_locus_tag="TCCBUS3UF1_7750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014515183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014515183.1"
                     /db_xref="GI:504328081"
                     /translation="MEAGVLSVILILVALEVILSADNALILGVIVQKLPPSLRRRALF
                     YGILGAYVLRGLALLFAALVIKLWWVQVLGAAYLLYIALRHFLKPEEAHAPPPLEVSA
                     AQFWKVVAQVELMDLAFAVDSVLVAVALSDKLWVIYTGVFLGILALRMLASLVVSLLD
                     RYPRFKHLAYVVVGLAGVKLLLGGWDKLAKETLHRPELALGLDKEAFSLLILAVLLLG
                     SLWALRKPAPQPS"
     gene            756547..756879
                     /locus_tag="TCCBUS3UF1_RS03815"
                     /old_locus_tag="TCCBUS3UF1_7770"
     CDS             756547..756879
                     /locus_tag="TCCBUS3UF1_RS03815"
                     /old_locus_tag="TCCBUS3UF1_7770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018461797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11