GenomeNet

Database: RefSeq
Entry: NC_017278
LinkDB: NC_017278
Original site: NC_017278 
LOCUS       NC_017278            2243772 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Thermus sp. CCB_US3_UF1 chromosome, complete genome.
ACCESSION   NC_017278
VERSION     NC_017278.1  GI:384438400
DBLINK      Project: 81197
            BioProject: PRJNA81197
KEYWORDS    RefSeq.
SOURCE      Thermus sp. CCB_US3_UF1
  ORGANISM  Thermus sp. CCB_US3_UF1
            Bacteria; Deinococcus-Thermus; Deinococci; Thermales; Thermaceae;
            Thermus.
REFERENCE   1  (bases 1 to 2243772)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Complete genome sequence of thermophilic Thermus sp. CCB_US3_UF1
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2243772)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2243772)
  AUTHORS   Teh,B.S., Abdul Rahman,A.Y., Saito,J.A., Hou,S. and Alam,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2011) Centre for Chemical Biology (CCB@USM),
            Universiti Sains Malaysia (USM), 1st Floor, Block B No.10,
            Persiaran Bukit Jambul, Bayan Lepas, Pulau Pinang 11900, Malaysia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003126.
            Bacteria available from Centre for Chemical Biology (CCB@USM)
            (info@ccbusm.edu.my).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2243772
                     /organism="Thermus sp. CCB_US3_UF1"
                     /mol_type="genomic DNA"
                     /strain="CCB_US3_UF1"
                     /db_xref="taxon:1111069"
     gene            48..1388
                     /locus_tag="TCCBUS3UF1_10"
                     /db_xref="GeneID:12251232"
     CDS             48..1388
                     /locus_tag="TCCBUS3UF1_10"
                     /note="similar to chromosomal replication initiation
                     protein PRK00149;
                     similar to Chromosomal replication initiator protein dnaA
                     of Bacteria UniRef RepID=DNAA_DEIDV"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein dnaA"
                     /protein_id="YP_005653125.1"
                     /db_xref="GI:384438401"
                     /db_xref="GeneID:12251232"
                     /translation="MFPWNSGVALTHEAIWHHVLEHIRRNITEVEFHTWFERIRPLGV
                     REGVLELAVPTSFALDWIRKHYAELIQEALGLLGAQAPRFELKVVPGTAIQEDIFQAT
                     PSPEPAQPRLNPKYTFENFVVGPNNSMAHAAAVAVAESPGRAYNPLFIYGGVGLGKTH
                     LMHAVGHSVAKRFPHLKIEYVSTETFTNELINAIREDRMAEFRERYRSVDLLLVDDIQ
                     FIAGKERTQEEFFHTFNALYEAHKQIILSSDRPPKDILTLEARLRSRFEWGLITDIQP
                     PDLETRIAILKMNAEQRGLRVSEEVLEYIARQVTSNIRELEGALVRVIAYASLNGVEL
                     TRAVAARALSDIFAPKEVEVDPQEIVAKVAEHFGLKPEELLGSGRRKEVVLPRQIAMF
                     LVREFTRASFPEIGQFFGGRDHTTVIYAIQKVQELSESDREVQRLLRQLREAFL"
     misc_feature    78..1373
                     /locus_tag="TCCBUS3UF1_10"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    84..269
                     /locus_tag="TCCBUS3UF1_10"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    468..857
                     /locus_tag="TCCBUS3UF1_10"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    501..524
                     /locus_tag="TCCBUS3UF1_10"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(504..527,690..692,792..794)
                     /locus_tag="TCCBUS3UF1_10"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    678..695
                     /locus_tag="TCCBUS3UF1_10"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    828..830
                     /locus_tag="TCCBUS3UF1_10"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1113..1376
                     /locus_tag="TCCBUS3UF1_10"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1182..1184,1206..1211,1230..1232,1248..1256,
                     1281..1295,1302..1304,1311..1316)
                     /locus_tag="TCCBUS3UF1_10"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1687..2811
                     /locus_tag="TCCBUS3UF1_20"
                     /db_xref="GeneID:12251234"
     CDS             1687..2811
                     /locus_tag="TCCBUS3UF1_20"
                     /note="similar to DNA polymerase III subunit beta
                     PRK07761;
                     similar to DNA polymerase III, beta chain of Thermaceae
                     UniRef RepID=Q72H86_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_005653126.1"
                     /db_xref="GI:384438402"
                     /db_xref="GeneID:12251234"
                     /translation="MDVTLPKNLLAEQIALLERVIPSRSSNPMFTYLGLAPQAGGLTL
                     FGSNGEVDLEVHLPAQVQGEGRYLVPAQPFFQLVRSLPGDTAILRLGLDLELSSGSFR
                     TRLSLAPSEGYPELIFPEPGVASPDYPLQTRLPAEGFLRALVHVRYAASNEEYRAIFR
                     GVQLEFSPQGVRAVASDGYRLALYDLPLPQPFQRKAVVPARSVDEVIRVLKGMGEGEA
                     VLALGAGTLGLTLGQEGGGRLRLAVRLMEGEFPDYERVIPKEFPLRAGLEVEPFREAL
                     RRVSVLSDRQNHRVDLLFGEGHVLLSAEGDYGKGQEELPVRLEGTPLAVAYNARYLLE
                     ALGPLSGQAALLLSGPTSPSLIRPLGEGEGYQAVVVPLRV"
     misc_feature    1687..2808
                     /locus_tag="TCCBUS3UF1_20"
                     /note="DNA polymerase III subunit beta; Provisional;
                     Region: PRK14945"
                     /db_xref="CDD:184909"
     misc_feature    1687..2805
                     /locus_tag="TCCBUS3UF1_20"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1756..1758,1900..1902,1921..1923,2287..2289)
                     /locus_tag="TCCBUS3UF1_20"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1903..1905,1912..1914,1984..1986,1990..1992,
                     2527..2529,2617..2622)
                     /locus_tag="TCCBUS3UF1_20"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2212..2214,2218..2229,2668..2670,2794..2805)
                     /locus_tag="TCCBUS3UF1_20"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2212..2214,2218..2223,2452..2454,2557..2559,
                     2596..2601,2677..2679,2794..2805)
                     /locus_tag="TCCBUS3UF1_20"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2877..4145
                     /locus_tag="TCCBUS3UF1_30"
                     /db_xref="GeneID:12251255"
     CDS             2877..4145
                     /locus_tag="TCCBUS3UF1_30"
                     /note="similar to phosphopyruvate hydratase PRK00077;
                     similar to Enolase of Bacteria UniRef RepID=ENO_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_005653127.1"
                     /db_xref="GI:384438403"
                     /db_xref="GeneID:12251255"
                     /translation="MTTIVSVKAREVLDSRGFPTVEAEVELEGGVRGRAMVPSGASTG
                     THEALELRDGGRRYLGKGVRRAVENINERIAPELIGMEALDQEGVDRAMRELDGTPNK
                     ANLGANAILAVSLATARAAAEALGLPLYRYLGGVQGVVLPVPLMNVINGGKHADNRVD
                     FQEFMLVPAGVESFAEALRVGAEVFHTLKGVLKEKGYSTNVGDEGGFAPDLRSNEEAV
                     ELLLLAIERAGYTPGQEVSLALDPAASELYREGRYHLEGEGKVLTSEEMVAFWASWVE
                     KYPIRSIEDGLSEDDWEGWRLLTKTLGERVQLVGDDLFVTNPERLAQGIERGVANAIL
                     VKVNQIGTLSETLEAIRLAQRSGYRAVISHRSGETEDPFIADLAVAVNAGQIKTGSLS
                     RSDRLAKYNQLLRIEEELGRAARFLGYAAF"
     misc_feature    2877..4142
                     /locus_tag="TCCBUS3UF1_30"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    2892..4103
                     /locus_tag="TCCBUS3UF1_30"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(2898..2900,2904..2930,2940..2942,2976..2978,
                     3339..3347,3408..3413,3420..3425,3432..3437,3474..3479,
                     3498..3500,3504..3506,3978..3986,4053..4061,4065..4070,
                     4077..4079,4086..4091,4098..4100)
                     /locus_tag="TCCBUS3UF1_30"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(3000..3002,3597..3599,3726..3728,3807..3809)
                     /locus_tag="TCCBUS3UF1_30"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(3336..3338,3486..3488,3882..3884,3966..3974,
                     4035..4037)
                     /locus_tag="TCCBUS3UF1_30"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            4132..5556
                     /locus_tag="TCCBUS3UF1_40"
                     /db_xref="GeneID:12251257"
     CDS             4132..5556
                     /locus_tag="TCCBUS3UF1_40"
                     /note="similar to pyruvate kinase PRK06247;
                     similar to Pyruvate kinase of Deinococci UniRef
                     RepID=Q1J2H5_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyruvate kinase"
                     /protein_id="YP_005653128.1"
                     /db_xref="GI:384438404"
                     /db_xref="GeneID:12251257"
                     /translation="MLPFKRTKIVATLGPASSSKEAIRALAEAGADVFRLNFSHGTPE
                     DHRQRVALVREVAQELGRPLAILQDLQGPKIRIGRFREGRVELKAGQPFVLTREPIEG
                     DQGRVSLTYGGLPEDVSPGQLLLLDDGRLRLRVEAVRGDEIHTVVEVGGVLSDHKGIN
                     VPGADLSIPALSEKDIQDVALGAELGVDWVAVSFVRTRDDLLLARHYLARYGSRAKLM
                     AKIEKPSAVHRFEEILEEADGIMVARGDLGVEMPLEEVPIVQKRLILRCIAAGKPVIT
                     ATQMLESMVHNPSPTRAEASDVANAIFDGSDAVMLSAETAAGAYPVEAVAMMARIARV
                     VESSPEFLQKLNVLRPAPTPTTQDAIAQAADDVVEAVGARAIVVFTATGGSARRIART
                     RPQVPILALTPNPEVQRQLALVWGVLPQLAPDPRDTDDMVRIALEKVKASGLAQVGER
                     VVIAAGVPFGVRGTTNLLRVERVS"
     misc_feature    4132..5550
                     /locus_tag="TCCBUS3UF1_40"
                     /note="Pyruvate kinase [Carbohydrate transport and
                     metabolism]; Region: PykF; COG0469"
                     /db_xref="CDD:223545"
     misc_feature    4141..5550
                     /locus_tag="TCCBUS3UF1_40"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cd00288"
                     /db_xref="CDD:238178"
     misc_feature    order(4147..4152,4318..4320,4324..4326,4348..4359,
                     4606..4611,4627..4629,4636..4650,4693..4695,4717..4719,
                     4738..4740,4771..4773,4879..4881,4933..4938,4948..4950,
                     5044..5046,5050..5052,5137..5139,5143..5148,5302..5304,
                     5308..5310,5314..5316,5347..5349,5356..5361,5365..5367,
                     5371..5379)
                     /locus_tag="TCCBUS3UF1_40"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238178"
     misc_feature    order(4234..4236,4240..4242,4336..4338,4711..4713,
                     4789..4791,4795..4797,4867..4869,4963..4965)
                     /locus_tag="TCCBUS3UF1_40"
                     /note="active site"
                     /db_xref="CDD:238178"
     gene            complement(5553..6299)
                     /locus_tag="TCCBUS3UF1_50"
                     /db_xref="GeneID:12251259"
     CDS             complement(5553..6299)
                     /locus_tag="TCCBUS3UF1_50"
                     /note="similar to acetylglutamate kinase PRK00942;
                     similar to Acetylglutamate/acetylaminoadipate kinase of
                     Thermus UniRef RepID=ARGB_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetylglutamate/acetylaminoadipate kinase"
                     /protein_id="YP_005653129.1"
                     /db_xref="GI:384438405"
                     /db_xref="GeneID:12251259"
                     /translation="MREALLVKVGGSLRGAEELLEELAQYPGPLVLVHGGGPEIGALL
                     ERLGYESRFVEGLRVTPPEQMDAVEMALCLTGKRLAQGLSQRGRKALSLSGRDALCLG
                     GRLLPGLGRVGEVVGVDPRPLLDLLGAGYTPLLAPIALDEEGPLNVNADTAAAAVAGA
                     LGWPAVFLTDVEGVYRHPKDPASRIPQLTPEAVAALKAEGVLQGGMIPKVEAALAALR
                     AGSPWAAIAKGRGGVLEGVLKGEAGTRFYP"
     misc_feature    complement(5610..6287)
                     /locus_tag="TCCBUS3UF1_50"
                     /note="AAK_NAGK-like: N-Acetyl-L-glutamate kinase
                     (NAGK)-like . Included in this CD are the Escherichia coli
                     and Pseudomonas aeruginosa type NAGKs which catalyze the
                     phosphorylation of N-acetyl-L-glutamate (NAG) by ATP in
                     the second step of arginine...; Region: AAK_NAGK-like;
                     cd04238"
                     /db_xref="CDD:239771"
     misc_feature    complement(order(5673..5675,5691..5693,5697..5699,
                     5775..5777,5793..5795,6189..6194,6267..6272,6276..6278))
                     /locus_tag="TCCBUS3UF1_50"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239771"
     misc_feature    complement(order(5850..5852,5856..5861,6126..6128,
                     6189..6194))
                     /locus_tag="TCCBUS3UF1_50"
                     /note="N-acetyl-L-glutamate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239771"
     gene            complement(6292..6783)
                     /locus_tag="TCCBUS3UF1_60"
                     /db_xref="GeneID:12251304"
     CDS             complement(6292..6783)
                     /locus_tag="TCCBUS3UF1_60"
                     /note="similar to Putative uncharacterized protein of
                     Thermus UniRef RepID=Q72HA8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653130.1"
                     /db_xref="GI:384438406"
                     /db_xref="GeneID:12251304"
                     /translation="MVRSFLSFHVQAPLEAALAFAQGRTGGAGVYLVPDPPWVSLYHE
                     ALEAHEDPGAIQGFLEDLSHLGRALAFLVLGEEDLLFLLAEGGEVRAELRQGPELGRA
                     LRAPQALLPLLERAQAMPPLSAVQALAIAFGLHPDHAALGFLDLLEAEEEEGLPEEVV
                     YLA"
     gene            6801..8420
                     /locus_tag="TCCBUS3UF1_70"
                     /db_xref="GeneID:12251306"
     CDS             6801..8420
                     /locus_tag="TCCBUS3UF1_70"
                     /note="similar to DNA polymerase III subunits gamma and
                     tau PRK12323;
                     similar to DNA polymerase III holoenzyme tau subunit of
                     Thermaceae UniRef RepID=Q72HA7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III holoenzyme tau subunit"
                     /protein_id="YP_005653131.1"
                     /db_xref="GI:384438407"
                     /db_xref="GeneID:12251306"
                     /translation="MSALYRRVRPLTFAEVVGQEHVKEPLLRAIGEGRLAQAYLFSGP
                     RGVGKTTTARLLAMAVGCQGEEKPCGACPHCQAVQKGTHPDVVEIDAASNNSVEDVRE
                     LRERILLAPLSAPRKVFILDEAHMLSKSAFNALLKTLEEPPAHVLFIFATTEPERMPP
                     TILSRTQHYRFRRLTESEIAAKLRRILEGLGREAEEEALFLLARLADGAMRDAESLLD
                     RFLLLPGPLTRAQVEAALGLPPQEALFLLARRLAEGQVREALEEARRLYGQGFAPRSL
                     VGGLMEVLREALYAAHGLPGRSLPLSPKELLFALSRLDEALERLAKRSDPLALEVALL
                     QAFSPSPAQAPPGLQAPPPQEAPLPEFHPLAPLPPRPRQEASPQADLSGLWRAFLEDL
                     KPTLRAFVREARPEVQGKTLLLRFPESKAFHHKKAEEQKAHLLPLAQSRFGVEEVAFL
                     LEKKSPGPSLQTAPPPRAEPPTPKPAPLPVEAPRAEEEPLPPEPEGEDPGQSLTRLAR
                     LLGGRLLWVRRPKPSEPEEPLSEDSIGGSGI"
     misc_feature    6801..8159
                     /locus_tag="TCCBUS3UF1_70"
                     /note="DNA polymerase III subunits gamma and tau;
                     Provisional; Region: PRK14963"
                     /db_xref="CDD:184927"
     misc_feature    6849..7295
                     /locus_tag="TCCBUS3UF1_70"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    6927..6950
                     /locus_tag="TCCBUS3UF1_70"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(6930..6953,7164..7166,7257..7259)
                     /locus_tag="TCCBUS3UF1_70"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    7089..7559
                     /locus_tag="TCCBUS3UF1_70"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08485"
                     /db_xref="CDD:236274"
     misc_feature    7152..7169
                     /locus_tag="TCCBUS3UF1_70"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    7293..7295
                     /locus_tag="TCCBUS3UF1_70"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    7479..7832
                     /locus_tag="TCCBUS3UF1_70"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:256887"
     gene            8428..8709
                     /locus_tag="TCCBUS3UF1_80"
                     /db_xref="GeneID:12251308"
     CDS             8428..8709
                     /locus_tag="TCCBUS3UF1_80"
                     /note="similar to Putative uncharacterized protein
                     TTHA1953 of Thermaceae UniRef RepID=Q5SGX7_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653132.1"
                     /db_xref="GI:384438408"
                     /db_xref="GeneID:12251308"
                     /translation="MTRTTELGQDTVENILKRLRRIEGQVRGLQKMVAEGRPCDEVLT
                     QMTATKKAMEAAATLILHEFLNVCATEVSEGKVDPKKPEEIATMLKKFI"
     misc_feature    8464..8700
                     /locus_tag="TCCBUS3UF1_80"
                     /note="Transcriptional regulators CsoR (copper-sensitive
                     operon repressor), RcnR, and FrmR, and related domains;
                     this domain superfamily was previously known as DUF156;
                     Region: CsoR-like_DUF156; cd10148"
                     /db_xref="CDD:197385"
     misc_feature    order(8470..8475,8482..8487,8494..8496,8503..8508,
                     8512..8517,8524..8535,8539..8547,8551..8559,8563..8568,
                     8572..8577,8584..8589,8596..8601,8605..8613,8617..8625,
                     8632..8634,8659..8664,8668..8697)
                     /locus_tag="TCCBUS3UF1_80"
                     /note="putative homotetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     misc_feature    order(8470..8475,8482..8487,8494..8496,8503..8508,
                     8512..8517,8524..8535,8539..8547,8551..8559,8563..8568,
                     8572..8577,8584..8589,8596..8598,8605..8607,8617..8619,
                     8677..8679,8686..8697)
                     /locus_tag="TCCBUS3UF1_80"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    order(8539..8541,8617..8619,8677..8679)
                     /locus_tag="TCCBUS3UF1_80"
                     /note="putative allosteric switch controlling residues;
                     other site"
                     /db_xref="CDD:197385"
     misc_feature    order(8542..8544,8617..8619,8629..8631)
                     /locus_tag="TCCBUS3UF1_80"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197385"
     misc_feature    order(8599..8601,8608..8613,8620..8625,8629..8634,
                     8659..8664,8668..8676,8680..8685)
                     /locus_tag="TCCBUS3UF1_80"
                     /note="putative homodimer-homodimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:197385"
     gene            8715..9194
                     /locus_tag="TCCBUS3UF1_90"
                     /db_xref="GeneID:12251230"
     CDS             8715..9194
                     /locus_tag="TCCBUS3UF1_90"
                     /note="similar to Putative uncharacterized protein
                     TTHA1954 of Thermaceae UniRef RepID=Q5SGX6_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653133.1"
                     /db_xref="GI:384438409"
                     /db_xref="GeneID:12251230"
                     /translation="MRKGFASRLGKRLARLFRAFRGEVPEDAFALAFLKGEERALYLA
                     MDPRDRAHAVRVAKRLLRAHPQAPSFAVRAALLHDAGKALRPYRPWERILTGLYAPPV
                     PPYPLRRGLWGAIQIRRHHPLYAAERIQDPEVRALVLEHHRPQSLWGKRLHRADQEE"
     gene            9268..11121
                     /locus_tag="TCCBUS3UF1_100"
                     /db_xref="GeneID:12252605"
     CDS             9268..11121
                     /locus_tag="TCCBUS3UF1_100"
                     /note="similar to 2-oxoacid-ferredoxin oxidoreductase of
                     Thermus UniRef RepID=Q72HA4_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoacid-ferredoxin oxidoreductase"
                     /protein_id="YP_005653134.1"
                     /db_xref="GI:384438410"
                     /db_xref="GeneID:12252605"
                     /translation="MDELTWRVGGPQGGGIETAATLFARAVAKGGWCVATKREYHSNI
                     MGRHSYLDVRLSRKPVGAFREKVDFLVALDGETLARHLGEVRPGGVLLYDPRVLDLTV
                     HKLPMLDHRVQEALSQRFGKPDPSLKEVLQAYAEGGVQPLPYPFEEVADRIGAELGVA
                     SLQARRTLNTIAVAASLHLLGFPLEPLLEALALQFRGKVLELNQAVAQAVYREEVPRL
                     PFALHLNGPTPGRVYLTGAQAAALGKLAGGLRFQTYYPISPATDESVYLEAHTAFQGA
                     EVAVVQTEDEIAAVTMAIGAALTGAKAATATSGPGFSLMAEGLGFAGMIEAPLVVTLY
                     QRGGPSTGLPTRTEQGDLFFALRGGHGEYPRLVLASGDVLDAFLDAQKALAWAWRYQT
                     VVVHLLDKFLASTAQSLPKEALRVLALDGEKRLEPRREGFGPYERYAPSEDGISPFVP
                     LGTPGGFYWMTSDEHDLEGHITEDPVLREYQMEKRMQKLHTARREIPPEDQYTLFRDG
                     EVLVLGWGTVKGTLLEALDHLPGVGYLHLRLLWPFPEVGPLLEGKRLVTVEHNYTGQL
                     ADLVQQETLKRVHHRVVKYNGRPITLDEAVAALKAVMAGQAAERLVLRGGV"
     misc_feature    9274..11064
                     /locus_tag="TCCBUS3UF1_100"
                     /note="2-oxoacid:acceptor oxidoreductase, alpha subunit;
                     Region: OAFO_sf; TIGR03710"
                     /db_xref="CDD:234323"
     misc_feature    9304..9894
                     /locus_tag="TCCBUS3UF1_100"
                     /note="Pyruvate ferredoxin/flavodoxin oxidoreductase;
                     Region: POR; pfam01558"
                     /db_xref="CDD:250706"
     misc_feature    9973..10464
                     /locus_tag="TCCBUS3UF1_100"
                     /note="Pyrimidine (PYR) binding domain of pyruvate
                     ferredoxin oxidoreductase (PFOR), indolepyruvate
                     ferredoxin oxidoreductase alpha subunit (IOR-alpha), and
                     related proteins; Region: TPP_PYR_PFOR_IOR-alpha_like;
                     cd07034"
                     /db_xref="CDD:132917"
     misc_feature    order(10018..10023,10039..10041,10051..10053,10060..10062,
                     10108..10119,10138..10143,10147..10155,10162..10164,
                     10168..10170,10219..10221,10228..10230,10240..10242,
                     10279..10284,10333..10338)
                     /locus_tag="TCCBUS3UF1_100"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(10018..10023,10030..10035,10039..10041,10057..10062,
                     10108..10119,10138..10143,10147..10155,10162..10164,
                     10168..10170,10219..10221,10228..10230)
                     /locus_tag="TCCBUS3UF1_100"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(10033..10035,10123..10125)
                     /locus_tag="TCCBUS3UF1_100"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132917"
     misc_feature    order(10039..10041,10273..10275)
                     /locus_tag="TCCBUS3UF1_100"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:132917"
     gene            11123..12037
                     /locus_tag="TCCBUS3UF1_110"
                     /db_xref="GeneID:12252606"
     CDS             11123..12037
                     /locus_tag="TCCBUS3UF1_110"
                     /note="similar to 2-oxoacid ferredoxin oxidoreductase
                     subunit beta PRK11869;
                     similar to Pyruvate ferredoxin/flavodoxin oxidoreductase,
                     beta subunit of cellular organisms UniRef
                     RepID=A9A5B1_NITMS"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyruvate ferredoxin/flavodoxin oxidoreductase,
                     beta subunit"
                     /protein_id="YP_005653135.1"
                     /db_xref="GI:384438411"
                     /db_xref="GeneID:12252606"
                     /translation="MVELKLADYKAEKNPDWCPGCGDYGILSALQMALFELKRDPSQT
                     VVFSGIGCSAKTPHYLNVYGVHTLHGRVLPVAQGAKLANPHLTVVAVGGDGDGLGIGA
                     GHFVAAGRRNVDMLYILYDNEVYGLTKGQAGPTLGLGEKTKSLPKPNPQGRINPLLLA
                     FAAGYTWIARGYAYDVKGLKELIKEGILHRGLAFLHVLQPCPTYNDLHTKEWFAPRLY
                     KLQEEGYDPQVPEGLSPEELDEKMARFQEKAAEWGERIPIGIFWKAEVPTFEERLRAY
                     LPRYPEVYPALGQREALDLEGLLQEFAL"
     misc_feature    11165..12025
                     /locus_tag="TCCBUS3UF1_110"
                     /note="2-oxoacid:acceptor oxidoreductase, beta subunit,
                     pyruvate/2-ketoisovalerate family; Region: PorB_KorB;
                     TIGR02177"
                     /db_xref="CDD:233764"
     misc_feature    11171..11734
                     /locus_tag="TCCBUS3UF1_110"
                     /note="Thiamine pyrophosphate (TPP family), 2-oxoglutarate
                     ferredoxin oxidoreductase (OGFOR) subfamily, TPP-binding
                     module; OGFOR catalyzes the oxidative decarboxylation of
                     2-oxo-acids, with ferredoxin acting as an electron
                     acceptor. In the TCA cycle, OGFOR...; Region: TPP_OGFOR;
                     cd03375"
                     /db_xref="CDD:239470"
     misc_feature    order(11327..11329,11399..11410,11486..11488,11492..11494)
                     /locus_tag="TCCBUS3UF1_110"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239470"
     misc_feature    11723..11950
                     /locus_tag="TCCBUS3UF1_110"
                     /note="Pyruvate ferredoxin oxidoreductase beta subunit C
                     terminal; Region: PFO_beta_C; pfam12367"
                     /db_xref="CDD:257011"
     gene            complement(12038..13318)
                     /locus_tag="TCCBUS3UF1_120"
                     /db_xref="GeneID:12252607"
     CDS             complement(12038..13318)
                     /locus_tag="TCCBUS3UF1_120"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q72HA2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653136.1"
                     /db_xref="GI:384438412"
                     /db_xref="GeneID:12252607"
                     /translation="MPGEGVLVVGAGILGLSAAHFLAEKGLRVLVLEREAPLACTSDK
                     STECYRVFWPGDEALSALVARSLELLGPFGEVARPQGRGYLYLGEEETLLRMAQEAPL
                     AGPLRVHQEATGYPKGAETGMDLLRPQALGQAFPYLAHLRGVAGLHVRRAGWLSAHGL
                     GMGLLEALRKRRGRLLRGEFCGLEGQGGRPAFARVRLGGVEELLPFAACVLAPGPGLP
                     SLLSLLGLELPLGAEPHFKAWFPDPLRRFPREAPLLIWNEPQEIFSPEEKALLAEEPS
                     LAPLLSPLPPGAHGRPEGEGFLALYNPWPKAEAPGGCAPTPPSWAGEVALRGLFPLLP
                     GLRAYLGSRPRVDGGYYVKTPENRPLLGPVAEGVYLLGAFSGYGVMAALGAGEALARW
                     VVGETPPPWAEALSPKRYQDPGYRPHGAAARAEL"
     misc_feature    complement(12071..13303)
                     /locus_tag="TCCBUS3UF1_120"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    complement(<13106..13303)
                     /locus_tag="TCCBUS3UF1_120"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    complement(<13214..13297)
                     /locus_tag="TCCBUS3UF1_120"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     gene            13345..13818
                     /locus_tag="TCCBUS3UF1_130"
                     /db_xref="GeneID:12252608"
     CDS             13345..13818
                     /locus_tag="TCCBUS3UF1_130"
                     /note="similar to molybdenum cofactor biosynthesis protein
                     MoaC PRK09364;
                     similar to Molybdenum cofactor biosynthesis protein C of
                     Bacteria UniRef RepID=MOAC_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdenum cofactor biosynthesis protein C"
                     /protein_id="YP_005653137.1"
                     /db_xref="GI:384438413"
                     /db_xref="GeneID:12252608"
                     /translation="MDLTHFKDGRPHMVDVTEKPATFRTATAEAFVELTEEALAALER
                     GGVGKGDPLVVAQLAGILGAKRTADLIPLCHPLPLTGVEVDLALEKEARRVRIQATVR
                     TKAETGVEMEALTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRREG"
     misc_feature    13381..13800
                     /locus_tag="TCCBUS3UF1_130"
                     /note="MoaC family, prokaryotic and eukaryotic. Members of
                     this family are involved in molybdenum cofactor (Moco)
                     biosynthesis, an essential cofactor of a diverse group of
                     redox enzymes. MoaC, a small hexameric protein, converts,
                     together with MoaA, a guanosine...; Region: MoaC_PE;
                     cd01420"
                     /db_xref="CDD:238708"
     misc_feature    order(13381..13392,13495..13572,13579..13599,13753..13788)
                     /locus_tag="TCCBUS3UF1_130"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    order(13489..13497,13543..13557,13738..13746)
                     /locus_tag="TCCBUS3UF1_130"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238708"
     misc_feature    order(13489..13491,13537..13539,13558..13560,13564..13569,
                     13663..13665,13672..13680,13687..13689,13720..13722,
                     13729..13731)
                     /locus_tag="TCCBUS3UF1_130"
                     /note="putative active site [active]"
                     /db_xref="CDD:238708"
     gene            13828..14160
                     /locus_tag="TCCBUS3UF1_140"
                     /db_xref="GeneID:12252609"
     CDS             13828..14160
                     /locus_tag="TCCBUS3UF1_140"
                     /note="similar to Dinitrogenase iron-molybdenum cofactor
                     biosynthesis protein of Thermus aquaticus Y51MC23 UniRef
                     RepID=B7A991_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="dinitrogenase iron-molybdenum cofactor
                     biosynthesis protein"
                     /protein_id="YP_005653138.1"
                     /db_xref="GI:384438414"
                     /db_xref="GeneID:12252609"
                     /translation="MRLAIALAKHDEGKVYPGPFGHAPRFAIYELAEDGTFLLVEVRE
                     NPHAALEGGDKHQRMRELLKDVDLRVGARFGHGGSMGAFPMADRLEVGPVSLAEALER
                     VKARRNTA"
     misc_feature    13831..>14061
                     /locus_tag="TCCBUS3UF1_140"
                     /note="This CD represents a family of iron-molybdenum
                     cluster-binding proteins that includes NifB, NifX, and
                     NifY, all of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme.  This...; Region:
                     NifX_NifB; cl00252"
                     /db_xref="CDD:260302"
     gene            complement(14135..15061)
                     /locus_tag="TCCBUS3UF1_150"
                     /db_xref="GeneID:12252610"
     CDS             complement(14135..15061)
                     /locus_tag="TCCBUS3UF1_150"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q72HQ2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653139.1"
                     /db_xref="GI:384438415"
                     /db_xref="GeneID:12252610"
                     /translation="MGPGFHRLYAGRLAWRYRLGLALAMALLGLLHPLWALLSPLALL
                     LPARWWEGRALREIARVSLAYPTALAYGEARLWAEAARVRLEPPSFPWGFLLAYLLAL
                     LLALAGTPWRASEGVPTPPIAPTSPTAPTRGAEGPPGSQEPPPGEAPRALEAPSGQGG
                     EGGPGTPGAQGDEGNPGSAEQAPGRERPQGPGGSEGAQGSAGAGQEGVQGPQGASGGE
                     GAQGQGQGDRPGTGGPLPQVDREALPAPTPLGPGQGLLGPGGEGGAPDLPSPWPAGRP
                     PEEVRRGVEVYLERTPLPPEVRELLRRYFGGP"
     misc_feature    complement(14225..>14740)
                     /locus_tag="TCCBUS3UF1_150"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            complement(15128..15556)
                     /locus_tag="TCCBUS3UF1_160"
                     /db_xref="GeneID:12252611"
     CDS             complement(15128..15556)
                     /locus_tag="TCCBUS3UF1_160"
                     /note="similar to Cytochrome c class I of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7ABI5_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c class I"
                     /protein_id="YP_005653140.1"
                     /db_xref="GI:384438416"
                     /db_xref="GeneID:12252611"
                     /translation="MKRFLPLALLLGLLALAQSPGAKLYSANCQSCHQATGQGLPGAF
                     PPLTHLDKVVQAKGGREYLVHVVLYGLQGPLTVEGKAYNGVMPPFRQLKDQEVADLLN
                     HVLTAFAKSKAKAFTAEEVKALRAKPLSPQDVLKSRPPVK"
     misc_feature    complement(15167..>15496)
                     /locus_tag="TCCBUS3UF1_160"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    complement(15239..15496)
                     /locus_tag="TCCBUS3UF1_160"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            complement(15585..16655)
                     /locus_tag="TCCBUS3UF1_170"
                     /db_xref="GeneID:12252612"
     CDS             complement(15585..16655)
                     /locus_tag="TCCBUS3UF1_170"
                     /note="similar to Predicted Fe-S oxidoreductases COG0535;
                     similar to Radical SAM domain-containing protein of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7ABI4_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="YP_005653141.1"
                     /db_xref="GI:384438417"
                     /db_xref="GeneID:12252612"
                     /translation="MKPDLHRFPLLVAWEMTRACLLACLHCRASAVPDPLPDELSTEE
                     GLRLLRELATYTPKPILLPTGGDPLARPDLFLLLEEARRLGLKVGITPAVTPRLTREV
                     VARFKELGVHQMALSLDGASPEAHDGFRGVPGTFALALEALSWAQEVGLMTQVNTTVT
                     RRTVGELPGLAQILAEKGVATWEVFFLVPVGRGAMLEQLSPEAYEEVMHLLYDLSRRY
                     PFKVRTTEGPMFRRVALERRRREGGEDGALVGEGRGVHLSDGFGFVFVAANGEVYPSG
                     FLPLAAGNIREKPLLEIYQRSPLFLELRDRTLLKGKCGVCEYRELCGGSRARAWAETG
                     DYLAADPRCAYTPRGPGQMPLA"
     misc_feature    complement(15615..16646)
                     /locus_tag="TCCBUS3UF1_170"
                     /note="radical SAM protein, BA_1875 family; Region:
                     sam_11; TIGR04053"
                     /db_xref="CDD:234449"
     misc_feature    complement(16032..16616)
                     /locus_tag="TCCBUS3UF1_170"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(16095..16100,16182..16184,16305..16307,
                     16371..16379,16455..16460,16464..16466,16572..16580,
                     16584..16586,16590..16592,16596..16598))
                     /locus_tag="TCCBUS3UF1_170"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(15627..15860)
                     /locus_tag="TCCBUS3UF1_170"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            complement(16694..17683)
                     /locus_tag="TCCBUS3UF1_180"
                     /db_xref="GeneID:12252613"
     CDS             complement(16694..17683)
                     /locus_tag="TCCBUS3UF1_180"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q72H83_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653142.1"
                     /db_xref="GI:384438418"
                     /db_xref="GeneID:12252613"
                     /translation="MRKALALLALALPALAQEVTVYPGFAEVKEAVVLPPSAWVYLAG
                     EKLARIPPGSLRLLGVEEEERVYQGTAVLFRYRGEGKATLRYLYTGLSGEVFYTLEEG
                     RLTAWARLRLEGEALEAQRLTLVSGAVSLEAQPAPGVALRALAEAPQGSPFGLFRYEL
                     PPRRLLPGTTELPFQKAEVRPERLLRLAGPFRTDRFLPLERGYRFQAPFPLAPGPLEA
                     VEGGLFLGQASLPPTPRGEVAEVWLGQDLEARLLRSVRLLSQTDKEATYQVETRLENP
                     YPYPVTLLLSETFPQPFRLDLPGATLLPQGYRLELGLKAKEARTLTYRLTLPR"
     misc_feature    complement(16808..>17311)
                     /locus_tag="TCCBUS3UF1_180"
                     /note="Domain of unknown function (DUF4139); Region:
                     DUF4139; pfam13598"
                     /db_xref="CDD:257913"
     gene            complement(17680..18294)
                     /locus_tag="TCCBUS3UF1_190"
                     /db_xref="GeneID:12252614"
     CDS             complement(17680..18294)
                     /locus_tag="TCCBUS3UF1_190"
                     /note="similar to Metal dependent hydrolase of Thermus
                     UniRef RepID=Q72H82_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Metal dependent hydrolase"
                     /protein_id="YP_005653143.1"
                     /db_xref="GI:384438419"
                     /db_xref="GeneID:12252614"
                     /translation="MSGPEPLRFAATLYRVPVEGGYFLVDAGLPWEAGRLLRLLPQPP
                     RLLFLTHHHLDHSGGALTLWRRFRLPILAHPQEWPYLTGERPRPPLPIPFLGRRLANL
                     APPLPREALRPAEEGMEVLGWRVVALPGHTLGQVGLLKEGVLLAGDALRGKGLPPRFI
                     NEDHGLARKTVRKILDLGAERILLGHGGPLSREEVAALARRLGV"
     misc_feature    complement(17737..18240)
                     /locus_tag="TCCBUS3UF1_190"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(18281..20128)
                     /locus_tag="TCCBUS3UF1_200"
                     /db_xref="GeneID:12252615"
     CDS             complement(18281..20128)
                     /locus_tag="TCCBUS3UF1_200"
                     /note="similar to 1-deoxy-D-xylulose-5-phosphate synthase
                     PRK05444;
                     similar to 1-deoxy-D-xylulose-5-phosphate synthase of
                     Deinococci UniRef RepID=DXS_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="YP_005653144.1"
                     /db_xref="GI:384438420"
                     /db_xref="GeneID:12252615"
                     /translation="MVLDKVNSPEDLKRLSLEELLTLAEEIRSEIIRVTAQNGGHLAS
                     SLGAVELILALHRVFHSPKDRILFDVGHQAYAHKLVTGRKDRFHTLRQEGGISGFTKV
                     SESEHDAITVGHASTSLANALGMALARDLRGEDHHVVAVIGDGALTGGMALAALNKIG
                     ELGKRMLIVLNDNEMSISENVGALNKYFKELQIRKWVQDAEKLGKEILQHISPRLFGL
                     VDRAKEAAKLLLHQENPFYAWGIRYVGPVDGHDLKGLIHILEHLKELEGPTLLHVVTQ
                     KGKGYKVAEADPIYWHGPPGFNPEKPEKVSKGYSWSQAFGDAVTELAHLEPRLFVITP
                     AMREGSGLVRYSLEHPERYLDVGICEDVAVTTAAGLALKGMKPVVAIYSTFLQRAYDQ
                     AIHDVAIENLPVVFAIDRAGIVGADGATHHGVFDIAYLRTIPNFQIAAPKDALELRAM
                     LRKALEVGGPVAIRYPRDNVERVPEGVWPEIPWGKWEVVKEGREAYILAFGKTLRYAL
                     EAAGDDPRVGVVNARFLKPLDREMLRELAAYKLLTVEDHQRMGGFGSAVLEALNEMGL
                     RPEIRVLGLPDRFLDHGTIPSLHRQAGIDAEGIRRALAEMGLHPAYERA"
     misc_feature    complement(18311..20128)
                     /locus_tag="TCCBUS3UF1_200"
                     /note="1-deoxy-D-xylulose-5-phosphate synthase;
                     Provisional; Region: PRK05444"
                     /db_xref="CDD:235470"
     misc_feature    complement(19286..20014)
                     /locus_tag="TCCBUS3UF1_200"
                     /note="Thiamine pyrophosphate (TPP) family, DXS subfamily,
                     TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate
                     synthase (DXS) is a regulatory enzyme of the
                     mevalonate-independent pathway involved in terpenoid
                     biosynthesis. Terpeniods are plant natural products...;
                     Region: TPP_DXS; cd02007"
                     /db_xref="CDD:238965"
     misc_feature    complement(order(19604..19606,19610..19612,19691..19702,
                     19784..19786))
                     /locus_tag="TCCBUS3UF1_200"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238965"
     misc_feature    complement(18728..19192)
                     /locus_tag="TCCBUS3UF1_200"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(18755..18757,18818..18823,18869..18871,
                     18878..18880,18953..18958,18965..18967,19019..19027,
                     19031..19036,19043..19060,19064..19066,19073..19075,
                     19124..19126,19142..19144,19148..19150))
                     /locus_tag="TCCBUS3UF1_200"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(18827..18829,18833..18838,18842..18847,
                     18872..18874,18878..18880,18959..18961,18965..18970,
                     19049..19057,19064..19066,19124..19126))
                     /locus_tag="TCCBUS3UF1_200"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(18965..18967,18974..18976,19049..19051,
                     19055..19057))
                     /locus_tag="TCCBUS3UF1_200"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(18332..18679)
                     /locus_tag="TCCBUS3UF1_200"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            complement(20137..20766)
                     /locus_tag="TCCBUS3UF1_210"
                     /db_xref="GeneID:12252616"
     CDS             complement(20137..20766)
                     /locus_tag="TCCBUS3UF1_210"
                     /note="similar to Hypothetical exported protein of Thermus
                     UniRef RepID=Q72H80_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653145.1"
                     /db_xref="GI:384438421"
                     /db_xref="GeneID:12252616"
                     /translation="MALALALAACAPQVTQSPEARPQLKEVGFYPSTTGLEWVYVPEG
                     EALSAPPYRVRAEGPAVFEGQEALRFRSFGRGEERVYYRQVGPFGVRLLGFQDPSARV
                     VFTPALLEYPPEALLSPGYRWSGTVQVRVELLTPGGREPLAQGALDYTMEVLEEREVR
                     LPAGVFRVYRIRQTFRDRQGQDAREVWLAPRVGEVRTREGRILVERNFN"
     misc_feature    complement(20173..>20397)
                     /locus_tag="TCCBUS3UF1_210"
                     /note="Protein of unknown function (DUF3108); Region:
                     DUF3108; pfam11306"
                     /db_xref="CDD:256405"
     gene            complement(20792..21190)
                     /locus_tag="TCCBUS3UF1_220"
                     /db_xref="GeneID:12252617"
     CDS             complement(20792..21190)
                     /locus_tag="TCCBUS3UF1_220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653146.1"
                     /db_xref="GI:384438422"
                     /db_xref="GeneID:12252617"
                     /translation="MPLFLELLLLALALALLALLLRPEPKGLAWARARLQGLVDWGEV
                     EAALKALEAREKELQEALQAPHLLPETRGELERALEEARETRRRLLALVQSLAAERAL
                     ARGGAEEARRLEERLRALREVLVSLRPGKG"
     misc_feature    complement(<20825..>21100)
                     /locus_tag="TCCBUS3UF1_220"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     cl19303"
                     /db_xref="CDD:267656"
     gene            complement(21198..21860)
                     /locus_tag="TCCBUS3UF1_230"
                     /db_xref="GeneID:12252618"
     CDS             complement(21198..21860)
                     /locus_tag="TCCBUS3UF1_230"
                     /note="similar to Phage shock protein A of Thermaceae
                     UniRef RepID=Q5SMD5_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein A"
                     /protein_id="YP_005653147.1"
                     /db_xref="GI:384438423"
                     /db_xref="GeneID:12252618"
                     /translation="MNLLDRIGRLIRANLNDLLRRAEDPEKILEQALGDMKEALKEAR
                     EQVAAALAEGKRLEREVESHLQEAALWEEKAKEALGAGREDLAKEALRRRKRALDLAE
                     GFKQQLAEQRALSERLLTQLKALEAKIDEAESRKKLLLARKKGVEAAEAVRRLESRLD
                     QHPALEAFEEMEARILALEDRHEALKELDGKDLEKELAALSADKEVEEELTRLKRELG
                     QA"
     misc_feature    complement(21204..21860)
                     /locus_tag="TCCBUS3UF1_230"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    complement(21204..21860)
                     /locus_tag="TCCBUS3UF1_230"
                     /note="Phage shock protein A (IM30), suppresses
                     sigma54-dependent transcription [Transcription / Signal
                     transduction mechanisms]; Region: PspA; COG1842"
                     /db_xref="CDD:224755"
     gene            21940..22533
                     /locus_tag="TCCBUS3UF1_240"
                     /db_xref="GeneID:12252619"
     CDS             21940..22533
                     /locus_tag="TCCBUS3UF1_240"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653148.1"
                     /db_xref="GI:384438424"
                     /db_xref="GeneID:12252619"
                     /translation="MHLLKDPVEARLLQAALELLAERGYRGATTKEVARRAGVSEVTL
                     FRRFGRKEALFRRALSSFVPPGFLERLPGEGVSLEEGLMRLLQAYLGLLEAHRALFLK
                     LLPELLRHPELKEEGPPEGLRAAMERVVGFFRAHQGQGGLREDEPAEELALAFLGPLL
                     ARFLLGEVLGVGMPLDPAAYVRGYLEGRYGPRRGSHA"
     misc_feature    22000..22113
                     /locus_tag="TCCBUS3UF1_240"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     misc_feature    22006..22500
                     /locus_tag="TCCBUS3UF1_240"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     gene            22505..23365
                     /locus_tag="TCCBUS3UF1_250"
                     /db_xref="GeneID:12252620"
     CDS             22505..23365
                     /locus_tag="TCCBUS3UF1_250"
                     /note="similar to ABC transporter related protein of
                     Meiothermus UniRef RepID=D7BE47_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653149.1"
                     /db_xref="GI:384438425"
                     /db_xref="GeneID:12252620"
                     /translation="MVHAEEVTRSFGGTRALDRVSLSVRPGEVFGLLGPNGAGKTTLV
                     RILSGVLRPDGGKAWVAGLEVAREPHRVKARIGYATQEASVYRDLMVEENLLFRARLY
                     RPKEARALAAEALVRFGLTPYAKALAGHLSGGWRQRLALAQAVVHRPEVLFLDEPTTG
                     LDPLSRRSIWELIHQEAARGAAVLVTTHYMDEAERCHRLGLLFGGRVLAEGTPQELKA
                     QAKARAQFLFAPGASLEEVRGWPGVLEAWPSGEGVRLLLRRQAPRAAGWVEVEPSLED
                     VFVLLTKEAA"
     misc_feature    22505..23356
                     /locus_tag="TCCBUS3UF1_250"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    22508..23125
                     /locus_tag="TCCBUS3UF1_250"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    22604..22627
                     /locus_tag="TCCBUS3UF1_250"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(22613..22618,22622..22630,22745..22747,22967..22972,
                     23066..23068)
                     /locus_tag="TCCBUS3UF1_250"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    22736..22747
                     /locus_tag="TCCBUS3UF1_250"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    22895..22924
                     /locus_tag="TCCBUS3UF1_250"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    22955..22972
                     /locus_tag="TCCBUS3UF1_250"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    22979..22990
                     /locus_tag="TCCBUS3UF1_250"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    23054..23074
                     /locus_tag="TCCBUS3UF1_250"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            23362..24483
                     /locus_tag="TCCBUS3UF1_260"
                     /db_xref="GeneID:12252621"
     CDS             23362..24483
                     /locus_tag="TCCBUS3UF1_260"
                     /note="similar to ABC-type multidrug transport system,
                     permease component COG0842;
                     similar to ABC-2 type transporter of Meiothermus UniRef
                     RepID=D3PLD7_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653150.1"
                     /db_xref="GI:384438426"
                     /db_xref="GeneID:12252621"
                     /translation="MNRVLALAEKELLQIRRDRVLPRLIVLLPTLMLLLFGYAINFTL
                     EGIPLAVADASRDRVSQTLVEELQRDGRFRLVFQAASPQEVLEAVDRGQARVGLVVPA
                     GALEKVRRGESLSLEVYVDGTDPNFAFQAQAALRKAIQEVNARILLGRALAGEAVLPP
                     LSPVLHTLYNPENRTAWFMIPGIIGLVLTMFTVLLTALAIVREAESRMMESLLASPLR
                     PHEMVLGKVLPYLLIAFLVALLVLALGHWVFGVPVRGSLALLLLAMFLFVLGSLAAGV
                     LISTLARTQVQAVFGTYAYAFPTIFLSGFVFPIDGMPRFFQALSYLVPARYLIEVLRG
                     VMLKGVGFSVLWPHLLALALFSVLVLFLASARFQRQVAV"
     misc_feature    23362..24471
                     /locus_tag="TCCBUS3UF1_260"
                     /note="ABC-type Na+ efflux pump, permease component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatB; COG1668"
                     /db_xref="CDD:224582"
     misc_feature    23866..24372
                     /locus_tag="TCCBUS3UF1_260"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     pfam01061"
                     /db_xref="CDD:250332"
     gene            24480..25229
                     /locus_tag="TCCBUS3UF1_270"
                     /db_xref="GeneID:12252622"
     CDS             24480..25229
                     /locus_tag="TCCBUS3UF1_270"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653151.1"
                     /db_xref="GI:384438427"
                     /db_xref="GeneID:12252622"
                     /translation="MRRFLALGFLLGLALAQGRLEGGVYASLASMGPTLEAALSLGEG
                     EVYLRAQGGRAGLGYLGGLALGPLGYLAYGVQGELGEGGLGGVLFAEGGAGLLAFQGR
                     LGYRPQGAFPLFPEAGPFGRLSLRYRLVPREVVGFLVEGGEAFRLEATYALRQEATHT
                     LGLGVAGWPYLVLGHKGEVGEEGEVLDLLLRLGGINRLEAGLYLGEASLFLTLSHPWA
                     GSVGAWLGDLGLEAGYRGAPYAWIRYVWRWP"
     gene            25229..25867
                     /locus_tag="TCCBUS3UF1_280"
                     /db_xref="GeneID:12252623"
     CDS             25229..25867
                     /locus_tag="TCCBUS3UF1_280"
                     /note="similar to Hypothetical conserved protein of
                     Thermaceae UniRef RepID=Q72JW6_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653152.1"
                     /db_xref="GI:384438428"
                     /db_xref="GeneID:12252623"
                     /translation="MGKRILVLVLCLGLALAQSVAEILERVEKNLQDPWQALVQGQVQ
                     GPSGLEELRARLLAIPKENLFRLEFLKPGSLEGNFTVITEKEVWNYLYLTNQLVVSPK
                     EKAQVQGLGFSPQGLGDLKALSERVSLRLGGEERLAEGVAWRLLGQAKEGQGFAQLEL
                     YILKADPRPVRFLFRDEAGKVLAELRVVEFKKTPLRAQDLKRYPKDAQVVRR"
     misc_feature    25241..25840
                     /locus_tag="TCCBUS3UF1_280"
                     /note="Outer membrane lipoprotein carrier protein LolA;
                     Region: LolA; cl19192"
                     /db_xref="CDD:267545"
     gene            complement(25869..26807)
                     /locus_tag="TCCBUS3UF1_290"
                     /db_xref="GeneID:12251381"
     CDS             complement(25869..26807)
                     /locus_tag="TCCBUS3UF1_290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653153.1"
                     /db_xref="GI:384438429"
                     /db_xref="GeneID:12251381"
                     /translation="MAQADPMPPRETALEDTLSWTGSLEEFPLSAVLQTLAKTRSTGT
                     LWIQPVAAGLHLREGRLQAVSGLLPLGDILLARGQLEEEDLAEALKRRVRPLGQALLQ
                     QGLGAEALREALSLQVHLGIAFLLHYLPGQAFHFRPTPPLPPPEADLEITPLLLEWLR
                     LHKPLPLSAPVELAPQPGPVHLDEEAWRLVRLVNGRRSLANVLRFSGLHPKRAWEKAE
                     ELLHRGLLRPSALFGLRLIVPARAPRRANYHPPSSLMANLFLKWVNGERTAAQIGEIL
                     GLKPQETALYLVDLFREGLIEVAQGRPEMERLADDF"
     misc_feature    complement(26469..26747)
                     /locus_tag="TCCBUS3UF1_290"
                     /note="Domain of unknown function (DUF4388); Region:
                     DUF4388; pfam14332"
                     /db_xref="CDD:258505"
     gene            complement(26842..27870)
                     /locus_tag="TCCBUS3UF1_300"
                     /db_xref="GeneID:12251382"
     CDS             complement(26842..27870)
                     /locus_tag="TCCBUS3UF1_300"
                     /note="similar to cysteine synthase B PRK11761;
                     similar to Cysteine synthase of Bacteria UniRef
                     RepID=D3PSI3_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="YP_005653154.1"
                     /db_xref="GI:384438430"
                     /db_xref="GeneID:12251382"
                     /translation="MFTLSQARLAPLSLANPWVGEKASPVFALPRAYSGGMRVEGVIG
                     RTPLVRLARVVEPGMAEVWVKLEGQNPGGSIKDRPAWYMIRDAEERGLLRPGSGQVIV
                     EPTSGNTGIGLAMIAASRGYRLILTMPAQMSEERKRVLRAFGAELVLTDPERRMLAAR
                     EEALRLKEALGAFMPDQFANPANVRAHYETTGPELYQALEGRIDAFVYGSGTGGTLSG
                     VGRYLKERIPGVKVFAVEPARSNVLSGGKMGQHGFQGMGPGFIPENLDLSLLDGVIQV
                     WEEDAFPLARRLAREEGLFLGMSSGGIVWAALQVARELGPGKRVACISPDGGWKYLST
                     PLYATLEP"
     misc_feature    complement(26848..27756)
                     /locus_tag="TCCBUS3UF1_300"
                     /note="cysteine synthase; Region: PLN02565"
                     /db_xref="CDD:166206"
     misc_feature    complement(26872..27741)
                     /locus_tag="TCCBUS3UF1_300"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    complement(order(26875..26877,26884..26886,26914..26916,
                     26986..26994,26998..27006,27277..27282,27442..27447,
                     27454..27459,27466..27471,27517..27519,27526..27528,
                     27658..27660,27664..27666,27682..27684,27721..27729))
                     /locus_tag="TCCBUS3UF1_300"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    complement(order(26893..26898,26974..26976,27106..27108,
                     27226..27243,27547..27549,27643..27645))
                     /locus_tag="TCCBUS3UF1_300"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    complement(27643..27645)
                     /locus_tag="TCCBUS3UF1_300"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            27869..28336
                     /locus_tag="TCCBUS3UF1_310"
                     /db_xref="GeneID:12251383"
     CDS             27869..28336
                     /locus_tag="TCCBUS3UF1_310"
                     /note="similar to FKBP-type peptidyl-prolyl cis-trans
                     isomerases 2 COG1047;
                     similar to Peptidyl-prolyl cis-trans isomerase of
                     Meiothermus ruber DSM 1279 UniRef RepID=D3PSI2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_005653155.1"
                     /db_xref="GI:384438431"
                     /db_xref="GeneID:12251383"
                     /translation="MKVEQDKVVTIRYTLQVEGEVLDQGELSYLHGHGNLIRGLEEEL
                     EGREEGESFQAHVPAEKAYGPHDPDGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMP
                     LTVVEVQGEEVTIDFNHPLAGKDLDFAVEVVRVREATPEELLHGHAHEGGHAH"
     misc_feature    27869..28333
                     /locus_tag="TCCBUS3UF1_310"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; cl19519"
                     /db_xref="CDD:267872"
     misc_feature    27869..28333
                     /locus_tag="TCCBUS3UF1_310"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 2
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SlpA; COG1047"
                     /db_xref="CDD:223976"
     gene            28453..28659
                     /locus_tag="TCCBUS3UF1_320"
                     /db_xref="GeneID:12251384"
     CDS             28453..28659
                     /locus_tag="TCCBUS3UF1_320"
                     /note="similar to Cold-shock DNA-binding domain protein of
                     Bacteria UniRef RepID=Q1J0P4_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Cold-shock DNA-binding domain protein"
                     /protein_id="YP_005653156.1"
                     /db_xref="GI:384438432"
                     /db_xref="GeneID:12251384"
                     /translation="MKKGTVKWFNAEKGYGFIQQEEGPDVFVHFSAIEAEGFRTLNEG
                     ERVEFEVEPGRGGKGPQAKKVRRL"
     misc_feature    28456..28653
                     /locus_tag="TCCBUS3UF1_320"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    order(28474..28476,28501..28503,28531..28533,28624..28626)
                     /locus_tag="TCCBUS3UF1_320"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(28492..28512,28528..28539)
                     /locus_tag="TCCBUS3UF1_320"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            28683..29465
                     /locus_tag="TCCBUS3UF1_330"
                     /db_xref="GeneID:12251385"
     CDS             28683..29465
                     /locus_tag="TCCBUS3UF1_330"
                     /note="similar to stationary phase survival protein SurE
                     PRK00346;
                     similar to 5'-nucleotidase surE of Deinococci UniRef
                     RepID=SURE_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase surE"
                     /protein_id="YP_005653157.1"
                     /db_xref="GI:384438433"
                     /db_xref="GeneID:12251385"
                     /translation="MGGPFSFRLKAMRILVSNDDGIFSPGIKALGLAMRALGEVYVVA
                     PDVEQSAVGHGITVRRPLRFKHTQSAGFGEIPAYRVDGTPADCVVLGVHLLGRPDLLV
                     SGINIGVNLGLDLTHSGTVAAALEGASLGIPSIAFSLDTSGEEMNFALAAEWAVRIAR
                     RVAERGLPKGVLLNVNFPAGTPKGIQVTRLSTHRFEDTVVERIDPEGKPYYWIAGTPV
                     GEEEEGTDLWAVRRGYISLTPVSLDFTAAHFLGELAEWAQGL"
     misc_feature    28716..29450
                     /locus_tag="TCCBUS3UF1_330"
                     /note="5'(3')-nucleotidase/polyphosphatase; Provisional;
                     Region: surE; PRK00346"
                     /db_xref="CDD:234732"
     gene            complement(29462..30232)
                     /locus_tag="TCCBUS3UF1_340"
                     /db_xref="GeneID:12251386"
     CDS             complement(29462..30232)
                     /locus_tag="TCCBUS3UF1_340"
                     /note="similar to Hypothetical conserved protein of
                     Thermaceae UniRef RepID=Q72H50_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653158.1"
                     /db_xref="GI:384438434"
                     /db_xref="GeneID:12251386"
                     /translation="MRPVFFLSDFGLEDPYVGVVKAVLAQRAPGVGVVDLGHGLPPQD
                     LRRGAYALFEALPYLPEGAVVLAVVDPGVGTERRAIAAEGRWWYVGPDNGLFTLAWLL
                     DPPRRAFTLERVRPPTPHGGFPGWSPGGYTFHGRDRFAPAAAHLALGLPPEALGLEVP
                     VADLVRLPLALTPGPEGEVLTFDRFGNAITTLLQAPLGGWVEVGGWRIPVRRTFGEVG
                     EGEAVAYRGSGGLLEVAVNRGRAREALGLREGMPVRLL"
     misc_feature    complement(29468..30223)
                     /locus_tag="TCCBUS3UF1_340"
                     /note="S-adenosyl-l-methionine hydroxide
                     adenosyltransferase; Region: SAM_adeno_trans; pfam01887"
                     /db_xref="CDD:250942"
     gene            complement(30234..31664)
                     /locus_tag="TCCBUS3UF1_350"
                     /db_xref="GeneID:12251387"
     CDS             complement(30234..31664)
                     /locus_tag="TCCBUS3UF1_350"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653159.1"
                     /db_xref="GI:384438435"
                     /db_xref="GeneID:12251387"
                     /translation="MLVLWGLSAFAQGAEEYYARCQRLYVQGALESAQATCELALVSN
                     PEHRPSLRLLARIALERGDLAQARGYLERLGEDPEALGLRARLLLGEGKPGEVLGLPL
                     PQDPEGRFLRASALEGLGRLEEALAEATGLPPTPEARLLLARLHLALGHPERALAALG
                     SSREERVEQGHLLLLLGNPEEAARLLEALLPELAGQPSLQRKALATLVLAYLGQGDLA
                     RGRAALAQLAQLENLPGRFLERTWPWFLALLAFLVLVLLGESRIEPLRTLEVVEEPKP
                     GPGRLYLLVLAALLGAFLVALLLGKALFGNLLALFTPYQQGQVLPTFYLAYGLFLFLG
                     VFLGERRRLPGLLGPWGSWVEGFWVGPTLALALLAYGALRSLLGLSTLPLDLLTFLGF
                     AFMEPLFRGLAPLAFRERYGEMGRSLTALFFAVAVPGPSLLLLLLGAGLLWAKERAGS
                     VLGVALGWVVAGVLLALLPPGWLRRF"
     misc_feature    complement(<31269..31586)
                     /locus_tag="TCCBUS3UF1_350"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     gene            31776..32441
                     /locus_tag="TCCBUS3UF1_360"
                     /db_xref="GeneID:12251388"
     CDS             31776..32441
                     /locus_tag="TCCBUS3UF1_360"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653160.1"
                     /db_xref="GI:384438436"
                     /db_xref="GeneID:12251388"
                     /translation="MALSLAQAPQVAALVDAGRFQEAYEAGLRLATPEALALAAKGAS
                     FHAMYLAKPEEKRAWFERAEKAASQAIAKAPDYAEGYFERARALGRLAQYKGILEALA
                     EGLAPRIRSDLEKTLKLDPNHAGAMVALALWHFELVQKGWLVAATQGADGAKVEPLMK
                     KAIELEPDGIIHRVEYAKVLAAWNKKEEARKQLETALSLPAKTAADRYDQERARQELA
                     RLK"
     gene            complement(32444..33040)
                     /locus_tag="TCCBUS3UF1_370"
                     /db_xref="GeneID:12251389"
     CDS             complement(32444..33040)
                     /locus_tag="TCCBUS3UF1_370"
                     /note="similar to Predicted membrane protein COG2860;
                     similar to Transporter of Thermus thermophilus HB27 UniRef
                     RepID=Q72HP9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="YP_005653161.1"
                     /db_xref="GI:384438437"
                     /db_xref="GeneID:12251389"
                     /translation="MVELLVWLGTLVFAATGALKGVEKGFDLLGVLVLATVTAVGGGS
                     IRDVLVGTLPPTALRNEALLWSVVLTGLLVFRFHPRVQALERPIYYLDTLGLGLFAAL
                     GAERGLEAGLGPFGVALAGTLSGVGGGVLRDVLSGEVPGILYRAGDLYASAALVGALV
                     AYALHGAHPEWALFAGALATVLLRVFGRRLGLRLPTPR"
     misc_feature    complement(32453..33040)
                     /locus_tag="TCCBUS3UF1_370"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2860"
                     /db_xref="CDD:225415"
     misc_feature    complement(32795..33037)
                     /locus_tag="TCCBUS3UF1_370"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     misc_feature    complement(32546..32779)
                     /locus_tag="TCCBUS3UF1_370"
                     /note="UPF0126 domain; Region: UPF0126; pfam03458"
                     /db_xref="CDD:251969"
     gene            complement(33033..33491)
                     /locus_tag="TCCBUS3UF1_380"
                     /db_xref="GeneID:12251390"
     CDS             complement(33033..33491)
                     /locus_tag="TCCBUS3UF1_380"
                     /note="similar to bifunctional 2-C-methyl-D-erythritol
                     4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase protein PRK09382;
                     similar to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase of Deinococci UniRef RepID=ISPF_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-C-methyl-D-erythritol 2,4-cyclo diphosphate
                     synthase"
                     /protein_id="YP_005653162.1"
                     /db_xref="GI:384438438"
                     /db_xref="GeneID:12251390"
                     /translation="MRLGYGEDSHRLLEGRPLYLCGLWLPSPVGALAHSDGDAALHAL
                     TDALLSAYGLGDIGLLFPDTDPRWQGVRSEVFLKEALRRVEERGGRLVQASLVLVLDR
                     PKLSPHRQALVDNLARLLGLPQDRVGLSFKTSEGLAEGHVQARAVVLLDG"
     misc_feature    complement(33042..33488)
                     /locus_tag="TCCBUS3UF1_380"
                     /note="MECDP_synthase
                     (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase),
                     encoded by the ispF gene, catalyzes the formation of
                     2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the
                     non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid
                     biosynthesis; Region: MECDP_synthase; cd00554"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(33045..33047,33051..33053,33057..33059,
                     33084..33092,33099..33104,33108..33110,33174..33176,
                     33180..33182,33201..33203,33207..33209,33213..33215,
                     33324..33329,33333..33338,33342..33344,33447..33449,
                     33459..33467,33471..33473,33477..33479,33483..33488))
                     /locus_tag="TCCBUS3UF1_380"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(33366..33368,33462..33464,33468..33470))
                     /locus_tag="TCCBUS3UF1_380"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(33093..33101,33174..33185,33189..33194,
                     33318..33320,33324..33326))
                     /locus_tag="TCCBUS3UF1_380"
                     /note="CDP-binding sites; other site"
                     /db_xref="CDD:100025"
     gene            33508..34059
                     /locus_tag="TCCBUS3UF1_390"
                     /db_xref="GeneID:12251391"
     CDS             33508..34059
                     /locus_tag="TCCBUS3UF1_390"
                     /note="similar to Predicted hydrolase (HD superfamily)
                     COG2316;
                     similar to Metal dependent phosphohydrolase of Bacteria
                     UniRef RepID=D7BD66_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Metal dependent phosphohydrolase"
                     /protein_id="YP_005653163.1"
                     /db_xref="GI:384438439"
                     /db_xref="GeneID:12251391"
                     /translation="MPSFAEALALMEAWTESESLRRHMRAVEVAMRAYARRYGEDEEL
                     WAMAGVLHDMDYEKYPGEHPYRGVEALRQLGYPEEVLEAILAHASYTGVPRRTRMAKA
                     LFAVDELTGLITAAVYVRPDRSILGLELPSLKKKFKDKAFAKGVNREEILKGAEDLGV
                     PLDEHLAFVLEAMRAEAGLLGLG"
     misc_feature    33523..34053
                     /locus_tag="TCCBUS3UF1_390"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cl17215"
                     /db_xref="CDD:266561"
     gene            34060..34416
                     /locus_tag="TCCBUS3UF1_400"
                     /db_xref="GeneID:12251392"
     CDS             34060..34416
                     /locus_tag="TCCBUS3UF1_400"
                     /note="similar to FUN14 family protein of Thermaceae
                     UniRef RepID=D7BD68_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="FUN14 protein"
                     /protein_id="YP_005653164.1"
                     /db_xref="GI:384438440"
                     /db_xref="GeneID:12251392"
                     /translation="MPCPLGAARVGGVELPDLTPYLGQMTFGGLAGYAVGFALKKVGR
                     LLAFSLGLLFVALQLLAQAGYVQVDWTRIQKEVEPLLQGPGLKNLWEGLLRTLTYNLP
                     FGASFMGGFLLGLRAG"
     misc_feature    34129..34407
                     /locus_tag="TCCBUS3UF1_400"
                     /note="FUN14 family; Region: FUN14; pfam04930"
                     /db_xref="CDD:252885"
     gene            complement(34403..34963)
                     /locus_tag="TCCBUS3UF1_410"
                     /db_xref="GeneID:12251393"
     CDS             complement(34403..34963)
                     /locus_tag="TCCBUS3UF1_410"
                     /note="similar to 5-formyltetrahydrofolate cyclo-ligase
                     COG0212;
                     similar to 5-formyltetrahydrofolate cyclo-ligase of
                     Thermaceae UniRef RepID=Q5SLW0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="YP_005653165.1"
                     /db_xref="GI:384438441"
                     /db_xref="GeneID:12251393"
                     /translation="MTLGELREEVWNALARHGLALHPTPPHGHHPNFLGGRRAAERLL
                     ATPEFLGARLLLVGMDAVLKPLREEALRRGKALLLPHPDRPGEFLLLKDLDPRRLKRV
                     REAYRFGVKAPLEGQPIDLVLIGAVAVDEEGGWVGKGYGFPQAWLRVAAPFATLAHPL
                     MVYPRLPVTPERRVDLIATPERLIRP"
     misc_feature    complement(34409..34852)
                     /locus_tag="TCCBUS3UF1_410"
                     /note="5-formyltetrahydrofolate cyclo-ligase family;
                     Region: 5-FTHF_cyc-lig; cl00360"
                     /db_xref="CDD:260381"
     gene            35019..38687
                     /locus_tag="TCCBUS3UF1_420"
                     /db_xref="GeneID:12251394"
     CDS             35019..38687
                     /locus_tag="TCCBUS3UF1_420"
                     /note="similar to DNA polymerase III subunit alpha
                     PRK05673;
                     similar to DNA polymerase III subunit alpha of Bacteria
                     UniRef RepID=DPO3A_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="YP_005653166.1"
                     /db_xref="GI:384438442"
                     /db_xref="GeneID:12251394"
                     /translation="MASRLKFAHLHQHTQYSLLDGAAKLTDLLKWVKEVSPEEPALAI
                     TDHGNLFGAIEFYKKATAMGVKPILGYEAYVAAESRFDRKRGKGLDGGYFHLTLLAKD
                     FRGYQNLVRLASRAYLEGFYEKPRIDREILREHAEGLIALSGCLGAEIPQFILQDRLD
                     LAEARLQEYLSIFGDRFFLELQNHGLPEQQKVNAVLKEFARKYGLGMVATNDGHYVRK
                     EDARAHEVLLAVQSKTTLDDPERWRFPCDEFYVKTPEEMRAAFPEAEWGDEPFDNTVV
                     IARMCQVDLPIGDRMVYRIPRFPLPEGRTEAQYLRELTFLGLLRRYPDRITEGFYREV
                     FRRLGKLPPHGDGVALAQALAQVEEGAWEAFLSGLPPLEGVGEWTAEAILHRALYELS
                     VIERMGFPGYFLIVQDYINWARQNGISVGPGRGSAAGSLVAYAVGITNIDPLRFGLLF
                     ERFLNPERVSMPDIDTDFSDRERDRVIEYVRRRYGADRVAQIGTFGSLASKAALKDVA
                     RVYGIPHKKAEELAKLIPVQFGKPKPLAEAIQVVPELRAEMEKDPKVREVLEVAMRLE
                     GLNRHASVHAAGVVIAQEPLTDLVPLMRDQEGRPVTQYDMGAVEALGLLKMDFLGLRT
                     LTFLDEAKRILKESRGVELDYDRIPLDDPKTFDLLSRGETKGVFQLESGGMTSTVRGL
                     KPRRLEDIIALVSLYRPGPMEHIPTYIRRHHGQEPVAYPEFPHAERYLRPILEETYGI
                     PVYQEQIMQIASAVAGYSLGEADLLRRAMGKKKLEEMQRHRERFVRGAKERGIPEEEA
                     HRLFDMLEAFANYGFNKSHAAAYSLLAYQTAYVKAHYPVEYMAALLSVERHDSDKVAE
                     YIRDARSLGIPVLPPDINRSGFDFKVVGGEILFGLSAVKNVGEGAASAILQERERGGP
                     YRSLGDFLKRLDEKVVNKRTLESLVKAGAFDAFGDRARLLASLEPLLRWAAESRERAR
                     SGMMGLFAEVEEPPLAEASPLDEITRLRYEKEALGIYVSGHPVLRYPGLREVASCALE
                     DLPHFAHDLPPRARVLLAGMVEEVVRKPTKSGGMMARFVLSDETGALEAVAFGRAYEG
                     VSPKLKEDTPLLVLAEVEREEGGVRVMAQAVWTYEEVAEAPKALEVEADHALLDEKGV
                     TLLKSLLDEHPGPYPFYVRVQGPFGEALFALKEVRASEEALRALEAEGFRAYLVPDRE
                     VFLQGNGGNGSKEEAVPF"
     misc_feature    35037..38594
                     /locus_tag="TCCBUS3UF1_420"
                     /note="DNA polymerase III subunit alpha; Validated;
                     Region: dnaE; PRK05673"
                     /db_xref="CDD:235554"
     misc_feature    35037..35891
                     /locus_tag="TCCBUS3UF1_420"
                     /note="Polymerase and Histidinol Phosphatase domain of
                     alpha-subunit of bacterial polymerase III DnaE3; Region:
                     PHP_PolIIIA_DnaE3; cd12113"
                     /db_xref="CDD:213997"
     misc_feature    order(35049..35051,35055..35057,35076..35078,35157..35159,
                     35232..35234,35652..35654,35658..35660)
                     /locus_tag="TCCBUS3UF1_420"
                     /note="active site"
                     /db_xref="CDD:213997"
     misc_feature    35211..35219
                     /locus_tag="TCCBUS3UF1_420"
                     /note="PHP Thumb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213997"
     misc_feature    order(35463..35465,35523..35525)
                     /locus_tag="TCCBUS3UF1_420"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213997"
     misc_feature    36084..37394
                     /locus_tag="TCCBUS3UF1_420"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; pfam07733"
                     /db_xref="CDD:254393"
     misc_feature    37611..37877
                     /locus_tag="TCCBUS3UF1_420"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:258717"
     misc_feature    38154..38405
                     /locus_tag="TCCBUS3UF1_420"
                     /note="DnaE_OBF: A subfamily of OB folds corresponding to
                     the C-terminal OB-fold nucleic acid binding domain of
                     Thermus aquaticus and Escherichia coli type C replicative
                     DNA polymerase III alpha subunit (DnaE). The DNA
                     polymerase holoenzyme of E. coli contains...; Region:
                     DnaE_OBF; cd04485"
                     /db_xref="CDD:239931"
     misc_feature    order(38154..38156,38310..38312,38316..38318,38322..38324,
                     38376..38378)
                     /locus_tag="TCCBUS3UF1_420"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239931"
     misc_feature    order(38169..38177,38217..38228,38232..38234,38250..38258,
                     38262..38264,38307..38309,38328..38336,38355..38363)
                     /locus_tag="TCCBUS3UF1_420"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239931"
     gene            complement(38734..40365)
                     /locus_tag="TCCBUS3UF1_430"
                     /db_xref="GeneID:12251395"
     CDS             complement(38734..40365)
                     /locus_tag="TCCBUS3UF1_430"
                     /note="similar to chaperonin GroEL PRK00013;
                     similar to 60 kDa chaperonin 1 of Bacteria UniRef
                     RepID=CH601_SALAI"
                     /codon_start=1
                     /transl_table=11
                     /product="60 kDa chaperonin 1"
                     /protein_id="YP_005653167.1"
                     /db_xref="GI:384438443"
                     /db_xref="GeneID:12251395"
                     /translation="MAKILVFDEAARRALERGVNAVADAVKVTLGPRGRNVVLEKKFG
                     SPTITKDGVTVAKEIELENHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREG
                     LKNVAAGANPLALKRGIEKAVEAAVEKIRSLAIPVEDRKAIEEVATISANDPDVGKLI
                     ADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFITSPDTMEAVLEDAFI
                     LIVEKKVSNVRELLPVLEQVAQTGKPLLLIAEDVEGEALATLVVNKLRGTLNVAAVKA
                     PGFGDRRKEMLKDIAAVTGGTVISEELGFKLENATLSMLGRAERVRITKDETTIVGGK
                     GKKEDIEARINAIKKELETTDSEYAKEKLQERLAKLAGGVAVIRVGAATETELKEKKH
                     RFEDALSATRAAVEEGIVPGGGVTLLRAISAVDELLKKLEGDEATGAKIVRRALEEPA
                     RQIAENAGYEGSVVVQRILAETQNLRLGFNAATGEYVDMVEAGIVDPAKVTRSALQNA
                     ASIGALILTTEAVVAEKPEKKESTPAPASSGDMDF"
     misc_feature    complement(38746..40365)
                     /locus_tag="TCCBUS3UF1_430"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(38794..40359)
                     /locus_tag="TCCBUS3UF1_430"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(38797..38817,38824..38826,38992..38994,
                     39214..39216,39220..39222,39601..39603,39685..39687,
                     39781..39783,40141..40143,40150..40152,40162..40164,
                     40186..40188,40192..40194,40222..40224,40228..40233,
                     40246..40248,40252..40263,40294..40296,40345..40347,
                     40357..40359))
                     /locus_tag="TCCBUS3UF1_430"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(38878..38880,38884..38886,39007..39009,
                     39127..39129,39178..39180,39919..39921,40096..40098,
                     40108..40110,40270..40278))
                     /locus_tag="TCCBUS3UF1_430"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(38968..38970,38977..38982,38986..38988,
                     39013..39015,39067..39069,40042..40044))
                     /locus_tag="TCCBUS3UF1_430"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(39142..39147,39247..39249,39793..39795,
                     39814..39816,39946..39948))
                     /locus_tag="TCCBUS3UF1_430"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(40389..40694)
                     /locus_tag="TCCBUS3UF1_440"
                     /db_xref="GeneID:12251396"
     CDS             complement(40389..40694)
                     /locus_tag="TCCBUS3UF1_440"
                     /note="similar to co-chaperonin GroES PRK00364;
                     similar to 10 kDa chaperonin of Bacteria UniRef
                     RepID=CH10_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="10 kDa chaperonin"
                     /protein_id="YP_005653168.1"
                     /db_xref="GI:384438444"
                     /db_xref="GeneID:12251396"
                     /translation="MAAEVKTVIKPLGDRVVVKRIEEEPKTKGGIVLPDTAKEKPQKG
                     KVIAVGSGRILENGQKVPLEVKEGDIVVFAKYGGTEIEIDGEEYVILSERDLLAVLS"
     misc_feature    complement(40395..40670)
                     /locus_tag="TCCBUS3UF1_440"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(40398..40406,40452..40454,40458..40460,
                     40473..40475,40503..40505,40566..40571,40650..40652,
                     40659..40661,40665..40667))
                     /locus_tag="TCCBUS3UF1_440"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(40584..40625)
                     /locus_tag="TCCBUS3UF1_440"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(40509..40511,40542..40544))
                     /locus_tag="TCCBUS3UF1_440"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            complement(40770..41858)
                     /locus_tag="TCCBUS3UF1_450"
                     /db_xref="GeneID:12251397"
     CDS             complement(40770..41858)
                     /locus_tag="TCCBUS3UF1_450"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653169.1"
                     /db_xref="GI:384438445"
                     /db_xref="GeneID:12251397"
                     /translation="MEGFLALLLLLALGWAPRWLRVRACLQGLPPGFPGQGGMGEVVA
                     ELFAPLPVLFRLESLPSGPLGLPAQALVGVAWGRTRLHLPLPYRYRRRGEHPVRLTLR
                     VWSALGIGEHTLSLEAGQAVVYPSLRPLPPFRLAPSFFLEGGPAPFGLPDPLEAHSLR
                     PYRPGDPLRLLARKASLRHGEPWVREAEKRLQGGLFLHLDTQSLHPSYPDHAASLAAW
                     LLLEAERRGERYGLSAGEVLPLGRGRGHLERALTLLARLKPTPGPALPPPAPPGSTYL
                     LVSQVAEEAFLEAALRGSARARQGVLLLLPEGYFLYPGERGRPAFGKTPGLERALRAR
                     ALLAARGLALRVVRGYEIPALHIPPQPP"
     misc_feature    complement(40938..41720)
                     /locus_tag="TCCBUS3UF1_450"
                     /note="Uncharacterized conserved protein (some members
                     contain a von Willebrand factor type A (vWA) domain)
                     [General function prediction only]; Region: COG1721"
                     /db_xref="CDD:224635"
     misc_feature    complement(<41256..41402)
                     /locus_tag="TCCBUS3UF1_450"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:250938"
     gene            complement(41861..42775)
                     /locus_tag="TCCBUS3UF1_460"
                     /db_xref="GeneID:12251398"
     CDS             complement(41861..42775)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="similar to MoxR-like ATPases COG0714;
                     similar to ATPase associated with various cellular
                     activities AAA_3 of Bacteria UniRef RepID=D1CHF3_THET1"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_005653170.1"
                     /db_xref="GI:384438446"
                     /db_xref="GeneID:12251398"
                     /translation="MFYPRIQQALEGRVFLPEETLKLALATLLSGGHLLLEDVPGTGK
                     TTFAKALARALGLRFGRIQMTPDLLPQDLTGVYFYREGEFLWQPGPLFAQVLLVDELN
                     RATPRTQSALLEAMGEGQVTLEGKTHPLPEPFFVLATQNPVEEEGTYPLPVAQRDRFA
                     ARLSLGYPDERALLQALRERDPLEGLKAVTGAEEVLALRQQVRRVRMEEELLDYLLSL
                     SAWLRGREEVRLGPSPRALLQVERLAQALALLEERPFAIPEDVKRAFLAAIPHRLLLR
                     LEAELSGARPEGLVQEALATIPAPVERV"
     misc_feature    complement(41873..42763)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    complement(42275..42688)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(42641..42664)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(42356..42358,42479..42481,42638..42661))
                     /locus_tag="TCCBUS3UF1_460"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(42476..42493)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(42302..42304)
                     /locus_tag="TCCBUS3UF1_460"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(42745..44073)
                     /locus_tag="TCCBUS3UF1_470"
                     /db_xref="GeneID:12251399"
     CDS             complement(42745..44073)
                     /locus_tag="TCCBUS3UF1_470"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653171.1"
                     /db_xref="GI:384438447"
                     /db_xref="GeneID:12251399"
                     /translation="MGRLGLPRWPFPWLSFFLAAVLLWAALPRGGLALALGVGLIPLT
                     RILYPQGFLWFAPLPGLLHALYAPFPLWLADWAATSASLLLLGLFLAAQGRPLASLFL
                     LPPALDLGPWGLFLLGLLHGVNLLEGALSQGREGRVALALPPRALLLPLLLGLGMAGL
                     AYLPFPASSLPLPHLSPFGPAEALGGGMEPGESAVYQTPEGGFPAWVGFLNRALGYAL
                     PLALALLLFSLWPLAGRGERLPYRGGHLLPLLMALLAFALFLLYLGTLGGGEGREAGT
                     PPASLWAPGEGPRPEAIPGPRRLGEVGVALAGFSALLTLAFFSLLLLAVWRRSRGEGE
                     VRAGARTAPRGQALGETLPEDRVRRAYLKALRALGAQGWPRQAWEGPLEYGERVARSF
                     PEVRASLFALTRLYLPVRYGGGAGEGAAEQAEGILESILKLCSIRASSRP"
     misc_feature    complement(<42841..42999)
                     /locus_tag="TCCBUS3UF1_470"
                     /note="Domain of unknown function (DUF4129); Region:
                     DUF4129; pfam13559"
                     /db_xref="CDD:257876"
     gene            complement(44081..44215)
                     /locus_tag="TCCBUS3UF1_480"
                     /db_xref="GeneID:12251400"
     CDS             complement(44081..44215)
                     /locus_tag="TCCBUS3UF1_480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653172.1"
                     /db_xref="GI:384438448"
                     /db_xref="GeneID:12251400"
                     /translation="MGKLLMLALVLAVWRAAIPLGVHGPGPWPQGCGMDVKDCPYMPL
                     "
     gene            complement(44270..45043)
                     /locus_tag="TCCBUS3UF1_490"
                     /db_xref="GeneID:12251401"
     CDS             complement(44270..45043)
                     /locus_tag="TCCBUS3UF1_490"
                     /note="similar to rRNA methylases COG0566;
                     similar to tRNA/rRNA methyltransferase (SpoU) of
                     Thermaceae UniRef RepID=D7BAL1_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA/rRNA methyltransferase"
                     /protein_id="YP_005653173.1"
                     /db_xref="GI:384438449"
                     /db_xref="GeneID:12251401"
                     /translation="MRIQSPANPKVKALAALKERRERERAGLFLVEGRREVARALGAG
                     LELYTLLLGPKALPEDRLLAGPAPVLELSQEAMERVSLRENPPPLIGVFRLPQGRPLP
                     PLPEAPLVLVLLGVEKPGNLGAILRSAEAAGADLVLVAEGVDLYSPQVIRNSTGAVFS
                     LPVLPLSEGEADRFLEERGLFRVAATPRGEKTLWEEDYRQGVAFLLGAEDQGLPPAWL
                     ERAQARVRIPMRGRADSLNVSVSAALLLYEALRQRLGVG"
     misc_feature    complement(44282..45037)
                     /locus_tag="TCCBUS3UF1_490"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    complement(44762..44953)
                     /locus_tag="TCCBUS3UF1_490"
                     /note="RNA 2'-O ribose methyltransferase substrate
                     binding; Region: SpoU_sub_bind; smart00967"
                     /db_xref="CDD:214943"
     misc_feature    complement(44303..44710)
                     /locus_tag="TCCBUS3UF1_490"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            complement(45021..47270)
                     /locus_tag="TCCBUS3UF1_500"
                     /db_xref="GeneID:12251402"
     CDS             complement(45021..47270)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="similar to 6-carboxyhexanoate-CoA ligase of Thermus
                     UniRef RepID=Q72GY5_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="6-carboxyhexanoate--CoA ligase"
                     /protein_id="YP_005653174.1"
                     /db_xref="GI:384438450"
                     /db_xref="GeneID:12251402"
                     /translation="MGYVPAPTPQYGLEEGPVLLKDGRTALLRRAGPKDLALFVAFLK
                     RLSPESLRMRFFSPISPEKAAELLLSAKPEEEKVTLIVLAGDPPRIVATGEYVRVKGE
                     DTAEVAFLVDDAYQGKGLGTLLLERLALIAAKRGVRRFQAFTLAENRQMLGVFMESGF
                     EVRAHREGGEVEVEFEILLEEKAAERFEWREKVSTIASLHPFFFPRGVAVVGASRDPE
                     SIGYRVLENLIFGRFQGPVYPVNEAIGQEGGTVGPLLAYPSVESIPGPVDLAVIAVPK
                     ERVLGALEACGRRGVRGAIVLTTGFSPQEAKALADRARRFGMRLLGPGSLGLVHTHPE
                     ARLAAGLAPLPKPGPLAISSQSGTLGRAVMAYAEGMGLGIASFVSLGAKADLSSNDLL
                     QFWEEDERTGVILLYLEGFGNPRRFSRLARRIGKRKPILAVHPSRDPLVRALFAQAGV
                     IRANDLEEAFDVAALLSLGRLPENPRVRLISNASGPSNLALEALQEGGLAVEHVDLGS
                     TARAEDFAHALKEAMASEAGSVFLLFVPMGFASEEEFLGLVERAEGEKLLLACAMGSP
                     GVRARVLGKAALYRFPESAAIALARAWAYRVWREEPLRFPDFPDLRLEEARKLLEGKK
                     HLGLEEAKALLQAFGLPLDGEEGGLTLRLKAEPHPLFGPVLTLLLPTPLGDQVLGQRL
                     SPLTEGDAKELLAPLAGKVEPGPYQEILLRLSRLLEELPQVEGLALELQGPKVAGLEV
                     RLHADPKPR"
     misc_feature    complement(46788..47192)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    complement(46851..47030)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(46905..46910,46938..46940,46941..46943))
                     /locus_tag="TCCBUS3UF1_500"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     misc_feature    complement(45522..46676)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="acetyl coenzyme A synthetase (ADP forming), alpha
                     domain; Region: AcCoA-syn-alpha; TIGR02717"
                     /db_xref="CDD:131764"
     misc_feature    complement(46278..46649)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="CoA binding domain; Region: CoA_binding_2;
                     pfam13380"
                     /db_xref="CDD:257707"
     misc_feature    complement(45873..46232)
                     /locus_tag="TCCBUS3UF1_500"
                     /note="Succinyl-CoA ligase like flavodoxin domain; Region:
                     Succ_CoA_lig; pfam13607"
                     /db_xref="CDD:257921"
     gene            47308..48576
                     /locus_tag="TCCBUS3UF1_510"
                     /db_xref="GeneID:12251403"
     CDS             47308..48576
                     /locus_tag="TCCBUS3UF1_510"
                     /note="similar to glucose-6-phosphate isomerase PRK00973;
                     similar to Glucose-6-phosphate isomerase of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A8R0_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_005653175.1"
                     /db_xref="GI:384438451"
                     /db_xref="GeneID:12251403"
                     /translation="MLRLDTRFLPDFPQALKAHEGILLAAREALLSRRKDPGAMLGWL
                     DLPEDTETLRRIRRFREENPWVEDYVLLGIGGSALGPKALEAAFNGGRVRFHYVDHVE
                     PEPVLRLLRTLDPRKTLVNAISKSGATAETLAALLVFLNWLKGHLGEGWRRHLVLTTD
                     PKRGALRALAEREGLAAFPIPEGVGGRFSVLSPVGLLPLAFADADLDALLMGARQANA
                     NALAPLGESLPLQTALLHHLHRHLPIAVFMVYSERLKHLPAWFVQLHDESLGKRDREG
                     RPVGTTAVPALGPQDQHAQVQLFREGPLDKLLTLVVPERPTEDLPLPPAEGLEGEAGY
                     LFGKGLFTLLSAEAEATYRALAEAGQKVYTLYLPEVSPYAVGWLLQHLMWQTALLGEL
                     WGVNAFDQPGVELGKRLTFALLGRPGYGEG"
     misc_feature    47308..48570
                     /locus_tag="TCCBUS3UF1_510"
                     /note="Glucose-6-phosphate isomerase [Carbohydrate
                     transport and metabolism]; Region: Pgi; COG0166"
                     /db_xref="CDD:223244"
     misc_feature    47455..47913
                     /locus_tag="TCCBUS3UF1_510"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the first SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_1; cd05015"
                     /db_xref="CDD:240146"
     misc_feature    order(47527..47529,47533..47538,47677..47685,47692..47694,
                     47863..47865)
                     /locus_tag="TCCBUS3UF1_510"
                     /note="active site"
                     /db_xref="CDD:240146"
     misc_feature    order(47602..47613,47698..47700,47710..47712,47719..47721)
                     /locus_tag="TCCBUS3UF1_510"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240146"
     misc_feature    48034..48546
                     /locus_tag="TCCBUS3UF1_510"
                     /note="Phosphoglucose isomerase (PGI) contains two SIS
                     (Sugar ISomerase) domains. This classification is based on
                     the alignment of the second SIS domain. PGI is a
                     multifunctional enzyme which as an intracellular dimer
                     catalyzes the reversible isomerization of...; Region:
                     SIS_PGI_2; cd05016"
                     /db_xref="CDD:240147"
     misc_feature    order(48034..48036,48058..48060,48094..48096,48106..48108,
                     48115..48120,48163..48165,48169..48177,48184..48189,
                     48196..48201,48208..48210,48325..48327,48331..48333,
                     48355..48357,48364..48366)
                     /locus_tag="TCCBUS3UF1_510"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240147"
     misc_feature    order(48094..48096,48106..48108)
                     /locus_tag="TCCBUS3UF1_510"
                     /note="active site"
                     /db_xref="CDD:240147"
     gene            48630..50219
                     /locus_tag="TCCBUS3UF1_520"
                     /db_xref="GeneID:12251404"
     CDS             48630..50219
                     /locus_tag="TCCBUS3UF1_520"
                     /note="similar to phosphoenolpyruvate carboxykinase
                     PRK09344;
                     similar to Phosphoenolpyruvate carboxykinase [ATP] 2 of
                     Bacteria UniRef RepID=PCKA2_MOOTA"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoenolpyruvate carboxykinase [ATP] 2"
                     /protein_id="YP_005653176.1"
                     /db_xref="GI:384438452"
                     /db_xref="GeneID:12251404"
                     /translation="MDRLSYLGLHPQKQVFWNTVSPVLVEHTLARGEGFLAHKGPLVV
                     DTTPYTGRSPKDKFVVREPEVEGEIWWGEVNQPFAPEAFQALYGRVVAYLAERDLYVQ
                     DLYAGADKRYRLGVRVVTESPWHALFARNMFILPRRFPEDDEAERFTPGFTVVHAPYF
                     LADPERDGTRSEAFVGISFARRLVLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHAS
                     ANVGQDGDVALFFGLSGTGKTTLSTDPLRPLIGDDEHGWSEEGVFNFEGGCYAKVIRL
                     SEEHEPLIYRASNQFEAILENVVVNPESRRVEWDDDSKTENTRASYPIAHLDNVVESG
                     MAGHPRAIFFLSADAYGVLPPIARLSPEQAMYYFLSGYTARVAGTERGVTEPKATFSA
                     CFGAPFLPMHPGVYARMLGEKIARHAPRVYLVNTGWTGGPYGVGRRFPLPLTRTLLQA
                     ALSGALEGVPYRQDPVFGFEVPLEVPGVPKELLDPRGTWADPEAYDRQARKLAHLFQE
                     NFQKYADGVGEAVRLAGPRAD"
     misc_feature    48666..50204
                     /locus_tag="TCCBUS3UF1_520"
                     /note="Phosphoenolpyruvate carboxykinase (PEPCK), a
                     critical gluconeogenic enzyme, catalyzes the first
                     committed step in the diversion of tricarboxylic acid
                     cycle intermediates toward gluconeogenesis. It catalyzes
                     the reversible decarboxylation and...; Region: PEPCK_ATP;
                     cd00484"
                     /db_xref="CDD:238270"
     misc_feature    order(48783..48785,49200..49202,49206..49208,49215..49220,
                     49275..49277,49329..49349,49383..49388,49437..49439,
                     49443..49445,49470..49472,49584..49586,49941..49943,
                     49950..49952,49959..49961)
                     /locus_tag="TCCBUS3UF1_520"
                     /note="active site"
                     /db_xref="CDD:238270"
     misc_feature    order(48783..48785,49200..49202,49206..49208,49215..49220,
                     49437..49439,49584..49586)
                     /locus_tag="TCCBUS3UF1_520"
                     /note="substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238270"
     misc_feature    order(49218..49220,49275..49277,49344..49346,49383..49388,
                     49437..49439)
                     /locus_tag="TCCBUS3UF1_520"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238270"
     misc_feature    order(49329..49349,49470..49472,49941..49943,49959..49961)
                     /locus_tag="TCCBUS3UF1_520"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238270"
     gene            50381..52207
                     /locus_tag="TCCBUS3UF1_530"
                     /db_xref="GeneID:12251405"
     CDS             50381..52207
                     /locus_tag="TCCBUS3UF1_530"
                     /note="similar to protoheme IX farnesyltransferase
                     PRK04375;
                     similar to Protoheme IX farnesyltransferase of Bacteria
                     UniRef RepID=COXX_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Protoheme IX farnesyltransferase"
                     /protein_id="YP_005653177.1"
                     /db_xref="GI:384438453"
                     /db_xref="GeneID:12251405"
                     /translation="MSQAWFSRYAWGVLGWNVLVALWGAYVRATGSGAGCGSHWPTCN
                     GEIIPRSPQVETLIEFTHRATSGLAFLSVLGLFLLALRLYPKGHPVRLGAGLAFLFMV
                     TESLVGASLVLFGWVADNVTPERAVVQMVHLANTYFLLAALALAAWWASGGAPLRLRG
                     QGAVAWALLLGFLALLFLGMSGAVTALGDLLFPVRNTLEALERSLTPGEHFLVRLRVL
                     HPLIAVSVGLYVVFAGFLVAHLRPSPHTRSLAQGLAYLYGIQLLAGLVNVWLKAPVWM
                     QLLHLLLAYAVWLLFLLLAAAALARGARRVELGEGSAEAGRLHQGTGGATWKDYLALT
                     KPRVISLLLLTTLLAMFIAAQGWPGTGLFLAVALGGYMMAGAANAINMVVDRDIDARM
                     RRTAQRPTVTQRISSRDALRFAFALAFGAFLLLWWGANLLAATLALMGLIWYVLVYTL
                     YLKRRTWQNIVIGGAAGAFPPLVGWAAVTGELSLFAWYLFALIFFWTPVHFWALALMI
                     QDDYKAVGVPMLPVVLGERVTVVQIALYAVLTAMISLMPLLLGELGLLYLFFSLALNA
                     LLLVKSLALYRQPERRTAVSLYKYSMLYLALLFVAMAVDRVL"
     misc_feature    50402..51244
                     /locus_tag="TCCBUS3UF1_530"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; pfam02628"
                     /db_xref="CDD:251431"
     misc_feature    51371..52183
                     /locus_tag="TCCBUS3UF1_530"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    order(51533..51535,51545..51547,51911..51913)
                     /locus_tag="TCCBUS3UF1_530"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            52219..53232
                     /locus_tag="TCCBUS3UF1_540"
                     /db_xref="GeneID:12251406"
     CDS             52219..53232
                     /locus_tag="TCCBUS3UF1_540"
                     /note="similar to Cytochrome c oxidase subunit 2 of
                     Thermus UniRef RepID=Q5SLI2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c oxidase subunit 2"
                     /protein_id="YP_005653178.1"
                     /db_xref="GI:384438454"
                     /db_xref="GeneID:12251406"
                     /translation="MKRGVAALSLIGLALAQEAHRVAITHPFSPVNRETNFLLVWVLL
                     FSVLIFGVVAGALAYIAWKFRARPGQEGEPPQIHGNDRLEVVWTVIPIVIIFILFGLT
                     ARSLILVNKPTPGAMKVEVTGYQFWWDFHYPEAGFRNSNELILPAGVPVELEVTSKDV
                     IHSFWVPGLVGKQDAIPGQKTRIRFVAEKPGNYYGFCAELCGPSHARMLFRVLVVPQE
                     AFDRFVQAAKAYTPPVADARGQEVFQQNCAACHGVQGKMPPAVIGPELAFTGNRVSLG
                     AGIVDHTPENLKAWIKDPASMKPGVKMPGFPQLSEGDLEALVRYLEGLKVEGVDFKAL
                     PKF"
     misc_feature    52297..52890
                     /locus_tag="TCCBUS3UF1_540"
                     /note="cytochrome c oxidase, subunit II; Region: CoxB;
                     TIGR02866"
                     /db_xref="CDD:234039"
     misc_feature    52564..52863
                     /locus_tag="TCCBUS3UF1_540"
                     /note="The cupredoxin domain of Caa3 type Cytochrome c
                     oxidase subunit II; Region: CuRO_CcO_Caa3_II; cd04213"
                     /db_xref="CDD:259875"
     misc_feature    order(52693..52701,52711..52713,52717..52719,52726..52740,
                     52744..52755,52759..52761,52798..52800,52804..52827,
                     52831..52839,52843..52845)
                     /locus_tag="TCCBUS3UF1_540"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259875"
     misc_feature    order(52702..52704,52807..52809,52819..52821,52831..52833,
                     52840..52842)
                     /locus_tag="TCCBUS3UF1_540"
                     /note="CuA binuclear center [ion binding]; other site"
                     /db_xref="CDD:259875"
     misc_feature    52927..53193
                     /locus_tag="TCCBUS3UF1_540"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            53247..55622
                     /locus_tag="TCCBUS3UF1_550"
                     /db_xref="GeneID:12251407"
     CDS             53247..55622
                     /locus_tag="TCCBUS3UF1_550"
                     /note="similar to Cytochrome c oxidase polypeptide I+III
                     of Thermus UniRef RepID=COX13_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c oxidase polypeptide I+III"
                     /protein_id="YP_005653179.1"
                     /db_xref="GI:384438455"
                     /db_xref="GeneID:12251407"
                     /translation="MAIATKPKTNAWAVLWDLLTTVDHKKIGLMYTATAFFAFGLAGV
                     FSLLIRAQLAVPNNQLLTGEQYNQVLTLHGATMLFFFIIQAGLTGFGNFVVPLMLGAR
                     DVALPRINAFSYWAFLGAILLALMSFFFPGGAPSVGWTFYYPFSVQSGSGVNFYMAAI
                     LLLGFSSLLGNANFIATIYNLRAQGMSLWKMPMYVWSVFAASVLNLFSLAGLTAATLL
                     VLLDRKIGLTWFNPDIGGDPVLFQQFFWFYSHPTVYVMLLPYLGILAEVASTFARKPL
                     FGYKQMVWAQMGIVVLGTMVWAHHMFTVGESTVFQIAFAFFTALIAVPTGVKLFNLLG
                     TLWGGHLQMKTPLYWVLGFIFNFLLGGITGVMLSMTPLDYQFHDSYFVVAHFHNVLMA
                     GSAFGAFAGLYYWWPKMTGRMYDERLGKLHFWLFLVGYLVTFLPQYALGFLGMPRRYY
                     TYNADLAGWPELNLISTIGAFILGLGGLVWLYAMWKSLRSGEKAPENPWGGYTLEWLT
                     ASPPKAHNFDVALPKDFPSERPLYDWAKKGVELKPEDPSHIHLPNSSFWPFYAAATLF
                     AFFVAVAALPVPNVWMWLFLALFAYGLVRWALEDEYSHPVEHHTLTGKSNAWMGMAWF
                     IVSEVGLFAILIAGYLYLRLTGAATPPEERPALWLALLNTFFLVSSSFTVHFAHHDLR
                     RGRFNPFRFGLLITIILGVLFFLFQAYEFWAFYGHSSWQENLWTAAFFTIVGLHGLHV
                     VIGGFGLILAYLQALRGKITLHQHGTLEAASMYWHLVDAVWLFIVVLFYIW"
     misc_feature    53280..54950
                     /locus_tag="TCCBUS3UF1_550"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    53301..54797
                     /locus_tag="TCCBUS3UF1_550"
                     /note="cytochrome c oxidase, subunit I; Region: CtaD_CoxA;
                     TIGR02891"
                     /db_xref="CDD:213748"
     misc_feature    55071..55619
                     /locus_tag="TCCBUS3UF1_550"
                     /note="Heme-copper oxidase subunit III.  Heme-copper
                     oxidases are transmembrane protein complexes in the
                     respiratory chains of prokaryotes and mitochondria which
                     couple the reduction of molecular oxygen to water to,
                     proton pumping across the membrane. The...; Region:
                     Heme_Cu_Oxidase_III_like; cd00386"
                     /db_xref="CDD:238227"
     misc_feature    order(55089..55094,55134..55136,55146..55151,55413..55418,
                     55425..55427,55437..55439)
                     /locus_tag="TCCBUS3UF1_550"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238227"
     gene            55677..56378
                     /locus_tag="TCCBUS3UF1_560"
                     /db_xref="GeneID:12251408"
     CDS             55677..56378
                     /locus_tag="TCCBUS3UF1_560"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653180.1"
                     /db_xref="GI:384438456"
                     /db_xref="GeneID:12251408"
                     /translation="MRLLAVDFDYFFPLPQDPGHPEAFLYAWAHFETPYYREAAWEER
                     ALAFLLRGLPLPQAQGWEGFWERFTFAPGARLYYADSNALAFHPQVREGVEEVVLYDA
                     HHDAGYRPLGEEPACDDWMVHYARQGARLRVFYPPWRDPALEPEPQVPLAREVDPGGR
                     VEGPFHRVFLCRSGAWVPPWADAAFFAFLAAASLPKVPLEPVAPRAWDLEGLRRRVAE
                     EALGLWIMDALRRSP"
     gene            56403..56478
                     /locus_tag="TCCBUS3UF1_t10"
                     /db_xref="GeneID:12251409"
     tRNA            56403..56478
                     /locus_tag="TCCBUS3UF1_t10"
                     /product="tRNA-Lys"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="Anticodon is TTT"
                     /db_xref="GeneID:12251409"
     gene            56485..56559
                     /locus_tag="TCCBUS3UF1_t20"
                     /db_xref="GeneID:12251410"
     tRNA            56485..56559
                     /locus_tag="TCCBUS3UF1_t20"
                     /product="tRNA-Glu"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="Anticodon is CTC"
                     /db_xref="GeneID:12251410"
     gene            56561..56637
                     /locus_tag="TCCBUS3UF1_t30"
                     /db_xref="GeneID:12251411"
     tRNA            56561..56637
                     /locus_tag="TCCBUS3UF1_t30"
                     /product="tRNA-Val"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="Anticodon is TAC"
                     /db_xref="GeneID:12251411"
     gene            complement(56974..57414)
                     /locus_tag="TCCBUS3UF1_570"
                     /db_xref="GeneID:12251412"
     CDS             complement(56974..57414)
                     /locus_tag="TCCBUS3UF1_570"
                     /note="similar to Putative uncharacterized protein of
                     Anabaena variabilis ATCC 29413 UniRef RepID=Q3M828_ANAVT"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653181.1"
                     /db_xref="GI:384438457"
                     /db_xref="GeneID:12251412"
                     /translation="MTPKAALGQPVYFCDRNLGKGFPQRLRELGLEIKAHDELFSPDT
                     PDEEWIPQVSAQGWVILTLDAQLRYRPVERAILRSFGARVILFTQPKQPERGWLLLLA
                     EEFAQAQGKVTGFLKQNSAPFVVRFSVDPKKRGSRRYQLFPLKL"
     gene            complement(57411..57887)
                     /locus_tag="TCCBUS3UF1_580"
                     /db_xref="GeneID:12251413"
     CDS             complement(57411..57887)
                     /locus_tag="TCCBUS3UF1_580"
                     /note="similar to Uncharacterized conserved protein
                     COG2442;
                     similar to Putative uncharacterized protein of Arthrospira
                     UniRef RepID=B5VXY4_SPIMA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653182.1"
                     /db_xref="GI:384438458"
                     /db_xref="GeneID:12251413"
                     /translation="MAALRQIHRIPMQRIRRMIDYAKEALGKPRPLLLDLEAGLGDVF
                     LRQGKELLALTRAGQLALQEVLESYLSRVDRDEQGIPLRFHPAVGTQLRSERVVLDPR
                     VAFGAPTVRGVKTSVIALRFNTGEGLEEIAKDYGLTEEEVTEALVFEGMGVDAWAA"
     misc_feature    complement(57444..57608)
                     /locus_tag="TCCBUS3UF1_580"
                     /note="Protein of unknown function (DUF433); Region:
                     DUF433; cl01030"
                     /db_xref="CDD:260756"
     gene            59998..61494
                     /locus_tag="TCCBUS3UF1_590"
                     /db_xref="GeneID:12251414"
     CDS             59998..61494
                     /locus_tag="TCCBUS3UF1_590"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653183.1"
                     /db_xref="GI:384438459"
                     /db_xref="GeneID:12251414"
                     /translation="MTPLAQYAVTLYASSLFAQKDDFKRLVEEIFTTNYKNPDEAFEH
                     LKDFWFGNKSLVNLFTLFVSRSDYNRIEYEGAPGTEDPEEKAFLDEEDKCKYELVYPY
                     FGDLQKTLDQFSMARPSIVRQVAQKVRTSLNQQRGGASFYISLMQESFDLLLPAAVRR
                     KYLARLRPVLNVLSSNPRRITAIPAGLLSATQEIDELSRELSQELGLKESYEDEHAEG
                     SAPLLPLYEGKDDTGLFSELATALRRQNLTILSTTAKMISSQVISLARQALDFMASSY
                     KGDPEAFTRAVHNVVDHAFYSALGLNGLFPVYVYDYRVTAIDEHERVVPIFFGFLERE
                     LLVGESTLAGAYLALVHSGIARAKDGKSLPLPQMIQGLAKQFAKSFTAKRVAEKVFKE
                     SGMGDSTRDLFEVDEPEAVPVNLTPRQVFAQGLANMLSEKLAPPEVQRSGYRTFYSIQ
                     NFILFRPKFANAVVKVASENPGFMLDQATQDVQRGFRTGFNTYRGRSV"
     gene            complement(62020..63192)
                     /locus_tag="TCCBUS3UF1_600"
                     /db_xref="GeneID:12251415"
     CDS             complement(62020..63192)
                     /locus_tag="TCCBUS3UF1_600"
                     /note="similar to DNA integration/recombination/invertion
                     protein of Thermus UniRef RepID=Q72GH2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA integration/recombination/inversion protein"
                     /protein_id="YP_005653184.1"
                     /db_xref="GI:384438460"
                     /db_xref="GeneID:12251415"
                     /translation="MARGKGGGTTYYHKAAQKWVAELRWVDEATGKLKKLCRYARTRR
                     EAEELLAKMVAERAQGLLPEPSQVTVVQFAQRYLQGLEGEGLRPNSLRLARQELVYAL
                     PSLKDPSAHDPLGRMRLQEVRPLHVQRVVDQLRQGYAPRTVRKVLNRLRALFQRACEL
                     ELLPRNPAGAIRLRLPQGERAARALEPQEVLRLLEVADGARSREMALLLRLLLETGLR
                     RGEALALQWRDVDLERGELRVWRSWTKVNGKGDFTQPKTRTARRVVPLPQSLLLRLRA
                     WKEELAQRLPQEVLEEAFLFGGNKPFDPDAFNHYLRRLAQRAGLGKVRVHDLRHTWAS
                     LALSRGIPLEVVSERLGHASPHVTLGIYRHLLEEERRGYVVDLETLLGLPAVRPQA"
     misc_feature    complement(62089..62970)
                     /locus_tag="TCCBUS3UF1_600"
                     /note="tyrosine recombinase XerD; Region: recomb_XerD;
                     TIGR02225"
                     /db_xref="CDD:233789"
     misc_feature    complement(62083..62535)
                     /locus_tag="TCCBUS3UF1_600"
                     /note="phiLC3 phage and phage-related integrases,
                     site-specific recombinases, DNA breaking-rejoining
                     enzymes, C-terminal catalytic domain. This CD includes
                     various bacterial (mainly gram positive) and phage
                     integrases, including those similar to Lactococcus...;
                     Region: INT_phiLC3_C; cd01189"
                     /db_xref="CDD:238594"
     misc_feature    complement(order(62107..62109,62137..62139,62206..62208,
                     62215..62217,62425..62427))
                     /locus_tag="TCCBUS3UF1_600"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238594"
     gene            complement(63222..65150)
                     /locus_tag="TCCBUS3UF1_610"
                     /db_xref="GeneID:12251416"
     CDS             complement(63222..65150)
                     /locus_tag="TCCBUS3UF1_610"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653185.1"
                     /db_xref="GI:384438461"
                     /db_xref="GeneID:12251416"
                     /translation="MVHYAGCINCSCLSRSSDSGVASSLQGDASCVPGALQDDQQKGG
                     DIQQGEWGQCTGDLPSEYRYLYHYIKKLSQPCPHLEAWAELLRVKRVRRLLARLRALF
                     SLPQRCLLLASPDKRVFSVLEGLSRTEVLLALYLHFELGVLLVGTDHAVSRRGKRVGS
                     WWMPRYGTRVVALDVDCPLEAFRAQVVGFLAEVRDSLGLWGFYGSSFSGQVHLYFLFR
                     KTVPLKRAYQLGQFLRKLALRHFPRDSVKEVVAYPTRESGPGRFLLLPLRCLGDGLKH
                     VEFGYPSPLGPMVRFLEERLNSWDQVSQRLEFPNKTQPKAPFRARASVLPHAKRDKAP
                     LGESSSKSARAKSPDALPPGSQDRSYPLSSEDYYALRRGDKVNPVFPEEGWLEQGTLE
                     GLRRLISSASLGYVKGSRQNLILGLAGFAARQGIPEEVFIQEVQHLLQGDEEKSKRLY
                     GIRRTYQRARTRREVCWHDFLEGVLGGGLLQEVQSFLETNPDRLGAWARDLGLSSSTV
                     RLALLISAEVLEKASLFGVARIGYNATAKRYRVSKRTVSEALGLLKRAGVIQRVEVGF
                     FHPDASGNKVSKGSAYLPLPELLQVRKEQGLLEAVLGALSKAVVARERLAGGNRLRPL
                     ALSVNGPGLESDRGVPKL"
     gene            65547..66785
                     /locus_tag="TCCBUS3UF1_620"
                     /db_xref="GeneID:12251417"
     CDS             65547..66785
                     /locus_tag="TCCBUS3UF1_620"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653186.1"
                     /db_xref="GI:384438462"
                     /db_xref="GeneID:12251417"
                     /translation="MIPLVHSELKIALTVLPVPVLQDVVWAERPEDIPPWDWTRGYSP
                     VQPLSRFGEDYDLDTPEEEVDRDHPLPSWLKLTKFYPRLVRKWASSDIWEPSPESNLP
                     PKASVSPLEAFQRVYRALQQDQDPLQPDSLTRKTIGEMARKAGILSSFEPDWRLSGEG
                     VWGRFSGANSLLRDDSLWAWVEAAYFFQTVRLALKLREESNLPPKPILQRVIQELGFP
                     LEVLEENGQAGVELRVRPAGDPLEGAKRRGLDIALEYLGRGRSLRVSGLENVLREEAT
                     RHVVLEPVSKFETHTPIRAPRIPLALLKKRSEQVRKQSQLDESWKEWAQELREIWEEW
                     VQSEQEGQNRRAQSAAHYFGFMSLIDLGLLQLLRRDYVACEWCGKVFSPRRRDTRYCS
                     DVCRMKAWRNQRASSKHKVE"
     misc_feature    66666..66782
                     /locus_tag="TCCBUS3UF1_620"
                     /note="MYND finger; Region: zf-MYND; pfam01753"
                     /db_xref="CDD:250838"
     gene            complement(67186..67335)
                     /locus_tag="TCCBUS3UF1_630"
                     /db_xref="GeneID:12251418"
     CDS             complement(67186..67335)
                     /locus_tag="TCCBUS3UF1_630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653187.1"
                     /db_xref="GI:384438463"
                     /db_xref="GeneID:12251418"
                     /translation="MVEKSIASQSTVKRVLASLRQEGMVRTKTTLKGRGSPEVLILAN
                     PEADT"
     gene            67602..68693
                     /locus_tag="TCCBUS3UF1_640"
                     /db_xref="GeneID:12251419"
     CDS             67602..68693
                     /locus_tag="TCCBUS3UF1_640"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653188.1"
                     /db_xref="GI:384438464"
                     /db_xref="GeneID:12251419"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     misc_feature    <68031..68471
                     /locus_tag="TCCBUS3UF1_640"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(68710..74256)
                     /locus_tag="TCCBUS3UF1_650"
                     /db_xref="GeneID:12251420"
     CDS             complement(68710..74256)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="similar to Distinct helicase family with a unique
                     C-terminal domain including a metal-binding cysteine
                     cluster COG1205;
                     similar to Putative uncharacterized protein of Meiothermus
                     silvanus DSM 9946 UniRef RepID=D7BJ06_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653189.1"
                     /db_xref="GI:384438465"
                     /db_xref="GeneID:12251420"
                     /translation="MGLALRPEDLRPERWFSQVLPRVVQGESLDWSAVPDAHPQDLEG
                     LLQPLFHLNLSPEELSRRLGLASMAEALRSWVASRMGLPLVRLAERGSVRDPFRQLEA
                     IQNSFRGYAESFVNPRNPAIADLLRQGIEEEDLLWREPFVAQKRRYRLGKSLEALIQE
                     GLLPPSIRPLLRKNPEDLQDPTPFHPYLHQEEALRAALAGESFVVATGTGSGKSLAFG
                     MPIFAYALTAKRPGIKAVIVYPMNALANSQYRDFALRLHGSGLRIALYNGETPYTKQD
                     GQALRERLLQERFVSDAEVLSREEIRQDPPDILMTNYVQLELLLTRGEDRTLFPPEHR
                     GVLRYLVLDEVHTYAGLRGADVAFLIRRLKQHTGTTETLQVIGTSATVDRGVEAIRRF
                     AENLFGTSVARVIGEHLEEPPPLDLSHLPEELREALSARPDGETRVRRALVFLEKALE
                     EPHTLSELAKKLSHEEGISQDQARAEVALALRVGAATGYLVPRIHAFYAQAPDLTATL
                     DLEGLSLKGEKHLHGKPAYPVVFCRNCGQEYLIAREEKGQFLPGPSFLELFRGEIRYL
                     RPGAWVPDREPLPESWLDESGEVKRDRRRLLPQNRVLDPYTGTPAEEGVPVAILPFPF
                     QFCPTCQVSYTRQGNEIRKLAAFGLVGRSTATDLLLLSTLGTFPREEQKIIVFTDNRQ
                     DAEFQAGHFQDLFRKVLFRQTVMEILAQGPAYLSELGGQVYQAWARSDPRAEMRPLYE
                     EHAPEGVAFRDLLSLVAVLEAGRNTQPNLKNLEAAGLIRYRYRHLEELLQDRGIWEGL
                     SVPEEVLRDYLTGLLDLMRRRGAIFHELLNPISFRFRVEEKLFAFVHEVFAEPMGGSI
                     LLEVRASQAPRFGQTLRLYGDRRRPSLFEQWTMGALNLPWEEAAARLRRVVRALKDRR
                     VLVAWELPSWGRNKVSGLALNPSAILLEKTGGDYLLCPRSGYTGPLYALRISPEYPSQ
                     ALEERRVHPFYETLYEKRRFPLPLEARAHSAQVSGEERRRLEERFRNPEDPLSVLVAT
                     PTLEMGIDIGALSSVFLRNIPPSPANYAQRSGRAGRKGQPALIQAFAGAMGHDQYFYR
                     FPERMVRGSVQAPRFLLDNPRLVKAHLRALVLEILAQWGFSLPGKVGEAVDYEDHTHL
                     YPLRAGFRAALEQGISTHQGAILQAVGEAFRREMASFPWFTQEVVRSTVEGFVAELDA
                     ELNSWREEYHDAQARYTEFMTRLQHMGPRHPNREEIQAEATRADKQRRYLVDLDLRGY
                     LAARGFLPNYAFGRVTTWAELITPGGEVERLERPSFIALTEFAPGNSVYFGARRYRLD
                     RLAVLPKEEAFRTAKRCTCGHVEAQGDRCRACGKDLSATLPNVRLLAPPILTGLPRRR
                     ITSEEEDRVRMGYEVEWDWRPKAPRALQGGSFRLLYEHNAEVVAMNKGLRAWLLDEEE
                     ENPLQEGFVYCQRCRRFLLTGKELEEHPWREDREGRCPVGGKPEDLKRGIVLEARAES
                     DVLALEVPAPLGIGDGERLSFYKSLLAAFRKAALVVLELAEDELFGFLQPISNPQVPY
                     RVVLVEGQEGGLGALAALAEWPSREESHPLQELARTALRLMHHGEEKACERACYDCLM
                     DYSNQVDHALLDRRLVQDFFTELQSTVFEDLPAPSRLQELQARCQSELERRWLQACHE
                     RGLPLPDEVQYTYALGDTYTRFDFFYARGLGIYVDGPPHLDPRRQEQDREIRRRLTLL
                     GVPFLVFREGEDWEKGFEELGLHLGRRGGGLSWEEALALVLPGYRPLLEALRKAGFPP
                     PDEVGEDLVVEGRVVGQSVARWGEKHLVPEGLEGLGLVVRPYTTPDEVLGYLRGEGLA
                     SSKEHP"
     misc_feature    complement(73024..73713)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    complement(73114..73656)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(73615..73629)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(73219..73230)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(71044..>71196)
                     /locus_tag="TCCBUS3UF1_650"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(71059..71061,71068..71070,71080..71082,
                     71143..71145))
                     /locus_tag="TCCBUS3UF1_650"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(74309..76306)
                     /locus_tag="TCCBUS3UF1_660"
                     /db_xref="GeneID:12251421"
     CDS             complement(74309..76306)
                     /locus_tag="TCCBUS3UF1_660"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653190.1"
                     /db_xref="GI:384438466"
                     /db_xref="GeneID:12251421"
                     /translation="MNPSTKSTLYVNLFPLKRSPQEGRIFRFAHRDPQSFLKYLQAIG
                     WIAQKRGDEVWIFALERPEVRAPFVGEAEPTSLQERAMAFNSHLNRLLSQKGFYRTGS
                     RWIDPEEWTRIEGVFLSGPFQGKAFPVRQHQAYKVEVVNLLGTFYALVDLSKQLLSDA
                     PLEALSVELVTYLEAQAPKHPLHALDLHTGKRTFWETADPRGHLLLHPVHLEELGVVG
                     EQGQMRRTSQEAFERSQFNFAHLLEKITLFSEVLVPEPLALSEEVLGRIEGLGLRMAK
                     GLAAEPKEVRFKGFLYAPSKISLRPILPDTPEVAFTQKVTKKPSFHVETKRRGKPPQR
                     SGHLEHKVTVGISPRHLLLYHLVEPHRLKNSREGLEILQRFGHAKGHAKDGYSLVQAL
                     KQFGTSIQVAQPSLRYDPTTGEIQGSPNPGSSGENEVNFILAPPEVGRYALGRLLKQL
                     KKYFPKAANQVVNPDTLGSPTKVLSLAYDLLVGKFRTTVPYALKDLGQHVLGLRATQE
                     DGFLWRLIGPEGFVLGKGKGFPPEEILPRAFVVHFMGNDRQLEEVMDWTHEPVVRLEL
                     SDLRFSQKNLPLGTFFRATPEVAYLLAHPGYPGWPTALRVEVIQGNLTLEEALKQVYW
                     LTKPTGGLYHPGKLPLSVEEKVPWDRLQPPREMGQTYSLER"
     misc_feature    complement(74390..>74962)
                     /locus_tag="TCCBUS3UF1_660"
                     /note="Piwi-like: PIWI domain. Domain found in proteins
                     involved in RNA silencing. RNA silencing refers to a group
                     of related gene-silencing mechanisms mediated by short RNA
                     molecules, including siRNAs, miRNAs, and
                     heterochromatin-related guide RNAs. The...; Region:
                     Piwi-like; cl00628"
                     /db_xref="CDD:260542"
     misc_feature    complement(order(74846..74848,74858..74860,74870..74872,
                     74879..74881,74909..74911,74918..74929,74954..74956))
                     /locus_tag="TCCBUS3UF1_660"
                     /note="5' RNA guide strand anchoring site; other site"
                     /db_xref="CDD:239208"
     misc_feature    complement(order(74675..74677,74789..74791,74795..74797))
                     /locus_tag="TCCBUS3UF1_660"
                     /note="active site"
                     /db_xref="CDD:239208"
     gene            complement(76311..80309)
                     /locus_tag="TCCBUS3UF1_670"
                     /db_xref="GeneID:12251422"
     CDS             complement(76311..80309)
                     /locus_tag="TCCBUS3UF1_670"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653191.1"
                     /db_xref="GI:384438467"
                     /db_xref="GeneID:12251422"
                     /translation="MFHAIRLSGGIFTEEFLQTLGHPEALKELSLTPEELRNRFYLLL
                     NLYERHKPLYELRDTSRARESWLLPLFRALGFQPVYNRSHLVVGEQAFPISHRGWDGE
                     EAPPLHLVAGELDLRPNRREKSPQGLVQGYLNAHPHQDWGVVAAPWEVRLLRKYYHVS
                     LPGYVAFNLVELFEAPREQALREFQILLLLLSPSRFQKGKDGKTPLERYYETARQTGI
                     RARDALRKGVVEALEILGNAFLNESLRQELNDPERLAAYHAELLRLVYRILFLLYAES
                     RGLIPTGGELSWVYEREYSISALRERAARDNPYGEDRNTDLWEKLLLTFHLVYRGDAR
                     LGVPALNGELFAPENLRILTGGVSNPGERARFPELPRPTNSQLLRAIRHLTHLEREGA
                     LERINYRDLEVEEIGHVYEGILALTPRLVEGRYSLESHLLDKKLSGSYYTPRELVQLV
                     VQEALAPVVEERLKAAGDDPERQEEAILSIKVVDPAMGSGAFLISALEYLAEKLLEVR
                     GQSKGDPEALYAARHLVATRCLYGVDLNPMAVELAKLSLWVASADRSKPLSFLDHHLK
                     VGNSLVGAPQDFLEKGIPKEAYDREDIPKEVRKSLRFGPGGGTLLFAPPSPPFLDFEE
                     ESAEQVEEKRRRYQAWRESEEVRKMELFADYWTAAFFLRPAPGVRLPDAEGLNWLAQQ
                     SRASLEQLGQSSYLNPPTLAAIQVAKRRHRFFHWWLEFPEVFRAGGFDVVLGNPPWEV
                     MEPKEEEFFAERAPHIAALPGKKRKETIEKLSQTDPDLFEKWKEHIRSISTTVQFARN
                     SNRFPLTSKGDANTYRYFAELAYRLRSPRGRVGLIVPTGIATDDSNKEFFAHLVEKGE
                     VSTLLDFENRERLFPGIDSRIKFAVLALRPPSPEPARLAFFLTQPDQAQDPVRQFRLA
                     PRDFALLNPNTRTCPVFRTRQDAELTRAIYEKVPVLWREEPEENPWNVRFRQGLFNMT
                     SDSHLFHTRADLEAQGFHLEGNRFLRGKEIYLPLYEAKLIWHYDHRFATYDGEDTRET
                     TLGEHQDPAYLPLPRYWVRAEEVEGRLEGRGQRGKEAWRWGRGWLLGFRDVTNATNER
                     TVIFSFIPRIAVGHTVPLIQSTYSAVLQLALLSSFNNLVLDFLARQKVGGTHLTFHLL
                     KQFPVLPPSTYGPQDLLFIVPRVLELTYTAWDLAPLAQEVWQEASPELRQALLAQHQA
                     NGGHPDAPPPWVQGPYPFPPFRFDEGRRALLRAELDAYYARLYGLNRKQLRYILDPQD
                     LTPKELADILSDIEEVADPLDEREYRKRRERSSFPGETFRVLRDKEEKRYGEYRTRRL
                     VLEAWTKLHTKG"
     misc_feature    complement(76839..>78134)
                     /locus_tag="TCCBUS3UF1_670"
                     /note="type II restriction m6 adenine DNA
                     methyltransferase, Alw26I/Eco31I/Esp3I family; Region:
                     met_A_Alw26; TIGR02987"
                     /db_xref="CDD:234080"
     misc_feature    complement(77688..>77891)
                     /locus_tag="TCCBUS3UF1_670"
                     /note="Eco57I restriction-modification methylase; Region:
                     Eco57I; pfam07669"
                     /db_xref="CDD:254345"
     gene            complement(80321..83077)
                     /locus_tag="TCCBUS3UF1_680"
                     /db_xref="GeneID:12251423"
     CDS             complement(80321..83077)
                     /locus_tag="TCCBUS3UF1_680"
                     /note="similar to Superfamily II DNA/RNA helicases, SNF2
                     family COG0553;
                     similar to Putative uncharacterized protein of Meiothermus
                     silvanus DSM 9946 UniRef RepID=D7BJ08_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653192.1"
                     /db_xref="GI:384438468"
                     /db_xref="GeneID:12251423"
                     /translation="MNVDMLQPGALFRARGRDFRLERRQGDVLVARTVDSEEETLFYL
                     PLEGEALELTTLGLPPERPGDPALHDLLLQALDLATLHADAPFLALQRSRVVPANYQL
                     VPLLMALRQPKVRLLIADDVGLGKTVEAGLIIKELLLRNKARRVLILAPAHLLGQWQE
                     ALRRFFHLDFAVLSGPNLKRLARTLPPGANPWAHFDRIIASVDYAKQGDVRQLVLLQD
                     FDLLLVDEAHMAARPPTEKGKQMERYRLVRELARRVPHLLLLTATPHNGYTESFYSLL
                     EHLDALGLGLFKNGTLDREVAKKHVVQRRRKDVEEWFRKEGKKSPFPERETKEEAVNP
                     NRAELELFEAVRRYQAEVYDPDPAKVPVLGRWLAMHLMRRATSSPRALERSLERRKGL
                     LENLLTEGQGITGEEEAALFDTTPDRLLPEEAEVGLELSLADRARAQAEKGYLETLLR
                     YLKGWRKDSKLERLRDLLTQPFLFGKGRTLLFTRYRDTLEYLVEKLGPNLPYPVFAVH
                     GEMSEEDRDEVLKAFAQESPALLIATDVFSEGLNLQHYAAQLIHYDLPWNPNRLEQRN
                     GRIDRFGQPEPRVRIRTFYYEQSFDVAVFHLLLEKAERIRRELGVVPAFFGEEAYLRE
                     RLEALWKQDWRQERRLQASLFAEVEDRELEGARRAVQEGFYGHSEFSLPDVEKRLQQA
                     LERAGNPKALEGFVLDGLRYLGWRVWGEDPYTAERDAGEAVPGLPARFGPFSFDPEAP
                     LGVEVLDLSHPLVEHLVSYLRYRAYRDLDGARTALLALRAPLGTPPVAFYHFRARFLG
                     PGGEVLETLYRRALRLLDGAEVPPKEAEALWRARLKAAPALSREQAQLLAADALRTPL
                     EALGRRGAEEALARLKAEREALKRDLERAYGTLPEAFRELDRLELLGHELLAITLLAP
                     AALR"
     misc_feature    complement(82286..82732)
                     /locus_tag="TCCBUS3UF1_680"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(82697..82711)
                     /locus_tag="TCCBUS3UF1_680"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(82394..82405)
                     /locus_tag="TCCBUS3UF1_680"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(81353..81733)
                     /locus_tag="TCCBUS3UF1_680"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(81470..81478,81551..81556,81617..81628))
                     /locus_tag="TCCBUS3UF1_680"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(81365..81367,81374..81376,81386..81388,
                     81452..81454))
                     /locus_tag="TCCBUS3UF1_680"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     STS             82120..82525
                     /standard_name="GDB:371657"
                     /db_xref="UniSTS:156878"
     gene            complement(83122..83445)
                     /locus_tag="TCCBUS3UF1_690"
                     /db_xref="GeneID:12251424"
     CDS             complement(83122..83445)
                     /locus_tag="TCCBUS3UF1_690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653193.1"
                     /db_xref="GI:384438469"
                     /db_xref="GeneID:12251424"
                     /translation="MYRPSGFWDYTWEILSDAKVLEPAPSLEAVVKLVQRFLKESEDQ
                     LEPGNRYKIITYTPARALEMHLIRPLLTPSELARAEHGFFFEATWGNPTPKAEADLFP
                     LKKRD"
     gene            complement(83942..84211)
                     /locus_tag="TCCBUS3UF1_700"
                     /db_xref="GeneID:12251425"
     CDS             complement(83942..84211)
                     /locus_tag="TCCBUS3UF1_700"
                     /note="similar to Putative uncharacterized protein of
                     Meiothermus UniRef RepID=D3PRB0_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653194.1"
                     /db_xref="GI:384438470"
                     /db_xref="GeneID:12251425"
                     /translation="MPIRYNPYTGRYEYAEKDQEPVQNEYEGGYEFGRQRETDYTPFT
                     RRYRKRGEGLVDRWNPYTGRYEAVPEGWEPRQNPYTGEYELGPEE"
     gene            complement(84228..84686)
                     /locus_tag="TCCBUS3UF1_710"
                     /db_xref="GeneID:12251426"
     CDS             complement(84228..84686)
                     /locus_tag="TCCBUS3UF1_710"
                     /note="similar to DNA polymerase III subunits gamma and
                     tau PRK07764;
                     similar to Putative uncharacterized protein of Meiothermus
                     silvanus DSM 9946 UniRef RepID=D7BJ21_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653195.1"
                     /db_xref="GI:384438471"
                     /db_xref="GeneID:12251426"
                     /translation="MVQPVEPLTAERIGRALKAMGLKVLVNEDGEFLVLFKKDPSANP
                     MALVNVAPQGSANQVLAVIALVKGHPPMEPEELLAKANEWNGTRRWPRALVRGGELLL
                     DYHVDLEEGVTEAQLRNFLATAFSGIGQFLLWIEGGDDLEDLFRTLGLLG"
     misc_feature    complement(84279..84662)
                     /locus_tag="TCCBUS3UF1_710"
                     /note="Putative bacterial sensory transduction regulator;
                     Region: YbjN; pfam10722"
                     /db_xref="CDD:256139"
     gene            complement(84690..86180)
                     /locus_tag="TCCBUS3UF1_720"
                     /db_xref="GeneID:12251427"
     CDS             complement(84690..86180)
                     /locus_tag="TCCBUS3UF1_720"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653196.1"
                     /db_xref="GI:384438472"
                     /db_xref="GeneID:12251427"
                     /translation="MPLNPGPRVHPTHQGGRGFPASPQGELLLLVAGSLFSGDLFYEG
                     AEEREARFTALAAEVTQQDPEFVALLATYARQVLGLRSGPSALVAHLFWWGPVEVAEG
                     AAQRVWLRGDEHLETLAYTRAQGWRIRKALKRAVAQRLNAMSPQALLKYRWEGRGFRQ
                     RDALILCHPKAPDREHALVYEWLVRGREAQPEARALVETLLAERPTWERILSRKGSTP
                     EAWREALPHLSGLALVRNLNNLHRHGLLEDPGVQAWLAQRLGDPRVARWGLFPYQWLQ
                     ALLQGEELGYPQAVLSALEGALEASLPSLPFQGESLVLVDVSGSMYQPLSARSQATYA
                     LAAASLGALLYRATGGQLYGFDRHTIPLPYGPDAPLGQMVRHLLEAGGGGTYLGEALR
                     RTLPAFPGPRVVILTDEQVADDAYTPLRRWLGEDPSRVAHVVNVAGYGPLAFPEGGVS
                     RVAGFSGRLLELLAVLEAQDPKAHLRARVSEASLAEEEEEGEGQGR"
     misc_feature    complement(85263..86150)
                     /locus_tag="TCCBUS3UF1_720"
                     /note="TROVE domain; Region: TROVE; pfam05731"
                     /db_xref="CDD:253355"
     misc_feature    complement(<84921..85247)
                     /locus_tag="TCCBUS3UF1_720"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(84957..84959,85026..85028,85233..85235))
                     /locus_tag="TCCBUS3UF1_720"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            86610..87830
                     /locus_tag="TCCBUS3UF1_730"
                     /db_xref="GeneID:12251428"
     CDS             86610..87830
                     /locus_tag="TCCBUS3UF1_730"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653197.1"
                     /db_xref="GI:384438473"
                     /db_xref="GeneID:12251428"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    86649..87797
                     /locus_tag="TCCBUS3UF1_730"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    86685..87734
                     /locus_tag="TCCBUS3UF1_730"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            88175..88327
                     /locus_tag="TCCBUS3UF1_740"
                     /db_xref="GeneID:12251429"
     CDS             88175..88327
                     /locus_tag="TCCBUS3UF1_740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653198.1"
                     /db_xref="GI:384438474"
                     /db_xref="GeneID:12251429"
                     /translation="MGMDRYSERQKVTTTLVNPFEGPSTPDTLGAEIETLHRTENPHQ
                     GGKDYP"
     gene            complement(88550..90415)
                     /locus_tag="TCCBUS3UF1_750"
                     /db_xref="GeneID:12251430"
     CDS             complement(88550..90415)
                     /locus_tag="TCCBUS3UF1_750"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653199.1"
                     /db_xref="GI:384438475"
                     /db_xref="GeneID:12251430"
                     /translation="MDREMPSTPLFSEPLRERLGIVFSLDEGRALECSPMELLLGYTK
                     LRAISFSASLKGLAELLAPLEEVELLLGLEEGHAAASALAALWEEAQSLLVLMGTKRR
                     LEVRFLPNSHAKLYLLEGPKGVRTILGSLNLSQSAWSGVQGEIAAFSDRLEVYQAFLS
                     WYEGERERARPLLGERERKRLEGKSLLLMPTALPPEEVRRAVAEAKGIVVVNLLPHKP
                     LVDRTEREKEAELRALKELTWEMRKAEDLVRLRGKETYLQSLVERALREVPVLEYAPD
                     GPRYRGLLAKDLSPDPQGVEATLRALSALLEGARRGSPSLAEAVGEALVYGFASSYLP
                     LLREEAGRQGRSPTRFPIVALLVGRAGAGKTTILRAIAATWGISFRHYRQVEETGRSK
                     GATVEAHLYLEERAPLPIDEVPPRHLTEENRLAQVVKGVGDDPGVRRALILTSNLEHF
                     RSEEQILRRAWFIPFEHLPQGMGSADLEDHLKAIRPDLFLRFLQEAFPTSDELASLLQ
                     GNDPLAPARRFLRGMGLSVPEGPKGDYRAHLLARWRNLYHTQREIFREIQAPDIATGR
                     PIPCFVVDKEKAGFLVPLQAFDNGFSGNGQAFLLKKREFLEAIGEGRPWWRRVWG"
     misc_feature    complement(90005..>90148)
                     /locus_tag="TCCBUS3UF1_750"
                     /note="Catalytic domain of type II restriction
                     endonucleases BfiI and NgoFVII, and uncharacterized
                     proteins with a DEAD domain; Region: PLDc_Bfil_DEXD_like;
                     cd09117"
                     /db_xref="CDD:197216"
     misc_feature    complement(order(90020..90022,90026..90028,90074..90076,
                     90080..90082))
                     /locus_tag="TCCBUS3UF1_750"
                     /note="putative active site [active]"
                     /db_xref="CDD:197216"
     misc_feature    complement(90080..90082)
                     /locus_tag="TCCBUS3UF1_750"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197216"
     misc_feature    complement(<89297..89842)
                     /locus_tag="TCCBUS3UF1_750"
                     /note="flagellar biosynthetic protein FlhF; Region: FlhF;
                     TIGR03499"
                     /db_xref="CDD:234232"
     misc_feature    complement(<89162..89362)
                     /locus_tag="TCCBUS3UF1_750"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     gene            90670..90813
                     /locus_tag="TCCBUS3UF1_760"
                     /db_xref="GeneID:12251431"
     CDS             90670..90813
                     /locus_tag="TCCBUS3UF1_760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653200.1"
                     /db_xref="GI:384438476"
                     /db_xref="GeneID:12251431"
                     /translation="MTIDPEFVRGLDYWKKWLWVISVTLGYALVVWGGMELSRWLEER
                     GQP"
     gene            complement(91295..91981)
                     /locus_tag="TCCBUS3UF1_770"
                     /db_xref="GeneID:12251432"
     CDS             complement(91295..91981)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="similar to leucine/isoleucine/valine transporter
                     ATP-binding subunit PRK11614;
                     similar to ABC transporter related of Proteobacteria
                     UniRef RepID=A1WG82_VEREI"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653201.1"
                     /db_xref="GI:384438477"
                     /db_xref="GeneID:12251432"
                     /translation="MSLRLEGFRAGYGGIPVLHGLDLEVREGEVVALLGRNGAGKTTT
                     LKGIMGLVRSQGGRVVYRDQDLARMPPFLRAQLGLGYVPDDRRIFPELTVRENLLIAH
                     RPGPWTLDRVYGLLPRLQEIENRRGGLLSGGEQQMLTLARTLMTNPRFLLLDEPTEGL
                     APLIVEEIARLLLELKREGMPILLAEQNLRFTGRVADRAYVLETGEIRLSGPMGELMH
                     REEVAALLSL"
     misc_feature    complement(91304..91975)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(91328..91975)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(91856..91879)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(91421..91423,91517..91522,91730..91732,
                     91853..91861,91865..91870))
                     /locus_tag="TCCBUS3UF1_770"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91730..91741)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91565..91594)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91517..91534)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91499..91510)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(91415..91435)
                     /locus_tag="TCCBUS3UF1_770"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(91978..92700)
                     /locus_tag="TCCBUS3UF1_780"
                     /db_xref="GeneID:12251433"
     CDS             complement(91978..92700)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="similar to leucine/isoleucine/valine transporter
                     ATP-binding subunit PRK11300;
                     similar to ABC transporter related of Bacteria UniRef
                     RepID=Q1AZ42_RUBXD"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653202.1"
                     /db_xref="GI:384438478"
                     /db_xref="GeneID:12251433"
                     /translation="MYKSFGGFLALASVSLSVAEGTFHALVGPNGAGKTTLFNVITGR
                     IRPDAGRVRFRGEEITGWPTSRVARKGIAISFQRAQPFSSFTVLEAVVLARLGYEGRT
                     FTLQPLKAFPGAWEQAREALVKVGLGGYAHRPVSELPLGDLKRLDVAIALVARPKLLL
                     LDEPLAGLSRAERKQMVEFIRGLLRQEGITLLFTEHDTEAVLALADRITVLHQGQVLA
                     EGTPEEIQKDQKVRQAFLGGGA"
     misc_feature    complement(91987..92694)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(92008..92694)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(92596..92619)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(92113..92115,92212..92217,92470..92472,
                     92593..92601,92605..92610))
                     /locus_tag="TCCBUS3UF1_780"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92470..92481)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92260..92289)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92212..92229)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92194..92205)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(92107..92127)
                     /locus_tag="TCCBUS3UF1_780"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(92705..93637)
                     /locus_tag="TCCBUS3UF1_790"
                     /db_xref="GeneID:12251434"
     CDS             complement(92705..93637)
                     /locus_tag="TCCBUS3UF1_790"
                     /note="similar to leucine/isoleucine/valine transporter
                     permease subunit PRK11301;
                     similar to Inner-membrane translocator of Marinobacter
                     UniRef RepID=A3J7U9_9ALTE"
                     /codon_start=1
                     /transl_table=11
                     /product="Inner-membrane translocator"
                     /protein_id="YP_005653203.1"
                     /db_xref="GI:384438479"
                     /db_xref="GeneID:12251434"
                     /translation="MRLGLLVLCLALLGPFLGEYGLKLLSEALILGLYAMAFNLLFHQ
                     AGLLSFGQAAFFGVGAYAMALLMARSGWSFLATLPLAFLLGGAAAFLVGFLSLRLTRI
                     YFTMLTLAFAQLLYAVAHKWYAFTGGDNGITDLRPAGPWGESLPFYYLTLGLFGLLVG
                     LLASLERSPFGYALRALRDNRARAEAVGLDGFRHLLLAFALAGAISGVAGALQGALQR
                     SVFPDYLFWTRSAEAIISTILGGSGVFLGPAVGAAAFLFLRVLVQAQTEYWPFFLGLL
                     LLLMVLFFPRGLAGVWARLGRGISLGVERGAPRG"
     misc_feature    complement(92831..93556)
                     /locus_tag="TCCBUS3UF1_790"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(93038..93094)
                     /locus_tag="TCCBUS3UF1_790"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(93634..94515)
                     /locus_tag="TCCBUS3UF1_800"
                     /db_xref="GeneID:12251435"
     CDS             complement(93634..94515)
                     /locus_tag="TCCBUS3UF1_800"
                     /note="similar to branched-chain amino acid transporter
                     permease subunit LivH PRK10740;
                     similar to ABC transporter permease protein of
                     Proteobacteria UniRef RepID=A8I9I2_AZOC5"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005653204.1"
                     /db_xref="GI:384438480"
                     /db_xref="GeneID:12251435"
                     /translation="MDLSFLLLQLLTGLAYASTLFLLSVGLSLIFGAMGIVNFAHGSF
                     YMLGAYLLFAFTRGQAEGFWAGLFLVLAAGLVVGALVERLLIRPIYPRPEEYQILLTY
                     ALLLILEDLVRLAFGAGYRSFPLPPLFSSPLFLLGAPFPSYYLFLLALAGLSALGLWA
                     FLYRTRLGTWVRAATQDREMLEALGVNVPLLYTAIFALGIALAALGGAALVPLQAATP
                     GMAVDAVINAFIVVVIGGLGSVWGALLGAVLIGLLQAFGILLLPEMAMVFPFALMALV
                     LLLRPWGLLGRPPAVRT"
     misc_feature    complement(93661..94473)
                     /locus_tag="TCCBUS3UF1_800"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(93925..93981)
                     /locus_tag="TCCBUS3UF1_800"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(94519..95715)
                     /locus_tag="TCCBUS3UF1_810"
                     /db_xref="GeneID:12251436"
     CDS             complement(94519..95715)
                     /locus_tag="TCCBUS3UF1_810"
                     /note="similar to Extracellular ligand-binding receptor of
                     Anaeromyxobacter sp. Fw109-5 UniRef RepID=A7H9I5_ANADF"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular ligand-binding receptor"
                     /protein_id="YP_005653205.1"
                     /db_xref="GI:384438481"
                     /db_xref="GeneID:12251436"
                     /translation="MKAWRWILAFGLLAGLVLAQGQQPIKIGALFILSGNFAGYGKSG
                     SQGAQLAVEEINARGGVLGRPLQLLVVDDQGNPEVGVREARRLVLQEKVDFLFGIDSS
                     SVALAVAPLTDEYKIPLVVTHAATPTLTEQCRPYVFRTSNNARMDAWAAAALAATLPV
                     KRWANIGPDYEFGRVSWQDFIARLRQLRPDVEVVSEQWPRFGSTDYASFITALMRARP
                     EGVFSTLWAGDMVIFARQAKAFGFFNQVRYFVNPVGAALEVLAPLGKETPEGLLVSAR
                     YWFLYPNAERNRAFVEAYRKRFGEYPSYNAQEAYAGMQMLALAIQKARSTQAEAIRKA
                     FEADGGLVYEAPEGRKRMRPEDHQVFESLVWGYTKHSPEYPFAILERMRIVPASDTVY
                     PTQCKR"
     misc_feature    complement(94612..95640)
                     /locus_tag="TCCBUS3UF1_810"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins; Region: PBP1_Arsenic_SBP_like;
                     cd06330"
                     /db_xref="CDD:107325"
     misc_feature    complement(order(94960..94962,95038..95040,95200..95202,
                     95341..95349,95410..95418))
                     /locus_tag="TCCBUS3UF1_810"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107325"
     gene            complement(95726..96427)
                     /locus_tag="TCCBUS3UF1_820"
                     /db_xref="GeneID:12251437"
     CDS             complement(95726..96427)
                     /locus_tag="TCCBUS3UF1_820"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK05653;
                     similar to Short-chain dehydrogenase/reductase SDR of
                     Micromonospora UniRef RepID=D1S6T7_9ACTO"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_005653206.1"
                     /db_xref="GI:384438482"
                     /db_xref="GeneID:12251437"
                     /translation="MIGATRGIGLAVAQELARRGARLGLTGRDPERVRAVATELGAWG
                     KAVDVRRREDLVEAVAGFARDVGLYGLVYNAGTSPAFTRAERLSLEVWDEVLAVNLTG
                     AFVAAQAFAQRLVGEGSVVLVGSVLGFRGGGRLAAYTASKAGLWGLTRALALDWAERG
                     IRVNLVAPGWTETEMTQGLREHPHLGPALLREIPLGRMARPEEVARMVAFLLEPENAY
                     LTGGFYAVDGGVGAR"
     misc_feature    complement(95738..96421)
                     /locus_tag="TCCBUS3UF1_820"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(95747..96421)
                     /locus_tag="TCCBUS3UF1_820"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(95906..95911,95915..95926,96002..96004,
                     96014..96016,96053..96061,96134..96136,96200..96208,
                     96281..96286,96341..96349,96404..96415,96419..96421))
                     /locus_tag="TCCBUS3UF1_820"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(96002..96004,96014..96016,96053..96055,
                     96131..96133))
                     /locus_tag="TCCBUS3UF1_820"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(96444..97736)
                     /locus_tag="TCCBUS3UF1_830"
                     /db_xref="GeneID:12251438"
     CDS             complement(96444..97736)
                     /locus_tag="TCCBUS3UF1_830"
                     /note="similar to Coenzyme F390 synthetase COG1541;
                     similar to Putative coenzyme A ligase of Symbiobacterium
                     thermophilum UniRef RepID=Q67RK6_SYMTH"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme A ligase"
                     /protein_id="YP_005653207.1"
                     /db_xref="GI:384438483"
                     /db_xref="GeneID:12251438"
                     /translation="MRAFWEPEVETLPRPQLESLQLERLRQQVERLWRTSAFFREKWA
                     GVNLELRHLEDLSRLPLVTKAELRAEQQAHPPLGRYTGVEAQSWREYHPSSGTTGFPV
                     GTVWSEGDVENITQVTARVLYGYGLRPGDILLNGFSYGLWVAGLAVHYAARAMGLFVL
                     PVGAGQTERHLELMERFRPRALTATPSFGLYLGEALRARGLESPLRIGAFGGEAGTEN
                     PSTRRRLEEALSLQAYDFYGLAEMGPTFAGECQAKAGLHFAEDHYLVEVVDPESQEPL
                     PEGEVGVLVLTHLTREATPLVRYYTGDLARLTKEPCPCGRTHLRAVGGILGRVDDLVV
                     YRGAKFYPGQVEEVVRRFPELAGEYRIEVWEAGGLVQGVTVVVEMAHPGVGEGLVEAL
                     RQSLKAALGVTPEVRLEAPGTLERTAFKAKRVVRHAQA"
     misc_feature    complement(96456..97736)
                     /locus_tag="TCCBUS3UF1_830"
                     /note="Coenzyme F390 synthetase [Coenzyme metabolism];
                     Region: PaaK; COG1541"
                     /db_xref="CDD:224458"
     misc_feature    complement(96462..97715)
                     /locus_tag="TCCBUS3UF1_830"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(97431..97436,97440..97457,97464..97466))
                     /locus_tag="TCCBUS3UF1_830"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(96477..96479,96720..96722,96753..96755,
                     96762..96764,96828..96830,97017..97034,97101..97106,
                     97455..97457))
                     /locus_tag="TCCBUS3UF1_830"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(96537..96539,96720..96731,96753..96755,
                     96762..96764,96828..96830,97017..97034,97101..97106,
                     97164..97166,97173..97178,97182..97184,97323..97328,
                     97455..97457))
                     /locus_tag="TCCBUS3UF1_830"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(96537..96539,96558..96560,96723..96731,
                     97104..97106,97164..97166,97173..97178,97326..97328))
                     /locus_tag="TCCBUS3UF1_830"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            97839..98378
                     /locus_tag="TCCBUS3UF1_840"
                     /db_xref="GeneID:12251439"
     CDS             97839..98378
                     /locus_tag="TCCBUS3UF1_840"
                     /note="similar to Putative uncharacterized protein of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7AB56_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653208.1"
                     /db_xref="GI:384438484"
                     /db_xref="GeneID:12251439"
                     /translation="MAQSTIPSLYTLSDLARESGVSRRILQHYAHLGLLEPGALTQGG
                     RKLYTGFALYLIQDIQDLNQLGFTLEEIRKIMALKKVIFHPDGTYREDWRREEIPLTQ
                     EELWAMWAKTGEVLSSMERQERMIRRFHRFLTKHFAPKEVRDGLRSGPGDGGAQGAGA
                     GLPGGGGDPQGGGGGQEPG"
     misc_feature    97866..>98072
                     /locus_tag="TCCBUS3UF1_840"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    97866..>98069
                     /locus_tag="TCCBUS3UF1_840"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     misc_feature    order(97869..97877,97917..97919,97968..97976)
                     /locus_tag="TCCBUS3UF1_840"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     gene            98338..99429
                     /locus_tag="TCCBUS3UF1_850"
                     /db_xref="GeneID:12251440"
     CDS             98338..99429
                     /locus_tag="TCCBUS3UF1_850"
                     /note="similar to acyl-CoA dehydrogenase PRK13026;
                     similar to Acyl-CoA dehydrogenase domain protein of
                     cellular organisms UniRef RepID=A1WKU1_VEREI"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase domain protein"
                     /protein_id="YP_005653209.1"
                     /db_xref="GI:384438485"
                     /db_xref="GeneID:12251440"
                     /translation="MIPREGEAARNLDSLEAIAKELQGEAKRRGLFLPHMPKALGGLG
                     LTWTQLAVVLEEAGRSLLGPKALNASAPDEGNMHLLEKVGSEAQKRRYLHPLLEGEIR
                     SAFAMTEPMGAGADPSLLKATARRKGRGFVLEGRKWFITGAEGAAFFIVLARAEEGPT
                     LFLVDRENPGLKLVRTIPTMDHWSIGGHGELVLEGCEVGEEAVLGEVGQGFAYAELRL
                     DPARLTHCMRWLGVGVRATELAQAYALQRDSFGKKLAEHQGVQFMIADSHMELHAARL
                     MVWHAAWKLDRGERIRHEASMAKVFVAEAVGRAVDRAVQITGGLGISEDIPLSIFYRE
                     VRPFRIYDGPSEVHRASIGKRALYKGLRP"
     misc_feature    98344..99408
                     /locus_tag="TCCBUS3UF1_850"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    98350..99408
                     /locus_tag="TCCBUS3UF1_850"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(98560..98562,98650..98652,98656..98658,98752..98754,
                     98758..98760,99355..99363,99367..99369,99373..99375)
                     /locus_tag="TCCBUS3UF1_850"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            99426..100406
                     /locus_tag="TCCBUS3UF1_860"
                     /db_xref="GeneID:12251441"
     CDS             99426..100406
                     /locus_tag="TCCBUS3UF1_860"
                     /note="similar to Aminoglycoside phosphotransferase of
                     Thermus UniRef RepID=B7AB58_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminoglycoside phosphotransferase"
                     /protein_id="YP_005653210.1"
                     /db_xref="GI:384438486"
                     /db_xref="GeneID:12251441"
                     /translation="MREALEAAFRELFGPGELVALRRIPGGASKEAWALDYRAGGRVY
                     PLFLRRAGGGVIQRRTLALATEFRLLELAHAHGVKVARPLWYFPDLEGREAFLMERLE
                     GESIGTRVVRRPEYQRARETLPRAMAEELARIHRIPLEELPPLPGPGGKPAHLWILEE
                     LYGDLDALGEAHPALEWGLRWLQNHPPRPLPPVLVHGDFRVGNLMVDGEGLVAVLDWE
                     FAHLGDPREDLAWPLVRAWRFGEDQRRLGGLGEVGPFLERYNALTGGEIAEEELFWWE
                     VLGNVRWGLGALNQARRHLKGEERSVELAVLGRLAAEMEYEVLYLLEKHG"
     misc_feature    99480..100142
                     /locus_tag="TCCBUS3UF1_860"
                     /note="Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal
                     domain, and similar proteins. This subfamily is part of a
                     larger superfamily that includes the catalytic domains of
                     other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs); Region:
                     ACAD10_11_like; cd05154"
                     /db_xref="CDD:240175"
     misc_feature    99486..100178
                     /locus_tag="TCCBUS3UF1_860"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(99507..99509,99519..99521,99564..99566,99570..99572,
                     99666..99668,99717..99728,100017..100019,100029..100034,
                     100038..100040,100068..100073,100128..100130)
                     /locus_tag="TCCBUS3UF1_860"
                     /note="putative active site [active]"
                     /db_xref="CDD:240175"
     misc_feature    order(99507..99509,100017..100019,100128..100130)
                     /locus_tag="TCCBUS3UF1_860"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240175"
     misc_feature    order(99519..99521,99564..99566,99570..99572,99666..99668,
                     99717..99728,100017..100019,100029..100034,100038..100040,
                     100068..100073)
                     /locus_tag="TCCBUS3UF1_860"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240175"
     gene            100399..100749
                     /locus_tag="TCCBUS3UF1_870"
                     /db_xref="GeneID:12251442"
     CDS             100399..100749
                     /locus_tag="TCCBUS3UF1_870"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653211.1"
                     /db_xref="GI:384438487"
                     /db_xref="GeneID:12251442"
                     /translation="MDRPNLDELLEAVAEFLKGEVLPTLEDPRLHFQALVALNALGIA
                     RREVALGKALEAEDLGELGRLLGREGDREGLLRELAQRIRQGEAPEGTFSFLKAHVAR
                     KLRIASPKHLERYP"
     gene            100746..101393
                     /locus_tag="TCCBUS3UF1_880"
                     /db_xref="GeneID:12251443"
     CDS             100746..101393
                     /locus_tag="TCCBUS3UF1_880"
                     /note="similar to Broad specificity phosphatase PhoE and
                     related phosphatases COG0406;
                     similar to Phosphoglycerate mutase family protein of
                     Thermus UniRef RepID=Q53WE2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate mutase"
                     /protein_id="YP_005653212.1"
                     /db_xref="GI:384438488"
                     /db_xref="GeneID:12251443"
                     /translation="MRRRLLLLRHGEVDYFPGGRPIPPEGAGLTPRGRAQAEAVGQLL
                     REVPLDLAVHTGLPRTEETLRIVLGGREVPVEAWPEFQEIRPGRLRDLPDPERAFREA
                     FHPQDLSERFLGGEGYGEFLDRVLPAYGRLLARPWDTLLLVAHGGVIRALLSYALTGQ
                     RGFLPLEVHPCGLSVLDLGDRPLLRLHNLTPYELLPQTRLSTMEALWRAYLGEGG"
     misc_feature    100773..101306
                     /locus_tag="TCCBUS3UF1_880"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    order(100773..100775,100920..100922,101178..101183)
                     /locus_tag="TCCBUS3UF1_880"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            complement(101390..102373)
                     /locus_tag="TCCBUS3UF1_890"
                     /db_xref="GeneID:12251444"
     CDS             complement(101390..102373)
                     /locus_tag="TCCBUS3UF1_890"
                     /note="similar to Immunogenic protein of Thermaceae UniRef
                     RepID=Q72J30_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653213.1"
                     /db_xref="GI:384438489"
                     /db_xref="GeneID:12251444"
                     /translation="MRRTVWLWLFLGLALAQKPQVLIGTGGVGGVYFYYGTAVAELLN
                     KGGAVQAQAMQSGGSMENLMLLRDRTDPARGVYYCGTALPDAALLAYQGEERFQGKPA
                     PVRILFTMYPNYFHVVTTEDSGIRVLQDLKGKRVSTEVAGGIIEYEARILMSAALPGF
                     DPRTHFAKWERTRVAESAQMLAEGTLDAFFWSGGLPTGSILELSGSLARRGKRLFLVP
                     LVPQSTAVQMLQRRFPGVVDTGVVPKGVYNTRYDTPTLTFWNVFVCPASLPEEVAYTM
                     VKTVFENLPTLHAAVAPARDTTLENAVRSRGGRIPYHEGAVRYFRERGVWR"
     misc_feature    complement(101402..102340)
                     /locus_tag="TCCBUS3UF1_890"
                     /note="TRAP transporter solute receptor, TAXI family;
                     Region: TRAP_TAXI; TIGR02122"
                     /db_xref="CDD:233736"
     gene            102517..103668
                     /locus_tag="TCCBUS3UF1_900"
                     /db_xref="GeneID:12251445"
     CDS             102517..103668
                     /locus_tag="TCCBUS3UF1_900"
                     /note="similar to TRAP-type uncharacterized transport
                     system periplasmic component-like protein of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7AB54_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP-type transport system periplasmic
                     component-like protein"
                     /protein_id="YP_005653214.1"
                     /db_xref="GI:384438490"
                     /db_xref="GeneID:12251445"
                     /translation="MVRWGVGFLALLALGAWAQEGFRWPRQILFASTEVGTAGYSLLV
                     AWSAEFTAATGVQLRVSPGATPTLTGWLLDGRVEFASAPLTVLVEALDGEAGYRPGPL
                     RVVYPAILTPWGLMTRGDSPYRRIQDIGPGVRLAWPPFSYFHRILDGLLACRGLTREQ
                     ARLVPVANYSANSRVIAEGGADIAFTSPVSDVNLEVEGNPRGIRWLPVPTAQEDRLCL
                     QRWQRAYPLLALVRPADVGAQSARGVRMFVIPSVYYSRADVSEDLVYHLVKWLDENHT
                     LYRDKHAMARFQTLDSLRFLVESMGVPLHPGTVRYLKEKGLWTAEMERKQGAAVRLVD
                     QYATLYERAASLAKSRRIPTDPANEAWQRFWREFLAQNKVPRFSEAWRP"
     misc_feature    102589..103464
                     /locus_tag="TCCBUS3UF1_900"
                     /note="TRAP transporter solute receptor, TAXI family;
                     Region: TRAP_TAXI; TIGR02122"
                     /db_xref="CDD:233736"
     gene            103676..105589
                     /locus_tag="TCCBUS3UF1_910"
                     /db_xref="GeneID:12251446"
     CDS             103676..105589
                     /locus_tag="TCCBUS3UF1_910"
                     /note="similar to TRAP transporter, 4TM/12TM fusion
                     protein of Thermus aquaticus Y51MC23 UniRef
                     RepID=B7AB55_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP transporter, 4TM/12TM fusion protein"
                     /protein_id="YP_005653215.1"
                     /db_xref="GI:384438491"
                     /db_xref="GeneID:12251446"
                     /translation="MEGRWRHLPPWAQAWVALASLLGLGLVLYYLLGSPLTGKALLDF
                     SYYWLLVALFLPLTYLLFPARAGEERPRGYDYALGLGTLGTGLFLAWHGPSMVVRPWT
                     NPEAPWQIALALFLLVAVLEGARRAGGLGFALVALLLAAYPLIAPSLPGLFWGPPLPW
                     TEVLGYAIYSTQGLLGLPMRTVGELLVGFLILAAFLVATGAGEVFLKVASALFGWTRG
                     GAAKVSVVASAFFGSLSGSILSNVAGTGSLTIPAMIRSGFGRTYAAGVEACASTGGVL
                     MPPVMGAVAFVMASLLGIPYGQVVAAAVIPSALYYLSLFAHVDLYAAKHGLKGLHRTE
                     LPPLGPSLREGLPFLLVLALLVFALLYLRLERLAPFYALGVLLLFLLLQGKLTWASLH
                     RGLVAAGALIGQTLALILPVGLILAGLLGTGVAPALTGALVQMGQANLYLVLFLGVAI
                     AFLLGMAGVMVAAYILLAVTLAPALARLGEFVPLAVHLFIAYWSMLSAITPPVAVAAF
                     LAARLAGAPPMAVALEAVKLGLAIYFLPFFFLFEPALILQGEWSSILYHTALAALGLL
                     LLVGGLEGQLWGLGPLPLWARALYVVGGILVAIPETLSSLLAIPVLLGSGLWLWGRGK
                     GKRTPPRGFEERR"
     misc_feature    103796..105514
                     /locus_tag="TCCBUS3UF1_910"
                     /note="TRAP transporter, 4TM/12TM fusion protein; Region:
                     TRAP_fused; TIGR02123"
                     /db_xref="CDD:233737"
     misc_feature    104240..105241
                     /locus_tag="TCCBUS3UF1_910"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; cl17274"
                     /db_xref="CDD:266603"
     gene            105594..106277
                     /locus_tag="TCCBUS3UF1_920"
                     /db_xref="GeneID:12251447"
     CDS             105594..106277
                     /locus_tag="TCCBUS3UF1_920"
                     /note="similar to benzoylformate decarboxylase PRK07092;
                     similar to Thiamine pyrophosphate enzyme-like TPP binding
                     region of Rubrobacter xylanophilus DSM 9941 UniRef
                     RepID=Q1AVS4_RUBXD"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiamine pyrophosphate enzyme-like TPP binding
                     region"
                     /protein_id="YP_005653216.1"
                     /db_xref="GI:384438492"
                     /db_xref="GeneID:12251447"
                     /translation="MKARESAHLWLRERGIRFVFGNPGSTELPFLLGLEGAARYILGL
                     HEGVAVAMADGYAQASGEVAFLNLHAAPGLGNALGALYTALKNRSPLVVTVGDQDRRH
                     RFRAPLLSGPLVEMAKPVSKAAWEVSRAEDLPEALERAFHLALTPPRGPVVVAVPMDV
                     WEEEAPPPPLKGPLPPDPPRASRGWPRPSPRRKTPPWSWGPGPTPLRPAGPPSSWPSA
                     WAPPFSPTP"
     misc_feature    105621..106067
                     /locus_tag="TCCBUS3UF1_920"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    order(105645..105647,105660..105665,105675..105677,
                     105687..105689,105708..105728,105735..105737,
                     105744..105749,105756..105761,105765..105773,
                     105807..105809,105828..105830,105840..105842,
                     105849..105854)
                     /locus_tag="TCCBUS3UF1_920"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(105660..105668,105675..105677,105687..105689,
                     105711..105713,105717..105728,105732..105734,
                     105807..105809,105816..105821,105825..105830,
                     105837..105839,105939..105941,105948..105950)
                     /locus_tag="TCCBUS3UF1_920"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    order(105660..105662,105729..105731,105807..105809,
                     105819..105821)
                     /locus_tag="TCCBUS3UF1_920"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     gene            106322..107158
                     /locus_tag="TCCBUS3UF1_930"
                     /db_xref="GeneID:12251448"
     CDS             106322..107158
                     /locus_tag="TCCBUS3UF1_930"
                     /note="similar to benzoylformate decarboxylase PRK07092;
                     similar to Thiamine pyrophosphate enzyme domain protein
                     TPP-binding of Psychrobacter sp. PRwf-1 UniRef
                     RepID=A5WFU4_PSYWF"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiamine pyrophosphate enzyme domain protein
                     TPP-binding protein"
                     /protein_id="YP_005653217.1"
                     /db_xref="GI:384438493"
                     /db_xref="GeneID:12251448"
                     /translation="MLPPLAASLRERLAPFDLVLVAGAPCFLLYPYSPGPSFPPSTRV
                     VLLTEDPEEAARAEAQEVYLGDVALGLRFLAEAVPPGGRPWPEPPPSPPPPPPRGPGG
                     LNPLYAAARLAQALQDRFLVDEAISLSPPLRRALPAEGARYLHGASGGLGFAPGAAVG
                     AALAGEKAAAVVGDGAFLFAPQALHAARTYGLDVVFVVLNNGGYGILKGFGEALYPGE
                     ASRLPGLSFPGVDFPLLAQAFGVGARRVETPEALEEALENLPQGPFLLEVALDPTPLR
                     VF"
     misc_feature    106682..107131
                     /locus_tag="TCCBUS3UF1_930"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(106772..106774,106838..106849,106922..106924,
                     106928..106930)
                     /locus_tag="TCCBUS3UF1_930"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            107217..107798
                     /locus_tag="TCCBUS3UF1_940"
                     /db_xref="GeneID:12251449"
     CDS             107217..107798
                     /locus_tag="TCCBUS3UF1_940"
                     /note="similar to Transcriptional regulator COG1309;
                     similar to Transcriptional regulator, TetR family of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A732_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator TetR"
                     /protein_id="YP_005653218.1"
                     /db_xref="GI:384438494"
                     /db_xref="GeneID:12251449"
                     /translation="MVVPTKDRILEEAAKLFTEKGYEATSVQDIAQAVGLSKAALYHH
                     FAGKEEVLYAISLQALEGLVREGEKALALPDPAQALLRFMEGHARFFEENYPFFVTML
                     QGIKSLSPERRARTVALRDRHEANLRAILRRGVAMGVFRPLDVALTGRAIFSLLNWMI
                     RWFRPGGPLRAEEVARGYFDLILRGIKHGDPGA"
     misc_feature    107229..107783
                     /locus_tag="TCCBUS3UF1_940"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    107241..107381
                     /locus_tag="TCCBUS3UF1_940"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            107779..108915
                     /locus_tag="TCCBUS3UF1_950"
                     /db_xref="GeneID:12251450"
     CDS             107779..108915
                     /locus_tag="TCCBUS3UF1_950"
                     /note="similar to Acyl-CoA dehydrogenase, short-chain
                     specific of Thermus UniRef RepID=Q72L25_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase, short-chain specific"
                     /protein_id="YP_005653219.1"
                     /db_xref="GI:384438495"
                     /db_xref="GeneID:12251450"
                     /translation="MEIPEHKEIRTLARRFLEEAGPELKAYEEKEAFPWPLVERMGAL
                     GFLGVFVPEELGGAGLDFFAYLALLEEMGGYASLRSILSVQQSLVLTPLLAYGTEAQK
                     RRYVPRLARGEVLGAFGLTEPGAGSDAASLSTRAHWDGEAYVLEGQKTFISHGNVAQV
                     FLIFAKTDPEAGAKGITSFLVEREDGVKTAPLKGKLGLRAADTGVVFLDGVRVPKERI
                     LGREGEGFRIALATLDTGRISLAAGAVGLMQRALDLSLAYVRERRQFGKPLAGFQLIQ
                     AHLAEMKLDLEASRLLTYQAAWKKVRGERYTLEASLAKLYASEAANRVAYRAIQVHGG
                     YGFFEEYEVARLYRDARILTLYEGTSEVQKLLIGAHLTGMRAFA"
     misc_feature    107788..108909
                     /locus_tag="TCCBUS3UF1_950"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    107788..108891
                     /locus_tag="TCCBUS3UF1_950"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(108040..108042,108130..108132,108136..108138,
                     108229..108231,108235..108237,108841..108849,
                     108853..108855,108859..108861)
                     /locus_tag="TCCBUS3UF1_950"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            108926..110173
                     /locus_tag="TCCBUS3UF1_960"
                     /db_xref="GeneID:12251451"
     CDS             108926..110173
                     /locus_tag="TCCBUS3UF1_960"
                     /note="similar to Beta-lactamase of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A6Y5_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase"
                     /protein_id="YP_005653220.1"
                     /db_xref="GI:384438496"
                     /db_xref="GeneID:12251451"
                     /translation="MRWVRFWVLGFLLLGLAWAQVREGVDLGALGAFKARLEAEVAQG
                     RLPGAVFLVARNGQVVFHEAVGYLDPQARTPMPREAIFRIYSMTKPLTSVLALRLVEE
                     GRLFLTDPIALYLPEFREVRVGVERTGPEGRPTLELVAAQRPITVYDLLRHTSGITYG
                     IFFDSLVKQEYRRVGADAVDQTAEEFVRKLAQLPLQFQPGTVWEYSNSTDLLGHLLER
                     LTGRSLAELMEEKLFRPLGMADAGFSVPEAKASRIAEPFLQDPFTRQPTPPALEVRRP
                     PRRFSGGAGAVATALDYYRFLQALLNGGELGGQRILSRKGVELLTQDHLGPLYLPSLG
                     RGAAYLPGPGYGFGLGVAVRLADGGSPLPGSAGDYNWGGLFGTSFFVDPKERLIGIWM
                     MQNPGGRAYYAQLFRHAVYASLR"
     misc_feature    109022..110107
                     /locus_tag="TCCBUS3UF1_960"
                     /note="Beta-lactamase; Region: Beta-lactamase; pfam00144"
                     /db_xref="CDD:249626"
     gene            110173..110943
                     /locus_tag="TCCBUS3UF1_970"
                     /db_xref="GeneID:12251452"
     CDS             110173..110943
                     /locus_tag="TCCBUS3UF1_970"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK05653;
                     similar to 3-oxoacyl-[acyl carrier protein] reductase of
                     Thermus UniRef RepID=Q53WH2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_005653221.1"
                     /db_xref="GI:384438497"
                     /db_xref="GeneID:12251452"
                     /translation="MGRLEGKVILVTGAAHGIGRAALERFAAEGAHLVAVDREEEALL
                     EAVAALEAEALAVPADLADPQGVEGAFAEALEEFGRLDGVAHFAGVAHAALSWKLSLA
                     DWERVLGVNLTGSFLVARKAGEVMQGGSLVLTGSVAALGALGLAHYAASKAALLGLVR
                     TLALELAPKGIRVNLLVPGLIETRMTAGLPEWSRAQEVEASPLKRPGRPEEVAQAALF
                     LLSEESGFITGQALFVDGGRSVLGPPGLPPGFGPKEVG"
     misc_feature    110179..110892
                     /locus_tag="TCCBUS3UF1_970"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    110197..110877
                     /locus_tag="TCCBUS3UF1_970"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(110209..110211,110215..110226,110281..110289,
                     110347..110355,110431..110439,110500..110502,
                     110572..110580,110614..110616,110626..110628,
                     110704..110715,110719..110724)
                     /locus_tag="TCCBUS3UF1_970"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(110503..110505,110578..110580,110614..110616,
                     110626..110628)
                     /locus_tag="TCCBUS3UF1_970"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            110940..111386
                     /locus_tag="TCCBUS3UF1_980"
                     /db_xref="GeneID:12251453"
     CDS             110940..111386
                     /locus_tag="TCCBUS3UF1_980"
                     /note="similar to MaoC-related acyl dehydratase of
                     cellular organisms UniRef RepID=Q53WH3_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC-related acyl dehydratase"
                     /protein_id="YP_005653222.1"
                     /db_xref="GI:384438498"
                     /db_xref="GeneID:12251453"
                     /translation="MMPMYFEDFEVGQRFTTAGRTVTEADVVNFAGVSGDYNPIHTDA
                     EFAKDTPFGQRIAHGLLALAMLTGLRQRTGVTDGTLIAWLEIRNYRFLKPVLIGDTIR
                     GETEIVEKRETSKPDRGILVQRVRVLNQRGEVVQEGEFVTMVRRRP"
     misc_feature    110952..111371
                     /locus_tag="TCCBUS3UF1_980"
                     /note="MoaC_like    Similar to the MaoC (monoamine oxidase
                     C) dehydratase regulatory protein but without the
                     N-terminal PutA domain. This protein family has a hot-dog
                     fold similar to that of (R)-specific enoyl-CoA hydratase,
                     the peroxisomal...; Region: MaoC_like; cd03446"
                     /db_xref="CDD:239530"
     misc_feature    order(110997..110999,111027..111029,111042..111047,
                     111054..111056,111117..111119,111129..111131,
                     111150..111152,111186..111188,111192..111200,
                     111204..111206,111210..111212)
                     /locus_tag="TCCBUS3UF1_980"
                     /note="homodimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239530"
     misc_feature    order(111030..111032,111045..111047,111051..111053,
                     111060..111062,111105..111107,111114..111119)
                     /locus_tag="TCCBUS3UF1_980"
                     /note="putative active site [active]"
                     /db_xref="CDD:239530"
     misc_feature    order(111045..111047,111051..111053,111060..111062,
                     111114..111116)
                     /locus_tag="TCCBUS3UF1_980"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:239530"
     gene            111383..111736
                     /locus_tag="TCCBUS3UF1_990"
                     /db_xref="GeneID:12251454"
     CDS             111383..111736
                     /locus_tag="TCCBUS3UF1_990"
                     /note="similar to hypothetical protein PRK11688;
                     similar to Putative uncharacterized protein TTHB018 of
                     Thermus thermophilus HB8 UniRef RepID=Q53WH4_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653223.1"
                     /db_xref="GI:384438499"
                     /db_xref="GeneID:12251454"
                     /translation="MSPFARWFQAEVGRREGGEAELLLAVREEFLQGQGLVHGGILAA
                     LLDSALGQAVESLGVRVVTAELSVNYLRPVREGVLLARGRVLHAGRRLFHAVGEVFSE
                     GERVAFAKGTFYRVG"
     misc_feature    111401..111727
                     /locus_tag="TCCBUS3UF1_990"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    111491..>111733
                     /locus_tag="TCCBUS3UF1_990"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    order(111491..111493,111569..111571,111590..111601)
                     /locus_tag="TCCBUS3UF1_990"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(111494..111496,111500..111502,111509..111511,
                     111572..111586,111590..111592)
                     /locus_tag="TCCBUS3UF1_990"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(111497..111499,111521..111526,111533..111538,
                     111569..111571)
                     /locus_tag="TCCBUS3UF1_990"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            111766..113370
                     /locus_tag="TCCBUS3UF1_1000"
                     /db_xref="GeneID:12251455"
     CDS             111766..113370
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="similar to long-chain-fatty-acid--CoA ligase
                     PRK06187;
                     similar to Medium-chain-fatty-acid-CoA ligase of Bacteria
                     UniRef RepID=Q72L27_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Medium-chain-fatty-acid-CoA ligase"
                     /protein_id="YP_005653224.1"
                     /db_xref="GI:384438500"
                     /db_xref="GeneID:12251455"
                     /translation="MFPSTMMDEELNLWDFLERAAELFPRKEVVSRLPTGEVHRTDYA
                     GIHRRARRLMGGLKALGVGVGDRVATLAFNGFRHLEAYFAVPGMGAVLHTANPRLAPK
                     EIAYILNHAEDKVLLFDPHLLPLVEALRPELKTVAHFVVLDREAPEGYLAYEALLGEE
                     VDPVRVPERAACGMAYTTGTTGLPKGVVYSHRALVLHSLSASLADGTALSERDVVLPV
                     VPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALAD
                     HLEATGHRLKTLKRLVVGGSAAPKSLIARLERMGIEVRQGYGLTETSPVVVQNFTKSH
                     LEGLSEEEKLSLKAKTGLPIPLVRLRVADEGGKPVPKDGKTLGEVQLRGPWITRGYYG
                     NEAASQQALTPDGWFRTGDVAVWDEEGYLEIKDRLKDLIKSGGEWISSVDLENALMGH
                     PGVKEAAVVAIPHPRWQERPLAVVVPRGERPKEEELREHLLRAGFARWQLPDAFVFVE
                     EIPRTSAGKFLKRALRERYKDLFGGG"
     misc_feature    111781..113352
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07008"
                     /db_xref="CDD:235908"
     misc_feature    111811..113340
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="Fatty acyl-CoA synthetases similar to LC-FACS from
                     Thermus thermophiles; Region: ttLC_FACS_AlkK_like;
                     cd12119"
                     /db_xref="CDD:213327"
     misc_feature    order(111817..111822,111832..111837,111844..111846,
                     111964..111966,112036..112038,112267..112272,
                     112276..112278,112285..112287,112324..112335,
                     112339..112344,112351..112353,112360..112362,
                     112468..112473,112732..112734,112822..112830,
                     112837..112839,112906..112938,112978..112980,
                     112984..112986,113020..113022)
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:213327"
     misc_feature    order(112285..112287,112294..112311,112315..112320)
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213327"
     misc_feature    order(112294..112296,112420..112425,112564..112566,
                     112570..112575,112582..112584,112645..112650,
                     112708..112725,112996..112998,113032..113034,
                     113041..113043,113065..113076,113257..113259)
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="putative active site [active]"
                     /db_xref="CDD:213327"
     misc_feature    order(112294..112296,112648..112656,112708..112725,
                     112996..112998,113041..113043,113047..113049,
                     113059..113061,113074..113076)
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213327"
     misc_feature    order(112420..112422,112570..112575,112582..112584,
                     112645..112647,113065..113073,113239..113241,
                     113257..113259)
                     /locus_tag="TCCBUS3UF1_1000"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213327"
     gene            113370..114131
                     /locus_tag="TCCBUS3UF1_1010"
                     /db_xref="GeneID:12251456"
     CDS             113370..114131
                     /locus_tag="TCCBUS3UF1_1010"
                     /note="similar to gluconate 5-dehydrogenase PRK08213;
                     similar to Gluconate 5-dehydrogenase of Thermaceae UniRef
                     RepID=Q72L28_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="YP_005653225.1"
                     /db_xref="GI:384438501"
                     /db_xref="GeneID:12251456"
                     /translation="MFLERFRLDGKAALVTGGSRGLGLEAALALKEAGARVAVMARRA
                     AFFEEARKHLGEEALYLEGDVRDEARLEAIVAEVEARLGPLTVLVNAAGISWGAPSLE
                     MPVEKVREVLEVNLVGAFLASRAAARPMRERGYGKIIHIASVAGLKGEPPEVLDAVGY
                     SASKGGLIALTRDLAVKWGRWGIRVNALAPGFFPTRMTEKVLPKAEAYLRASLPLGRP
                     GQPGELGGAVLFLASPASDYVTGAVLPVDGGATAL"
     misc_feature    113370..114128
                     /locus_tag="TCCBUS3UF1_1010"
                     /note="gluconate 5-dehydrogenase; Provisional; Region:
                     PRK08213"
                     /db_xref="CDD:181295"
     misc_feature    113385..114125
                     /locus_tag="TCCBUS3UF1_1010"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(113418..113420,113424..113429,113433..113435,
                     113490..113498,113640..113648,113790..113798,
                     113847..113849,113859..113861,113937..113948)
                     /locus_tag="TCCBUS3UF1_1010"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(113712..113714,113796..113798,113847..113849,
                     113859..113861)
                     /locus_tag="TCCBUS3UF1_1010"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(114128..114643)
                     /locus_tag="TCCBUS3UF1_1020"
                     /db_xref="GeneID:12251457"
     CDS             complement(114128..114643)
                     /locus_tag="TCCBUS3UF1_1020"
                     /note="similar to Multi-sensor hybrid histidine kinase of
                     Meiothermus silvanus DSM 9946 UniRef RepID=D7BA51_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Multi-sensor hybrid histidine kinase"
                     /protein_id="YP_005653226.1"
                     /db_xref="GI:384438502"
                     /db_xref="GeneID:12251457"
                     /translation="MPTRALILAQGNQGIKIYKEADGYPEEVVPLLLAVTDLFREERG
                     FWDPERFMAQVLIGLGLKDRLSRGPGKGMAPPSPVFGYALTTGWRWVDYIYFVRDDYT
                     LEIYQPGEGWGEGIGLDEGEAWQKGCQRVAFACLEDKECRKFYKAWKTLLATPLRSGE
                     GEERQRKTLLH"
     gene            complement(114731..115474)
                     /locus_tag="TCCBUS3UF1_1030"
                     /db_xref="GeneID:12251458"
     CDS             complement(114731..115474)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="similar to ABC-type branched-chain amino acid
                     transport systems, ATPase component COG0410;
                     similar to ABC transporter related protein of Dethiobacter
                     alkaliphilus AHT 1 UniRef RepID=C0GDC0_9FIRM"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653227.1"
                     /db_xref="GI:384438503"
                     /db_xref="GeneID:12251458"
                     /translation="MLEVRGLSLLYGKAQILFGVDLEVREGELVCLVGPNGAGKTSFL
                     RAISGLVRLEARLHRGTKAGEIRLEGEVRFQGRRIDGLLPHQIARLGLVLCPERRRPF
                     RELTVEENLLAGGLLLPKGEVGRQLAFVYELFPRLRERRKQRAGDLSGGEQQMLAIGR
                     ALMARPKLLAVDEPSTGLAPKVRALVFEQIARVRREGVTVLLVEQEAARALALADRAY
                     LLSNGCLVRHGPAQSFLEDPQFQRAYLGL"
     misc_feature    complement(114734..115474)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(114764..115471)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(115352..115375)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(114860..114862,114956..114961,
                     115184..115186,115349..115357,115361..115366))
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(115184..115195)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(115004..115033)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(114956..114973)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(114938..114949)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(114854..114874)
                     /locus_tag="TCCBUS3UF1_1030"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(115461..116231)
                     /locus_tag="TCCBUS3UF1_1040"
                     /db_xref="GeneID:12251459"
     CDS             complement(115461..116231)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="similar to ABC-type branched-chain amino acid
                     transport systems, ATPase component COG0411;
                     similar to ABC transporter related of Bacteria UniRef
                     RepID=B8FBP2_DESAA"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653228.1"
                     /db_xref="GI:384438504"
                     /db_xref="GeneID:12251459"
                     /translation="MALLEARGLSKRFGGLQALYRVDLRVGEREIVGLIGPNGAGKTT
                     LLRLLLGIHRPDEGRVFFKGKDITPLPTWERVRLGLAATFQNPRPLKRLPVMANVLVA
                     AYGPRGGRMGDWVKRAEVRALDALEFVGIADKAKEPAAVLSQGELKRLEIARALATEP
                     ELLVLDEPFAGLTPAETELLAKSLSRLRKGGRFGRLHSEGCAMVIIEHKLSELFKIAD
                     RVVVLNFGEVLAEGPPGAVAQDPKVIEAYLGEGVHAGG"
     misc_feature    complement(115482..116231)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(115503..116222)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(116103..116126)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(115608..115610,115731..115736,
                     115977..115979,116100..116108,116112..116117))
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(115977..115988)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(115779..115808)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(115731..115748)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(115713..115724)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(115602..115622)
                     /locus_tag="TCCBUS3UF1_1040"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(116218..117879)
                     /locus_tag="TCCBUS3UF1_1050"
                     /db_xref="GeneID:12251460"
     CDS             complement(116218..117879)
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="similar to long-chain-fatty-acid--CoA ligase
                     PRK08314;
                     similar to AMP-dependent synthetase and ligase of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7AB64_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase and ligase"
                     /protein_id="YP_005653229.1"
                     /db_xref="GI:384438505"
                     /db_xref="GeneID:12251460"
                     /translation="MTETLYWERPWLRFYPPGTPEAVEPPEGHVGQRVEEAFRARGGE
                     VALFYYGRAYRYGELLEGIQRFASGLKALGLSPGDRVGLYLANSPQFALAYLGILWAG
                     GVVVPVSPLYTSHELRHQLQDSGARFLVVQDALWENASRAGVALEATIVVPLKEALPP
                     WQRLLVRSLPLPQGPGVYPWRDLFRAPPLPAPEPRQGEDLAALPYTGGTTGLPKGVEI
                     THGNILAAHRMIQSLNPFSRRSTILAFLPFYHIYGQVVLLLGGLLSGARLVVFSTPDP
                     DWILEAMVRYRATHFFGVPSLYEVLRDHPKAHWVDWGRLEVVVSGADTLHEATAEAFR
                     TRTGREIAEGYGMTETTSVSHINPRDRVKRGSFGIPLPGIRALVVDPDTLEPVPVGEV
                     GELALAGPNVTRGYWRREEENARSFFARGGLRFFRTGDLVRMDEEGYFHFYDRAKDMI
                     KYKGRPVFPREIEEALRAHPLVKAAGVVGVPDPKVGAYPKAYVVLEAEARGKVTEEDL
                     MAFLRERLAPYKLPREIEFRGELPKTDVGKVSRRELREEVQGGAP"
     misc_feature    complement(116224..117822)
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    complement(116245..117780)
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(117238..117243,117247..117264,
                     117271..117273))
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(116266..116268,116512..116514,
                     116545..116547,116554..116556,116590..116592,
                     116836..116853,116914..116919,117262..117264))
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(116323..116325,116512..116523,
                     116545..116547,116554..116556,116590..116592,
                     116836..116853,116914..116919,116980..116982,
                     116989..116994,116998..117000,117139..117144,
                     117262..117264))
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(116323..116325,116341..116343,
                     116515..116523,116917..116919,116980..116982,
                     116989..116994,117142..117144))
                     /locus_tag="TCCBUS3UF1_1050"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(117876..118949)
                     /locus_tag="TCCBUS3UF1_1070"
                     /db_xref="GeneID:12251461"
     CDS             complement(117876..118949)
                     /locus_tag="TCCBUS3UF1_1070"
                     /note="similar to leucine/isoleucine/valine transporter
                     permease subunit PRK11301;
                     similar to Inner-membrane translocator of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7AB65_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Inner-membrane translocator"
                     /protein_id="YP_005653230.1"
                     /db_xref="GI:384438506"
                     /db_xref="GeneID:12251461"
                     /translation="MTGPLRLWSLPWALLYLRHEVLALPGRTLALAFALFLLLFPLFS
                     QDPYWLRVLTLTAIFALYAASWDLLSGYTGQVSLGHAFFFGISGYASAILGRELGLPP
                     GLTIPLGALLATLAGVLVGLPSLRVRGPYLSLVTLAFPIIALGLIFLFPRFTGGELGL
                     SGLPRLGGSRLEEYYLVVLLFLASILVLWKLSGSRVGLLFHAIREDEMAVRMVGVNTV
                     RLKLLAFAVSAFFAGLAGGLHAHYLRVAGPDSLSLFNSIQPVIWTVFGGIATIYGPVA
                     GTFLLFPLLEVLRLAEELRTLAFALLVLLVMRFLPQGVVRGVLDRLEEECPRCKIRNA
                     FTRKRCRACGVELHLGRPKEVAR"
     misc_feature    complement(118005..118781)
                     /locus_tag="TCCBUS3UF1_1070"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(118272..118328)
                     /locus_tag="TCCBUS3UF1_1070"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(118946..119809)
                     /locus_tag="TCCBUS3UF1_1060"
                     /db_xref="GeneID:12251462"
     CDS             complement(118946..119809)
                     /locus_tag="TCCBUS3UF1_1060"
                     /note="similar to branched-chain amino acid transporter
                     permease subunit LivH PRK10740;
                     similar to Inner-membrane translocator of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7AB66_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Inner-membrane translocator"
                     /protein_id="YP_005653231.1"
                     /db_xref="GI:384438507"
                     /db_xref="GeneID:12251462"
                     /translation="MLAAILVNGLVLSGIYGMLALGFALTYGVARILNLAHTAFYMAA
                     AYALFFFLGLLGFAPAALLSALLVLGLALLAYWLLLEPLKEYEATVLIVTIVLALLLQ
                     EGILLLFGGHFRSVPALLPGFLEVLGVRVAQQALLALFFAGLVLLLAWALLKGTRLGL
                     GIRAAAQDQEAAELLGISLSRAGYWAVGLGALLAALAGLAVAPMATLEPHMWNAPLLV
                     VLAAVVLGGLGSLPGALLGAVILAFAEVLVVNLLPGGAFLRTAVALLILVLVLVLRPE
                     GLFGAAFAEER"
     misc_feature    complement(118973..119785)
                     /locus_tag="TCCBUS3UF1_1060"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:260432"
     misc_feature    complement(119246..119302)
                     /locus_tag="TCCBUS3UF1_1060"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119320"
     gene            complement(119810..121114)
                     /locus_tag="TCCBUS3UF1_1080"
                     /db_xref="GeneID:12251463"
     CDS             complement(119810..121114)
                     /locus_tag="TCCBUS3UF1_1080"
                     /note="similar to Putative branched-chain amino acid ABC
                     transporter (Substrate-binding protein) of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7AB67_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     (Substrate-binding protein)"
                     /protein_id="YP_005653232.1"
                     /db_xref="GI:384438508"
                     /db_xref="GeneID:12251463"
                     /translation="MAEMAHHRWLALLALALALAGPAAAQTLRIGILGPMAFVQGEHT
                     WHGATLAAEELNRAGGIAVGNQRYRIELVRVDTNEMTSVTDAATAVERAITAQRVDFL
                     VGGFRSEAVLAMTEVAADYRKVYLITGAALDGILAGRVDRNYDRFKYLFRVSPTKSSD
                     LARTSLLLLGEVIQAVRRDLRVERPKVAILAERAAWADPLVETASRLIAAPAPQGYAS
                     EVVGTWRPSATATDVTPELTAIQRAGAQVIFTVLSGPVGVPFGRDWGRLKIPAAPVGI
                     NVEAQQETWLKATDNLGAYVATLNTLAPSVAITPKTIPFIANFQARFRQFPIYTASGA
                     YAALYILADALQRAGTTAADAVVRALEATDYVGPSGRLVFDRTHDVTWGPGYTTGLGV
                     QWIEGRMQAFWPRQWRVGNQVVSYAGVRPYQLPPWVVEAWRR"
     misc_feature    complement(119957..121030)
                     /locus_tag="TCCBUS3UF1_1080"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    complement(119990..120976)
                     /locus_tag="TCCBUS3UF1_1080"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     gene            121238..121855
                     /locus_tag="TCCBUS3UF1_1090"
                     /db_xref="GeneID:12251464"
     CDS             121238..121855
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="similar to 2-dehydro-3-deoxy-6-phosphogalactonate
                     aldolase PRK09140;
                     similar to 4-hydroxy-2-oxoglutarate
                     aldolase/2-deydro-3-deoxyphosphogluconate aldolase of
                     Thermus thermophilus UniRef RepID=Q53W90_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-ketovalerate aldolase"
                     /protein_id="YP_005653233.1"
                     /db_xref="GI:384438509"
                     /db_xref="GeneID:12251464"
                     /translation="MLDPVEALARFRLLPLLTLRGGEDLEALGQALLEEGLPLLEVTL
                     RTPEGLQALPRLAAQGLVVGAGTVRSQDQAAKALAAGAAFLVSPALVEEVAHLAQERQ
                     VPYFPGVLTPGEVERALGLGLRDLKFFPAKAFHAPQVLRAYAEVFPEARFIPTGGLRE
                     EDLPQYAPLPNLLACGGSWLLEGSPAEVRRRLRAAKALLTPQAPG"
     misc_feature    121253..121831
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="Entner-Doudoroff aldolase; Region: eda; TIGR01182"
                     /db_xref="CDD:162241"
     misc_feature    121259..121780
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="KDPG and KHG aldolase; Region: KDPG_aldolase;
                     cd00452"
                     /db_xref="CDD:188632"
     misc_feature    order(121283..121285,121358..121360,121370..121372,
                     121436..121438,121616..121618,121622..121624,
                     121700..121702)
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="active site"
                     /db_xref="CDD:188632"
     misc_feature    order(121370..121372,121436..121438,121442..121444,
                     121499..121510,121568..121579,121583..121585,
                     121595..121597,121622..121627,121661..121663,
                     121673..121678)
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188632"
     misc_feature    121616..121618
                     /locus_tag="TCCBUS3UF1_1090"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188632"
     gene            complement(121833..122609)
                     /locus_tag="TCCBUS3UF1_1100"
                     /db_xref="GeneID:12251465"
     CDS             complement(121833..122609)
                     /locus_tag="TCCBUS3UF1_1100"
                     /note="similar to Transcriptional regulator COG1414;
                     similar to Transcriptional regulator of Thermus
                     thermophilus HB8 UniRef RepID=Q53W89_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_005653234.1"
                     /db_xref="GI:384438510"
                     /db_xref="GeneID:12251465"
                     /translation="MARLPRHETETAEASGTQTLLRGLQLLEKVAEGVHDLQGLAQAL
                     GLSRSTAYRILASLARAGYLRHEPRKGYWLGPKLIRLGFKAYGQLHLPTLARPHLEAL
                     RDATQETVHLGILEGQEVVYIDKVPGRRELQLASQIGARFPAQSTALGKALLAWSPPE
                     RWRQAFVPGLRRTAKTLGDWPAFAAELEATRARGYAVDLEENEPGVRCVAAPILNGQG
                     EPVAAVSVSTAALYLDEARIPEVARLVQEAARRISRELGG"
     misc_feature    complement(121836..122558)
                     /locus_tag="TCCBUS3UF1_1100"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(122298..122558)
                     /locus_tag="TCCBUS3UF1_1100"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(121845..122204)
                     /locus_tag="TCCBUS3UF1_1100"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            122707..123669
                     /locus_tag="TCCBUS3UF1_1110"
                     /db_xref="GeneID:12251466"
     CDS             122707..123669
                     /locus_tag="TCCBUS3UF1_1110"
                     /note="similar to TRAP-type C4-dicarboxylate transport
                     system, periplasmic component COG1638;
                     similar to ABC transporter, periplasmic substrate-binding
                     protein, putative of Thermus thermophilus HB27 UniRef
                     RepID=Q746M2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_005653235.1"
                     /db_xref="GI:384438511"
                     /db_xref="GeneID:12251466"
                     /translation="MKRWWAVVSALALGVGLAQTYTLRYNHVLGPNHPYHAGLQAWAE
                     RVAQRTNGDLRILVFHSAQLGIEEDIIEQLRQGVPLGQNTDGARLGNYVRELGVFNGP
                     YFVDDYAAVERLARLPVVQGWVERLAQQYGIRVLCFNWVQGYRHFMTNRPVRRPEDLR
                     GLRIRTPPAPVWQESVRALGATPVALPFGEIYSALQQRAIDGVELVYANVPDMSLWEV
                     LRYINETKHFLLINFQIVGEAWYQRLPANYRQILREECARAGRETSQRIAAEEERIKQ
                     LAQQRGMTIVSDVDLAAFRRAAEAAYQRLGLRTVRDALYQALKR"
     misc_feature    122707..123564
                     /locus_tag="TCCBUS3UF1_1110"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            123707..124168
                     /locus_tag="TCCBUS3UF1_1120"
                     /db_xref="GeneID:12251467"
     CDS             123707..124168
                     /locus_tag="TCCBUS3UF1_1120"
                     /note="similar to TRAP-type C4-dicarboxylate transport
                     system, small permease component COG3090;
                     similar to Tripartite ATP-independent periplasmic
                     transporter DctQ component of Thermaceae UniRef
                     RepID=D3PMY2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="tripartite AtP-independent periplasmic
                     transporter subunit DctQ"
                     /protein_id="YP_005653236.1"
                     /db_xref="GI:384438512"
                     /db_xref="GeneID:12251467"
                     /translation="MKGLLNTLHRVEEALAKGFLLTSTLVVFLGGVGRFLGHPLDWSM
                     DLATFCFAWAVFLGGDLALKAERHVAVENLVRLLPPGGRRWILALVWGAVALFLLVLL
                     VYSLQAAYQTRFRSFQGIPGFSYSWVTLSVALGSLLMFLTALGKLRAAFSR"
     misc_feature    123707..124159
                     /locus_tag="TCCBUS3UF1_1120"
                     /note="Tripartite ATP-independent periplasmic
                     transporters, DctQ component; Region: DctQ; cl01181"
                     /db_xref="CDD:260823"
     gene            124172..125446
                     /locus_tag="TCCBUS3UF1_1130"
                     /db_xref="GeneID:12251468"
     CDS             124172..125446
                     /locus_tag="TCCBUS3UF1_1130"
                     /note="similar to TRAP dicarboxylate transporter, DctM
                     subunit of Meiothermus ruber DSM 1279 UniRef
                     RepID=D3PMY3_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP dicarboxylate transporter subunit DctM"
                     /protein_id="YP_005653237.1"
                     /db_xref="GI:384438513"
                     /db_xref="GeneID:12251468"
                     /translation="MLLSFAVFLLLLLLGMPVVFAIGIGGLVFFLTQPGLQLTMPVQL
                     ALAETQNFSLLAIPTFILASNLMNELGVTRRLLQFAYVLTGFLRGGLAQVSVLMGFLM
                     GGVSGSAIADATMQARLLGPEMVRKGYPRGFIAALQGFSGLLAVAIPPSIGLILYGSI
                     GQVSIGQLFAGGIGVGVLMALSYMLTVAFLARRQGYAPEASAPPKAREVWQALRQSFW
                     AVLFPFLLLASLRFGVFVPSEVGAAAVVYALFVGLVYRELSLERLGRALSHSVRDVGM
                     VALLISMAAVLGYGMKWEMVPQQVSGFLLEAIQNPQVALLLILITLLLLGTVLDSTVM
                     IILLTPILVPAAKALGIDLVYFGVLMVLTCAVGLLTPPVGLSMYSVCSVMGCGIGEYV
                     REGWPLFLATLWVLLLAYLFPGVVLFLPRLLF"
     misc_feature    124214..125431
                     /locus_tag="TCCBUS3UF1_1130"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; cl17274"
                     /db_xref="CDD:266603"
     misc_feature    124214..125416
                     /locus_tag="TCCBUS3UF1_1130"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            125459..126163
                     /locus_tag="TCCBUS3UF1_1140"
                     /db_xref="GeneID:12251469"
     CDS             125459..126163
                     /locus_tag="TCCBUS3UF1_1140"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK12826;
                     similar to UPI0001DBA10A related cluster of unknown UniRef
                     RepID=UPI0001DBA10A"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653238.1"
                     /db_xref="GI:384438514"
                     /db_xref="GeneID:12251469"
                     /translation="MRLKGKRALVIAAGQGIGRAIALAFRDEGAEVLGATLHPEKLEG
                     VVPAVRLDARDKGALQALIGGMAHLDVLVNAQGVVPVGGVLEATDEAWEEAFRLNAQS
                     VFWAMQAALPKMAAQGGGSIINIASVAAFKAVPQRFVYSATKAAVVAMTRAAALEFAP
                     QGVRVNAICPGTVDTPSLRERAGGEEGLKAFAERQLLKRLGRPEEIAALAVYLASDEG
                     AFATGGAFVVDGGMSL"
     misc_feature    125459..126160
                     /locus_tag="TCCBUS3UF1_1140"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    125468..126160
                     /locus_tag="TCCBUS3UF1_1140"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(125492..125494,125498..125503,125507..125509,
                     125564..125572,125681..125689,125831..125839,
                     125876..125878,125888..125890,125966..125977)
                     /locus_tag="TCCBUS3UF1_1140"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(125753..125755,125837..125839,125876..125878,
                     125888..125890)
                     /locus_tag="TCCBUS3UF1_1140"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            126160..127200
                     /locus_tag="TCCBUS3UF1_1150"
                     /db_xref="GeneID:12251470"
     CDS             126160..127200
                     /locus_tag="TCCBUS3UF1_1150"
                     /note="similar to Malate/L-lactate dehydrogenases COG2055;
                     similar to Dehydrogenase of Bacteria UniRef
                     RepID=Q746L8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005653239.1"
                     /db_xref="GI:384438515"
                     /db_xref="GeneID:12251470"
                     /translation="MRLNAQALDRFAQGVLRAAGADEASAAATAQVLLDADLKGIHSH
                     GLVRLPIYVRRLEAGLANPRPVPRPLREEGPLVLLDGDQGLGPRVGLLAVELARERAR
                     AHGVGGVGVQRSTHFGAAGFYAEALAREGLLGLVLSNVEPDVVPYGGRRATLGTNPLA
                     FAAPAPQGVLLVDLATSQVAMGKVFLARARGEAIPPDWGVDEEGRPTRDPHRVRALLP
                     LGGPKGYALALMVEVLAGVLTGAGIAHGVGRMYDEWDRPQNVGHFFLALDPERLVGQE
                     AFRERMGLLWQAIKATPPAPGFPEVLLPGEREARLRAERLATGVPLEEATVRSLKELG
                     ARYGLALEVEGA"
     misc_feature    126160..127185
                     /locus_tag="TCCBUS3UF1_1150"
                     /note="Malate/L-lactate dehydrogenases [Energy production
                     and conversion]; Region: COG2055"
                     /db_xref="CDD:224966"
     gene            127193..128128
                     /locus_tag="TCCBUS3UF1_1160"
                     /db_xref="GeneID:12251471"
     CDS             127193..128128
                     /locus_tag="TCCBUS3UF1_1160"
                     /note="similar to 2-keto-3-deoxy-gluconate kinase of
                     Thermus thermophilus UniRef RepID=Q746L7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate kinase"
                     /protein_id="YP_005653240.1"
                     /db_xref="GI:384438516"
                     /db_xref="GeneID:12251471"
                     /translation="MPEVVAAGEAMALLLAPQPGYLRHQTYLELRIGGAEANTAIALA
                     RLGFSVAFATWLGRDELGEVVLSRLRAEGVEVWANRVEAPTGLYLRERLPGGRGRVHY
                     RRAGSAASRMGPGAFDPGGLEGAKVFHLTGITPALSESARAFALWALREAKERGVRVS
                     LDVNHRRKLWSAEAARGFLEEALPLVDLLFLSEEDARLWSTEPQDLLPALAARGPKEV
                     VLKRGRKGALALVGGSPVAAEAFPVEELDPVGAGDAFNAGYLAGLLWGKPPEERLRLG
                     CALGALAVTVMGDYEGAPSPEELLAFLGQEHTMDR"
     misc_feature    127199..128059
                     /locus_tag="TCCBUS3UF1_1160"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    order(127292..127297,127304..127306,127454..127456,
                     127496..127498,127502..127504,127589..127591,
                     127688..127690,127940..127942,127949..127951,
                     128057..128059)
                     /locus_tag="TCCBUS3UF1_1160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    order(127853..127855,127868..127870,127913..127915,
                     127940..127948,127955..127957,128021..128023,
                     128033..128035)
                     /locus_tag="TCCBUS3UF1_1160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            128154..128867
                     /locus_tag="TCCBUS3UF1_1170"
                     /db_xref="GeneID:12251472"
     CDS             128154..128867
                     /locus_tag="TCCBUS3UF1_1170"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK05653;
                     similar to 2-deoxy-D-gluconate 3-dehydrogenase of Thermus
                     thermophilus UniRef RepID=Q53W82_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="2-deoxy-D-gluconate 3-dehydrogenase"
                     /protein_id="YP_005653241.1"
                     /db_xref="GI:384438517"
                     /db_xref="GeneID:12251472"
                     /translation="MTGGSRGIGLALVQELLAKGFKVGVASRHPETAVADLTRQGLAA
                     FAVPIDLEHEPPEKAVAQAVAQGGLHVLVHAAGINVRKPALELGYEEWRRVLYLHLDV
                     AFLLAKAAAPHMAQAGWGRILFLGSATTFTSGGPVPIPAYTTAKTALLGLTRALAKEW
                     APLGIRVNLLCPGYVKTEFTAPVWGNPELYNPITARIPLGRWASPEEIAKVGAFLCTD
                     EAGYLTGQAVVVDGGFLAY"
     misc_feature    128157..128861
                     /locus_tag="TCCBUS3UF1_1170"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    128157..128846
                     /locus_tag="TCCBUS3UF1_1170"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(128160..128162,128166..128177,128232..128240,
                     128298..128306,128376..128384,128445..128447,
                     128526..128534,128577..128579,128589..128591,
                     128667..128678,128682..128687)
                     /locus_tag="TCCBUS3UF1_1170"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(128448..128450,128532..128534,128577..128579,
                     128589..128591)
                     /locus_tag="TCCBUS3UF1_1170"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(128861..129229)
                     /locus_tag="TCCBUS3UF1_1180"
                     /db_xref="GeneID:12251473"
     CDS             complement(128861..129229)
                     /locus_tag="TCCBUS3UF1_1180"
                     /note="similar to Uncharacterized protein conserved in
                     bacteria COG3333;
                     similar to Uncharacterized protein conserved in bacteria
                     of Bacteria UniRef RepID=Q2SLH8_HAHCH"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653242.1"
                     /db_xref="GI:384438518"
                     /db_xref="GeneID:12251473"
                     /translation="MVLFVQVLRVPAYYLLPSILAISFVGVYAVNHNPFDLLLMTAFG
                     FLGYLLRKLEVPLPPILLGLVLGYLMEINLRRALILGAGDPGYLFGSPTALAFWGLSA
                     LVLLLSLVWAKGRPGGGEGQ"
     misc_feature    complement(128936..>129223)
                     /locus_tag="TCCBUS3UF1_1180"
                     /note="Tripartite tricarboxylate transporter TctA family;
                     Region: TctA; cl00772"
                     /db_xref="CDD:260613"
     gene            complement(129258..130349)
                     /locus_tag="TCCBUS3UF1_1190"
                     /db_xref="GeneID:12251474"
     CDS             complement(129258..130349)
                     /locus_tag="TCCBUS3UF1_1190"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653243.1"
                     /db_xref="GI:384438519"
                     /db_xref="GeneID:12251474"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     misc_feature    complement(129480..>129920)
                     /locus_tag="TCCBUS3UF1_1190"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(130743..131708)
                     /locus_tag="TCCBUS3UF1_1200"
                     /db_xref="GeneID:12251475"
     CDS             complement(130743..131708)
                     /locus_tag="TCCBUS3UF1_1200"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653244.1"
                     /db_xref="GI:384438520"
                     /db_xref="GeneID:12251475"
                     /translation="MKRGAWQVYEEVLRAAQGLGLEGEEGEVVQGLLALPREAFRTFA
                     QGLGLKPKYLRHDLLPVAFLPEPLREALRAGLPLWHAHRLNRLLRAGRLALEDLQGRP
                     PEALKALPREEGGVDLGAPVWLYPEDPRPEALAPGVARALVALYSLPGELVVDPMAGY
                     GTVVEEALGLGRRAWGGDTCPKGPRVERADIRDLPRRFQGEAALLVLHPPTFASWLKE
                     EGEKAPPEERYAAYVEYLQGLLDYALPALRPGGRLVLVVRPRHALSPREWAMGRDFFL
                     SPFERALAEVSPRLRPFHYHLAVRRDGGEAWHLFVAEVGDGGLGG"
     misc_feature    complement(131181..>131324)
                     /locus_tag="TCCBUS3UF1_1200"
                     /note="DNA methylase; Region: N6_N4_Mtase; cl17433"
                     /db_xref="CDD:266681"
     gene            131829..133199
                     /locus_tag="TCCBUS3UF1_1210"
                     /db_xref="GeneID:12251476"
     CDS             131829..133199
                     /locus_tag="TCCBUS3UF1_1210"
                     /note="similar to Putative uncharacterized protein TTHB126
                     of Thermus UniRef RepID=Q53W40_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653245.1"
                     /db_xref="GI:384438521"
                     /db_xref="GeneID:12251476"
                     /translation="MAAHRTSSKEALARPKHFDEANVARLGLISIQERIPEGYSSWEE
                     EFEFLGKPVKLACYASEKVGGVPHGLDNEVSLALIALYFNAGSPEDGTFTATPYQILK
                     LMGLDTSGYYYQALKESLMRLTTATYVLSEAWRADGRWQSVTFRYIEKLEYTSSAEGK
                     LDRASVLRITLAKEIVRSLKQNYVKPIDIEFMASLKRPLSRALYRLLDAQRFSPENPS
                     PLPRFEVNLMEWAAACKIVHKRPDKVRRTLEPAHEELIARRYLQSVEYIGRGQQQTIV
                     YVFGEEAGGVADMEAVDLLMAEGLSFTSAYSLARRYSLAHIKDRLERFRSILASGYKP
                     KNRLGFLVDVIRDEEGKYRRALPPAQGRRAQAHREEEEARRIEEEAEREWQRMPKEAQ
                     VRRALQVAQLVLRSRISVGELEELARLMEAGQLEPRAVVEELKAAASGGRLEEWLQTF
                     RQGLAE"
     misc_feature    131880..132590
                     /locus_tag="TCCBUS3UF1_1210"
                     /note="Replication initiator protein A; Region: RPA;
                     cl19398"
                     /db_xref="CDD:267751"
     gene            133753..138729
                     /locus_tag="TCCBUS3UF1_1220"
                     /db_xref="GeneID:12251477"
     CDS             133753..138729
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="similar to Superfamily II DNA helicase COG0514;
                     similar to Putative uncharacterized protein of Thermus
                     thermophilus UniRef RepID=Q746C7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653246.1"
                     /db_xref="GI:384438522"
                     /db_xref="GeneID:12251477"
                     /translation="MEQALAADRVWVALDLEATSSRPEEAEILEVAAVDTLGRTFRRY
                     LVTQNPLGPDHEAFRLTGIPYGEYQANKVLPGQALVELLEFLGARPLVGHNLLRYDLP
                     LLGRYLKDLDLSLPARSVLDTLRLAHLLFPVPPPGLEGYRLGDLYRFFTGHELQGAHR
                     ALEDARANLQVLDHLMAWGKEHLATHPGLVRAWRELGLREAALFPEVPGLVKDLLARA
                     ADVREFFVEAEGKPLPSLDNLGPDLLPTRREAQQRMFHLVAAALDQGIPLLLQAPTGT
                     GKTKGYLYPALGREGVTWVATHTKVLQAQVLDELREVAQRGYRVRAALVKSARDALCP
                     DRLLEAFLEERKAGSEEARLAVGVLLHYAALGFHDLEALPAYWHFQEGFRAVRARVGT
                     NPIRCREACPFFAYCAFQRMEAKRKRATLLVTNQAYLLQHFLEAGTGPTLEATPSLVV
                     DEAHHLEEVATEALTEQVDGEGLRHLLERLADQDRGRGLLLNEEYLRPLGEEARAKAK
                     ELAAEGVPRAAGVLEAYGNRLEAFLKQWGRGSPEYGLYLPLDRTWPRHEAYPLLRREE
                     QALIRVLAYLLEKVQELRDLAPRSLLALELDSILREFRIYLDLLREREEALEKGGDDS
                     SLYVSRLDPVTGTWAHLKEPVEVAPQLERGLWPKFRGVVLTSATLRVPTEKDPEGFSF
                     LQRILGLPEKAKKEALPPSLPYEKATLLVPHHLPEARESTLPRFQRLLHQELRLILQA
                     VPRTLTLFTSLRRLEEARRALEDLPHLRAPLTRREREDTLRLARANPEAPLAALGSRS
                     FMEGVDIPHLKLVNLERIPFPYPSPLVRKRMERAYEYGLDGWEDYYLPKAVLAFVQAF
                     GRLVRDDRKRAGRGAFVLWDKKLLHASYQEPFYRALPEGVGRLFPGTREAFYRALGEA
                     LDLPLPVPAEEFPEAPWAQVQAILRNPLLSNLEKGRRVAKEVYRLVLAEDRWAKQAEA
                     IQAALEGHHLLALLPTGFGKSLAFQIPAWLQEGLTLVVSPLVALMKDQADRLAELGLP
                     ALALHGLMSGGEQRGVLDEVRQGRVHLLYVAPERINRSSELQKLLKEFRAAGRLARVV
                     FDEAHCLLEWGFDFRPDYLRALEWLKGLALPMSFFTATLTPEERVRLKQVAGLREVVE
                     VLPDTFHRENLRFVVRQARGEVDKFAHLAQALLWVQKEGGSAIVYATSRAETERLAWA
                     LGKLFPGLGVEAYHAGLGPHIRREVQERFTQGVSRVVVATTAFGMGVDKADVRLVAHW
                     RPPLSLEEYIQQAGRAGRDGKEAYAFLLYTVGDWNFLRWMAGLSRRSSWEVYAEALLK
                     RLETGAFRGYKKDLLQSLRQQLGESVAEEVGVGEEEDEPEGIEGPAPLGSEELDLLLA
                     GLERAGVLRFQYLPGRASLLLFPEELDRLRRREPGLSSLLERAVFRGSPRQGEVFLDM
                     SRLPLEQAEELDNGLYRAYREGWLRLYHYREPLLLVERSPTAQGQNLDAWRQDREKAV
                     RLAQERLDAVREYATRSRCRAGVLLAHINGERRRCGTCDTCSGDLGPWEGLETFQSEE
                     LLRAYKPLDTLLAFFRWVEEHYLQNPYLGRQATLMALRGKDRTKDGLLSPRYRDNALF
                     GHLSFLKPKQLERAFEEALRLGYLEKKAVWQGRDLFGLTEAGRKRLRR"
     misc_feature    133783..>134313
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="DNA polymerase III, epsilon subunit and related
                     3'-5' exonucleases [DNA replication, recombination, and
                     repair]; Region: DnaQ; COG0847"
                     /db_xref="CDD:223916"
     misc_feature    133786..134268
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    order(133795..133806,133810..133812,134032..134037,
                     134044..134052,134227..134229,134242..134244)
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    order(133795..133806,133810..133812,134032..134037,
                     134044..134049,134227..134229,134242..134244)
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    order(133795..133797,133801..133803,134050..134052,
                     134227..134229,134242..134244)
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     misc_feature    134479..136434
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="Rad3-related DNA helicases [Transcription / DNA
                     replication, recombination, and repair]; Region: DinG;
                     COG1199"
                     /db_xref="CDD:224120"
     misc_feature    134554..>134715
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    134575..134589
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    135952..136437
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="Helicase C-terminal domain; Region: Helicase_C_2;
                     pfam13307"
                     /db_xref="CDD:257644"
     misc_feature    136657..137232
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    136690..137133
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    136717..136731
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    137020..137031
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    137251..137622
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(137329..137340,137404..137409,137482..137490)
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(137506..137508,137569..137571,137581..137583,
                     137590..137592)
                     /locus_tag="TCCBUS3UF1_1220"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            138732..139601
                     /locus_tag="TCCBUS3UF1_1230"
                     /db_xref="GeneID:12251478"
     CDS             138732..139601
                     /locus_tag="TCCBUS3UF1_1230"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653247.1"
                     /db_xref="GI:384438523"
                     /db_xref="GeneID:12251478"
                     /translation="MKEKGERTPPTFRVPSLGELPERSGGCRPEDLPRPVFTPTPEGD
                     LPLLGEGSQQEDSENPKEERQVWRLKQRLQKKHAELEDLRRRLARLEREWQVALRAKG
                     KAEMEASRLRKDYAALEEELAQLRKQWEEAQAQLNLLLPLREENKTLREEVVRLGEKV
                     ASLQKEAKRGEAWARAQAFQEALPAPFPLEVFSRVLFLDYGALGTTPEERLLALAEGY
                     KALLAGHDHPALQASTRELIQGDPEGIALVGLERLLLDLANSPLPRWLRTHAWLLEAR
                     LRGGGLHSPREEG"
     misc_feature    139014..>139403
                     /locus_tag="TCCBUS3UF1_1230"
                     /note="Phage capsid family; Region: Phage_capsid; cl19393"
                     /db_xref="CDD:267746"
     misc_feature    <139068..>139184
                     /locus_tag="TCCBUS3UF1_1230"
                     /note="rod shape-determining protein MreC; Region: MreC;
                     cl19252"
                     /db_xref="CDD:267605"
     gene            139598..140110
                     /locus_tag="TCCBUS3UF1_1240"
                     /db_xref="GeneID:12251479"
     CDS             139598..140110
                     /locus_tag="TCCBUS3UF1_1240"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653248.1"
                     /db_xref="GI:384438524"
                     /db_xref="GeneID:12251479"
                     /translation="MTPEERQTLEARFREDLAWYERELEACWKRLAEERTAWQETKRG
                     LLEEISRCSHRIRALEAKGREREKEVEALKRRLEALNRPALGEGWLAALREELGHWDQ
                     MLVEKVGAVRAGNLEEALEELLGMRLEALRRHLQGQQPDFKALYTALVLEWALWAWLE
                     GEWQTLGDTP"
     gene            140083..141612
                     /locus_tag="TCCBUS3UF1_1250"
                     /db_xref="GeneID:12251480"
     CDS             140083..141612
                     /locus_tag="TCCBUS3UF1_1250"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653249.1"
                     /db_xref="GI:384438525"
                     /db_xref="GeneID:12251480"
                     /translation="MADPWRHAVNLYRAVEEGLRLGDLRRAPVRYEDYLGVKETVRKL
                     WLGEWRPGLHKPTKDGVVPAYLLLGFLAGYFFYRNLPENDLAFWPDFLKALGVDQQEP
                     TPAQRDLLWRVLSGVPLVQRHLRFHADGSRDFVGTLDALFGFRALRLRDLLAHLRRYR
                     EEGVLAGELGAYGEILSTLKEALDRLVQEGLAEEELDDLEGLVARLESLGFFPPDPHP
                     LRFLFHRSQEALRSLYREWRGEKNEATRYSKVRVELLQGKGLVERVVPQMRPEPLLEG
                     MKVYGQVRFRDGTFQGFTWTPRLDEKGLPIPEEKRLVHQEGEVVFRLHHRAWGVRFLD
                     SSGNPVPFWRYPEPFRVESFHFDPAKNPLAFSLESGGAPVEDPRGISLDQALLEDILL
                     VEVLVSGKREHGEWRLLGRLPVRFHPLLTPRLTEEALELGLSPPGELEVELLPSQAPP
                     QRARGSVRIPRGRLPFRVRVRAFGQVWEYQVPPRGWPAAFYRAGMAFGNPGPLRPEGP
                     V"
     gene            complement(141670..142005)
                     /locus_tag="TCCBUS3UF1_1260"
                     /db_xref="GeneID:12251481"
     CDS             complement(141670..142005)
                     /locus_tag="TCCBUS3UF1_1260"
                     /note="similar to hypothetical protein PRK02877;
                     similar to UPF0145 protein Daci_3728 of Bacteria UniRef
                     RepID=Y3728_DELAS"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653250.1"
                     /db_xref="GI:384438526"
                     /db_xref="GeneID:12251481"
                     /translation="MGPGMILTTTGTVEGKRVEAYLGVVFGEAIVGANIFRDLFASIR
                     DIVGGRSGAYEAELRRAREMALSELAEAARQLGANAVIGIDVDYEVLGQGNSMLMVTA
                     SGTAVRLAP"
     misc_feature    complement(141679..141993)
                     /locus_tag="TCCBUS3UF1_1260"
                     /note="Putative heavy-metal-binding; Region: YbjQ_1;
                     cl00426"
                     /db_xref="CDD:260416"
     gene            complement(142056..144284)
                     /locus_tag="TCCBUS3UF1_1270"
                     /db_xref="GeneID:12251482"
     CDS             complement(142056..144284)
                     /locus_tag="TCCBUS3UF1_1270"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653251.1"
                     /db_xref="GI:384438527"
                     /db_xref="GeneID:12251482"
                     /translation="MELFDRFAPALILMDEWVAYLRNLHGEDLPAGTFDQNLTFAQAL
                     TEAAKRSRRTLLVASLPASDAEVGGERGREALFRLQNVFGRLESVWQPATQDESYEIV
                     RRRLFLPLSEEGYRARDAVVQAFMRLYREHKGEFPPETLEPDYERRLKLAYPIHPELF
                     DRLYGDWSTLEGFQRTRGVLRFMAAVVYALWSRGDTSLMILPGGLPLDPGGPRYELTR
                     HLSRFLEGFDGVLDADVDGVNARALVLDNERLALGRQQMARRTARAVFMATAPGAAAP
                     VGRPRGVEGVRVRLGVVQPGESPALVADALRALADHLTYFHAEGDRYWFETRPSLNRL
                     AQERATRLDPEEARREIAGRLKGWARGRTPFAALHAAPESTADVPDEPALRLVLLPPT
                     APYAKGGSEGERRAREILETRRQAPRLYRNTLLFLAAEASLVPDLEEATRRYLAWKGI
                     WEDREALNLGQADLRQVEARLKEAGDTLEARLKEAYRILLSFTQPDSQNPHLEPTAIR
                     LLGSGDPAERAAAKAKHEALVYTEWHPRFLLETLERYRFFTSREPQGVLPLRWLWEAL
                     CTYPYLPKLQGEEVLLESVKRGVEEGLFGYATHLQEGKPKGVFLGERVTPSLQGFLLR
                     REVAEATQGEEAKVAVDGPTPPGGGALPPTPEKTPVAAPKPRPKRFYLRKELAPHSLV
                     QEAELLAKEIVLHLAKEPGVRLKLHLEVQAEAEGGFSEDLARVLRENSATLKADHSLE
                     EA"
     misc_feature    complement(142833..>144281)
                     /locus_tag="TCCBUS3UF1_1270"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1483"
                     /db_xref="CDD:224400"
     gene            144867..146087
                     /locus_tag="TCCBUS3UF1_1280"
                     /db_xref="GeneID:12251483"
     CDS             144867..146087
                     /locus_tag="TCCBUS3UF1_1280"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653252.1"
                     /db_xref="GI:384438528"
                     /db_xref="GeneID:12251483"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    144906..146054
                     /locus_tag="TCCBUS3UF1_1280"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    144942..145991
                     /locus_tag="TCCBUS3UF1_1280"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            complement(146394..147461)
                     /locus_tag="TCCBUS3UF1_1290"
                     /db_xref="GeneID:12251484"
     CDS             complement(146394..147461)
                     /locus_tag="TCCBUS3UF1_1290"
                     /note="similar to Predicted ATPase (AAA+ superfamily)
                     COG1483;
                     similar to Putative uncharacterized protein of
                     Thermobaculum terrenum ATCC BAA-798 UniRef
                     RepID=D1CH26_THET1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653253.1"
                     /db_xref="GI:384438529"
                     /db_xref="GeneID:12251484"
                     /translation="MLARPRRFGLYAWDMALSNREIVGRGLDLLRAGLAPFVEREYQR
                     VYGEAWAEEALEVLKDRASLQDPDGQALLKLMDFRWNEVFDEKLGRWGRTLVKELLEV
                     RNRFAHQNPFSLEDAHRALDTITRLLEMVAAEERAETNRMARELLRRRFEEEARREAE
                     KAAKLPQAPTPSGLKPWREVVTPHADVASGRFTEAEFAADLAEVLQGEASPEYGDPLE
                     FFRRTHFTGGLRQLLLNALRRLSGEGGDPVVELQTAFGGGKTHSMLALYHLFGGRVDP
                     HEVPGLEEVLKEAGLARVPTARRAVLVGTALDPARPRPKPEGLLVHTLWGRWPTSSGG
                     WRGTGWWRRGTGGAWPWDRTP"
     misc_feature    complement(<146484..146924)
                     /locus_tag="TCCBUS3UF1_1290"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1483"
                     /db_xref="CDD:224400"
     gene            complement(147465..147848)
                     /locus_tag="TCCBUS3UF1_1300"
                     /db_xref="GeneID:12251485"
     CDS             complement(147465..147848)
                     /locus_tag="TCCBUS3UF1_1300"
                     /note="similar to Predicted nuclease of the RNAse H fold,
                     HicB family COG1598;
                     similar to Putative uncharacterized protein of
                     Cyanobacteria UniRef RepID=B7KLX8_CYAP7"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653254.1"
                     /db_xref="GI:384438530"
                     /db_xref="GeneID:12251485"
                     /translation="MLLVPEPEGGFTALLPDLEGCVSVGETEEEALANLEEARQLWIE
                     TAYEHGDEIPLPSSAKEYSGRILVRMPKSLHRRLDEEARAEGVSLNQFIVSLLSERLP
                     LAVLKRELRVLKEEASPKNSMRART"
     misc_feature    complement(147672..147836)
                     /locus_tag="TCCBUS3UF1_1300"
                     /note="Predicted nuclease of the RNAse H fold, HicB family
                     [General    function prediction only]; Region: COG1598"
                     /db_xref="CDD:224514"
     misc_feature    complement(147558..147710)
                     /locus_tag="TCCBUS3UF1_1300"
                     /note="HicB family; Region: HicB; pfam05534"
                     /db_xref="CDD:114265"
     gene            complement(147908..148177)
                     /locus_tag="TCCBUS3UF1_1310"
                     /db_xref="GeneID:12251486"
     CDS             complement(147908..148177)
                     /locus_tag="TCCBUS3UF1_1310"
                     /note="similar to Putative uncharacterized protein of
                     Cyanobacteria UniRef RepID=B2J5R2_NOSP7"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653255.1"
                     /db_xref="GI:384438531"
                     /db_xref="GeneID:12251486"
                     /translation="MGKKRKLLEKLFALPPEMRYEDVEKVLVAFGFECVRSKGSHQQF
                     RHPGGRMLTVPKRKGQTVTRTYLKQVIAALECVTGKTLEELIEEE"
     misc_feature    complement(147965..148120)
                     /locus_tag="TCCBUS3UF1_1310"
                     /note="YcfA-like protein; Region: YcfA; pfam07927"
                     /db_xref="CDD:254521"
     gene            complement(148238..151168)
                     /locus_tag="TCCBUS3UF1_1320"
                     /db_xref="GeneID:12251487"
     CDS             complement(148238..151168)
                     /locus_tag="TCCBUS3UF1_1320"
                     /note="similar to Adenine-specific DNA methylase
                     containing a Zn-ribbon COG1743;
                     similar to Putative uncharacterized protein of Arthrospira
                     UniRef RepID=B5VWV3_SPIMA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653256.1"
                     /db_xref="GI:384438532"
                     /db_xref="GeneID:12251487"
                     /translation="MRARLLRQVEGAVDLKRLERLLQNALAKEVLSPKQVQALRLELE
                     RAEARKLRPHFLGSFFREALERLGGSVHLREAGRMEVSFVPPRVRQARPGILRSYQRV
                     TFHKDKVALPGKPLDHVKDPQEALDPRKGVVAEAQYEIAKSLAQSLGKTPPASTNDRE
                     TIAALLEEAPPVLDPFAGGGTIPLEAQRLGLRAYASDLNPVAVLINKALVEIPPRFLG
                     LLPVNPEYRAKAREGEALPGAKGLAWDVRHYGAWVREEARRRIGHLYPELNGETVIAW
                     LWAHTVTCPSPGCRAETPLVRSFWLSKKRGREAFVVPEVRSGQVFFRVERGGEPPVEG
                     TVNRKGARCLVCGTPFSLEHVRQEGRAGRLGAKLMALMTEGKGGRNYHAPNEEHEAIA
                     HQALPTWKPLTQLVHDPRNIWCVQYGLATHADLFTPRQLLALATFADLVDEARERVYQ
                     DALQAGMPDDDTPLAEGGRGARAYAEAVGVYLALAVGRLVDYHPALCSWHTSRENIRN
                     TFTRQALPMVWDLAEANPFSQSSGSWDNMLEWVATALEALPAHPPGQARQLNAQESVN
                     GVPTPPLISTDPPYYDNISYAILSDFFYVWLRKTLEPTYPDLFRTLLTPKAEELVADP
                     YRHGSKEAAKRHFEEGMRQVFRNLRQKAHPDYPLTLYYAFKQQEEEADEEGNGAPTLA
                     STGWETFLQGLVDAGFQITATWPMRTELANRPQGQGSNALASSIVLVCRPRPQDAPLA
                     TRQEFLRALRQELPEALRKLTQGSIPPVDLAQSAIGPGMAVFSRYRQVVEPSGRALSV
                     REALVLINSVLDEFLAEEEAELDSATRFAIAWYEQYGYGEGPFGDAETLAKAKNVAVA
                     ALEEGGILRAKAGKVRLLKPEEYPEGWDPQTDRRLSAWEVAHQLIRALKQAGESAAAT
                     LLSQVPPDLAEGARALAYRLYGIAERKGRTEEAQDFNLLAGSYGHLHVEAARRRGAVQ
                     GELF"
     misc_feature    complement(148328..150718)
                     /locus_tag="TCCBUS3UF1_1320"
                     /note="Adenine-specific DNA methylase containing a
                     Zn-ribbon [DNA replication, recombination, and repair];
                     Region: COG1743"
                     /db_xref="CDD:224657"
     misc_feature    complement(<150560..150694)
                     /locus_tag="TCCBUS3UF1_1320"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            complement(151226..151453)
                     /locus_tag="TCCBUS3UF1_1330"
                     /db_xref="GeneID:12251488"
     CDS             complement(151226..151453)
                     /locus_tag="TCCBUS3UF1_1330"
                     /note="similar to Helicase domain protein of Chloroflexus
                     UniRef RepID=A9WJK0_CHLAA"
                     /codon_start=1
                     /transl_table=11
                     /product="Helicase domain protein"
                     /protein_id="YP_005653257.1"
                     /db_xref="GI:384438533"
                     /db_xref="GeneID:12251488"
                     /translation="MNLQQAHLLINYDLPWNPARLEQRFGRIHRIGQTEVYLVAENTR
                     EGEVYRRLLAKLEEASRALGGKVFDVLGQLF"
     misc_feature    complement(151337..>151450)
                     /locus_tag="TCCBUS3UF1_1330"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(151364..151366,151373..151375,
                     151385..151387,151448..151450))
                     /locus_tag="TCCBUS3UF1_1330"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(151450..151569)
                     /locus_tag="TCCBUS3UF1_1340"
                     /db_xref="GeneID:12251489"
     CDS             complement(151450..151569)
                     /locus_tag="TCCBUS3UF1_1340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653258.1"
                     /db_xref="GI:384438534"
                     /db_xref="GeneID:12251489"
                     /translation="MGSPEGKKVEEVFRLLGRMTWESFVRTRLPLLRLLPGKG"
     gene            151639..151857
                     /locus_tag="TCCBUS3UF1_1350"
                     /db_xref="GeneID:12251490"
     CDS             151639..151857
                     /locus_tag="TCCBUS3UF1_1350"
                     /note="similar to Prevent-host-death family protein of
                     Meiothermus ruber DSM 1279 UniRef RepID=D3PTK5_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Prevent-host-death"
                     /protein_id="YP_005653259.1"
                     /db_xref="GI:384438535"
                     /db_xref="GeneID:12251490"
                     /translation="MRVSKAYFKAHALELLRQVEATGEPLILTHRGKPVLEVRPYREE
                     NPLEELRGTLLRYEGPTEPTEGVWEALR"
     misc_feature    151645..>151806
                     /locus_tag="TCCBUS3UF1_1350"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            151854..152255
                     /locus_tag="TCCBUS3UF1_1360"
                     /db_xref="GeneID:12251491"
     CDS             151854..152255
                     /locus_tag="TCCBUS3UF1_1360"
                     /note="similar to PIN domain nuclease, a component of
                     toxin-antitoxin system (PIN domain) COG3744;
                     similar to Hypothetical conserved protein of Thermus
                     thermophilus UniRef RepID=Q746F8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653260.1"
                     /db_xref="GI:384438536"
                     /db_xref="GeneID:12251491"
                     /translation="MRPFLLDTHAWVWFLTSPELLPSSLLARLEAARRRKALYISAIT
                     PWEVAVLAQKGRIALALESWHWLKKALQVEGIRVIPLDVGIVLDGAYMDLPHPDPADR
                     FIAATALRLGAVLITKDANLRRHPRLDTLWE"
     misc_feature    151863..152249
                     /locus_tag="TCCBUS3UF1_1360"
                     /note="PIN domain of the VapC-like Sll0205 protein and
                     homologs; Region: PIN_Sll0205; cd09872"
                     /db_xref="CDD:189042"
     misc_feature    order(151872..151874,151992..151994,152154..152156,
                     152208..152210)
                     /locus_tag="TCCBUS3UF1_1360"
                     /note="putative active site [active]"
                     /db_xref="CDD:189042"
     gene            complement(152541..153419)
                     /locus_tag="TCCBUS3UF1_1370"
                     /db_xref="GeneID:12251492"
     CDS             complement(152541..153419)
                     /locus_tag="TCCBUS3UF1_1370"
                     /note="similar to Stage 0 sporulation protein J
                     (antagonist of Soj) containing ParB-like nuclease domain
                     COG1475;
                     similar to Chromosome partitioning protein parB family of
                     Thermaceae UniRef RepID=Q746H2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosome partitioning protein parB"
                     /protein_id="YP_005653261.1"
                     /db_xref="GI:384438537"
                     /db_xref="GeneID:12251492"
                     /translation="MSAIRAYLKGLVEEAKRPATSTLPLAELVPRPQPRRRFDEASLA
                     TLADSIRAHGVLEPLLVRPVGEGRYEIIAGERRYRAARMAGLSEVPVVVLEADEKTAQ
                     ALALMENLQREDLNPYEETLGVLDLLALELGREREEVVGLLHRMRDERKGKVPHNVMG
                     SPEAGKVEEVFRLLGRMTWESFVQNRLPLLRLPPDLREALEEGSIPYTAALELKKVKD
                     EGVRKGLLAEARAGLPLRELRVRVRQALKRPAPPPPWHKEVAARLARLDLESLPEAKR
                     QEVEKHLKALRQLLAE"
     misc_feature    complement(153090..153353)
                     /locus_tag="TCCBUS3UF1_1370"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     gene            complement(153416..154378)
                     /locus_tag="TCCBUS3UF1_1380"
                     /db_xref="GeneID:12251493"
     CDS             complement(153416..154378)
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="similar to ATPases involved in chromosome
                     partitioning COG1192;
                     similar to Chromosome partitioning ATPase, ParA family of
                     Thermus UniRef RepID=Q53W41_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Chromosome partitioning ATPase, ParA"
                     /protein_id="YP_005653262.1"
                     /db_xref="GI:384438538"
                     /db_xref="GeneID:12251493"
                     /translation="MKRERLVPLPEWARREGISESLARKWIREGRLEAVRLGHYWYVP
                     EVVEGPEGRGQAYTLFTHAGGAGKTSLARDLGFELASRGYRVLLVDADPQANLTAWLG
                     VEPGSVADEETLLRVIRHDTLPQPRPVGRNLFLIPASVNLAVGELELDRKPLGALALR
                     TALERREGYDLVLVDSLPSLGSLAVMAALAGDGLLVPVETGAKGVQALQAVVQVAKEY
                     REALRKVAPEAVAGRAHIIRAFIPTKYDARTQGDNRVLQLIGELEEVAPVAPKVAYRP
                     GPHRKATEEGVPIHAAGDKEAVEEIARLADFLLERVFRLEGVPA"
     misc_feature    complement(153689..154210)
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(<153845..154210)
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(153434..154207)
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(154172..154192)
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(153854..153856,154172..154174))
                     /locus_tag="TCCBUS3UF1_1380"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            154488..154964
                     /locus_tag="TCCBUS3UF1_1390"
                     /db_xref="GeneID:12251494"
     CDS             154488..154964
                     /locus_tag="TCCBUS3UF1_1390"
                     /note="similar to Predicted ATPase (AAA+ superfamily)
                     COG1373;
                     similar to Mlr9349 protein of Bacteria UniRef
                     RepID=Q981J4_RHILO"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653263.1"
                     /db_xref="GI:384438539"
                     /db_xref="GeneID:12251494"
                     /translation="MIIPRRLEPILEARLREVPVVVLTGPRQAGKTTLALRVGERWGA
                     LYLDLESERDRAKLAEPELYLEGFWGRLVILDEVHRMPGLFPVLRSLVDRARRGHRAD
                     LYLLLGSVSPEVSRQAGESLAGRAGYKRGCGGLQSPPLSRVGCSSPPRGPVGHTAW"
     misc_feature    154488..>154865
                     /locus_tag="TCCBUS3UF1_1390"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    154542..154877
                     /locus_tag="TCCBUS3UF1_1390"
                     /note="AAA domain; Region: AAA_14; pfam13173"
                     /db_xref="CDD:257541"
     gene            155940..157652
                     /locus_tag="TCCBUS3UF1_1410"
                     /db_xref="GeneID:12251495"
     CDS             155940..157652
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653264.1"
                     /db_xref="GI:384438540"
                     /db_xref="GeneID:12251495"
                     /translation="MLRTLGGLWWEGQPFRRTKPLLLLAYLALEGPKPRRHLAELFWP
                     GAQDGLNSLSVALNQLRPLGVVEGGEVLSARVESDVGALLAALRAGDLEGVRRLYRGA
                     FLEGLDLPLGEELEEWVWARREALALEVYRLFARRARAHFALGLAEEGRALLGEALAL
                     GGVRHAVEVAEEPPPHPQPLPREVRRAYWAFHLLPGKAPEVCPLEPEALERLHEEGLL
                     SPGGYPLLPLGLEALPPEAQEVALELARRLPLREALPLYRLARFFWTEEDRRRAGQAL
                     LAEARRWLSENPLQGLELLQGLPRDPQVQLLRARALERLGRYGEALEELEGLEEEDPE
                     AAAVRGGILFRLGRVGEALAEAERAAGGSPWAQGEAWNLRGLLAFSQGRFAEAAALFA
                     RAAVRFLAAGETARQVDALNNRAVALVEGGSPEAEGVLAEALRAAGEAPLLRARVLLN
                     LGVVRERQGRPEEAEALYRASLEAAERAGSLEALGRAWNNLGALFHRQGRLGEAEAAY
                     RQALALAKEGREWVLTAAVLANLAELQGDPASLEEAIALLQEARYTVLAERYRARLEA
                     FRGR"
     misc_feature    157260..157490
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    157278..157592
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(157278..157280,157284..157289,157296..157301,
                     157404..157409,157413..157418,157425..157430,
                     157515..157520,157527..157532,157539..157544)
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(157293..157295,157329..157331,157341..157343,
                     157350..157352,157413..157415,157449..157451,
                     157461..157463,157470..157472,157524..157526,
                     157569..157571,157581..157583,157590..157592)
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    157389..157592
                     /locus_tag="TCCBUS3UF1_1410"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     gene            complement(157639..157785)
                     /locus_tag="TCCBUS3UF1_1420"
                     /db_xref="GeneID:12251496"
     CDS             complement(157639..157785)
                     /locus_tag="TCCBUS3UF1_1420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653265.1"
                     /db_xref="GI:384438541"
                     /db_xref="GeneID:12251496"
                     /translation="MVRGGEGRSLQGRPGSGAWASGRTSPFSLGFPWTPHPFQGGPRG
                     LNAP"
     gene            157845..159176
                     /locus_tag="TCCBUS3UF1_1430"
                     /db_xref="GeneID:12251497"
     CDS             157845..159176
                     /locus_tag="TCCBUS3UF1_1430"
                     /note="similar to Peptidase S8 and S53 subtilisin kexin
                     sedolisin of Meiothermus UniRef RepID=D3PPF1_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase S8 and S53 subtilisin kexin sedolisin"
                     /protein_id="YP_005653266.1"
                     /db_xref="GI:384438542"
                     /db_xref="GeneID:12251497"
                     /translation="MTQRAKGLWLVWVLLGAWLAGCGPSEPSLTLYPSRAVPGEEVEA
                     RLSGMGGLEARVYVGEVEAEVTAREVRAVRFRVPALPGGPKPVRVVSGSQEAQGTLGL
                     LGRVDPSRVLLRLPLGREPRLPKGFTLLRQDSLSACGFALAELGYSGEALGRALEELE
                     AQDPAYKADPESLWSLGGVSGGEAVGAPLAHRRGRTGKGVRVAVLDTGVDAAIPQLPG
                     YDFVEDDPVPQDAFPGGHGTGAAGLVKEVAPDAQIVPVRVCDGNGVCRASRVVRGVCW
                     VVANRQGPTVLSLSLGGDTPVEALRLALEAALAQGLPVAAAAGNQGNQGSPAHYPAAL
                     DLPGLVAVGALEEVQGEWKPAAYSTRGTYVDLAAPGTDLDCVLPGGGRGSCTGTSFAT
                     PLVAGAMALWLEAQPGLTPAQVQGHLMQSAKALPQPTQAVGAGMLDLGQAP"
     misc_feature    158439..159107
                     /locus_tag="TCCBUS3UF1_1430"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    158448..159128
                     /locus_tag="TCCBUS3UF1_1430"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    order(158550..158552,158715..158717,159009..159011)
                     /locus_tag="TCCBUS3UF1_1430"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    order(158550..158552,159009..159011)
                     /locus_tag="TCCBUS3UF1_1430"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     gene            159304..160407
                     /locus_tag="TCCBUS3UF1_1440"
                     /db_xref="GeneID:12251498"
     CDS             159304..160407
                     /locus_tag="TCCBUS3UF1_1440"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653267.1"
                     /db_xref="GI:384438543"
                     /db_xref="GeneID:12251498"
                     /translation="MRKLFVGVWIGAFAGLLLAGCNLGGGTDPLNEALAAEDAVYGAV
                     LAWVEGVEASAQGLTPQGDGGRPLTLVKDSDGLTVLAQATGWTPPQDPGGLLGQPLGI
                     TIKCSSDGRRCAYAPMELVGDGEGGYRMVWRGRTGEGTPIEEATPATAEPGGPGTDPT
                     AKPRWSYNKIGLGGFWADSLIQYPFRLHLAAPGPEGLAGWAGPTPPQNPTASLEEALR
                     QAFSLPKPFSLSWPPALLLREDLVLAFAPYQNPAFSTARSPADLVGQPLGVAYWRGGK
                     GAKLTKADAARLLSLSLTQEPGGGYGLEAQDLRNPGQVLRFRVGEVGWCDGCFGQDPR
                     PRYLGIEDRLQGPPLVHLQVGGLLLRGIEKKDR"
     gene            complement(160455..162365)
                     /locus_tag="TCCBUS3UF1_1450"
                     /db_xref="GeneID:12251499"
     CDS             complement(160455..162365)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="similar to cobyric acid synthase PRK00784;
                     similar to Cobyric acid synthase/cobinamide
                     kinase/cobinamide phosphate guanylyltransferase of
                     Deinococci UniRef RepID=Q746N0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobyric acid synthase/cobinamide
                     kinase/cobinamide phosphate guanylyltransferase"
                     /protein_id="YP_005653268.1"
                     /db_xref="GI:384438544"
                     /db_xref="GeneID:12251499"
                     /translation="MGRARALAVWGTGSGVGKSFLAAALLRHFRRLGLKAAPFKAQNM
                     SNHARVVAGGEMASAQWLQALAAGAEPDPRMNPILVKPFGEGGSQVVVLGRVDPRLSH
                     LPWKERKAHLLAPVREALEGLLGEYDLLVLEGAGSPVERNLWPDLPNLQVAVWAGARA
                     LLVADVDQGGSLAAFFGTWALLGEHRERLLGFVFNKFRGDLSLLEPAYALLEGWTGVP
                     VLGTLPLLPLELPEEDGFRHRPKEGEGPKVALLRYPHAANLDEFWALGELVRLVHART
                     PEEAEGADLLILPGSRLPARDLPWLRAFLPLLRRHLEAGRPVLAVCGGAEMLSEALVD
                     EEGVEAQGVFPGLGLLPFRVRMEREKTVRRTRVRFGGLQGFWGRLNGLEATGYEIHHG
                     QGLPLLHQEGPLLATWLHGLLEDPGVQRALFGREARGLEEALEGAADALEAHLDLPAL
                     HRALGLVGGVHPAPRPQAPDPPPAPGLVLFLGGARSGKSRQAQRLAGPFATLIATAEA
                     RDGEMAERIARHRAERPPTWETLEEPLDLVGALARAQHPVVVVDCLTLWVSNLLERGL
                     DPLAEAGRFLKAAQESGKRVILVSNEVGMGIVPANPLARRYRDLLGEVNRLAAEAAQE
                     AYLLVAGRLLPL"
     misc_feature    complement(161016..162359)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="cobyric acid synthase; Provisional; Region:
                     PRK00784"
                     /db_xref="CDD:234838"
     misc_feature    complement(161703..162335)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(161097..161624)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyric Acid Synthase (CobQ); Region:
                     GATase1_CobQ; cd01750"
                     /db_xref="CDD:153221"
     misc_feature    complement(order(161190..161192,161196..161198,
                     161400..161402))
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153221"
     misc_feature    complement(160458..160937)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="Adenosylcobinamide kinase / adenosylcobinamide
                     phosphate guanyltransferase (CobU). CobU is bifunctional
                     cobalbumin biosynthesis enzymes which display
                     adenosylcobinamide kinase and adenosylcobinamide phosphate
                     guanyltransferase activity. This enzyme is a...; Region:
                     CobU; cd00544"
                     /db_xref="CDD:238304"
     misc_feature    complement(order(160470..160472,160476..160478,
                     160509..160511,160518..160523,160527..160532,
                     160542..160544,160575..160577,160581..160592,
                     160905..160907,160911..160919))
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238304"
     misc_feature    complement(160899..160919)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238304"
     misc_feature    complement(order(160707..160712,160770..160772,
                     160794..160796,160803..160805,160848..160850,
                     160899..160913))
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238304"
     misc_feature    complement(160710..160724)
                     /locus_tag="TCCBUS3UF1_1450"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238304"
     gene            complement(162352..162765)
                     /locus_tag="TCCBUS3UF1_1460"
                     /db_xref="GeneID:12251500"
     CDS             complement(162352..162765)
                     /locus_tag="TCCBUS3UF1_1460"
                     /note="similar to Hepn domain protein of Thermomicrobium
                     roseum DSM 5159 UniRef RepID=B9L4T6_THERP"
                     /codon_start=1
                     /transl_table=11
                     /product="Hepn domain protein"
                     /protein_id="YP_005653269.1"
                     /db_xref="GI:384438545"
                     /db_xref="GeneID:12251500"
                     /translation="MSAEKRREEGLRWLAQAQDDWEAGEALLGAGKFAQAAFLAQQAG
                     EKALKALWIALGLDPWGHSLARLIRDLPEGMGGALQPLLPQALALDKLYIPTRYPDAL
                     PGLTPKEAYTQEEAQKALMDAQAILKAVEVALGKG"
     misc_feature    complement(162373..162732)
                     /locus_tag="TCCBUS3UF1_1460"
                     /note="HEPN domain; Region: HEPN; pfam05168"
                     /db_xref="CDD:253056"
     gene            complement(162743..163069)
                     /locus_tag="TCCBUS3UF1_1470"
                     /db_xref="GeneID:12251501"
     CDS             complement(162743..163069)
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="similar to DNA polymerase, beta domain protein
                     region of Thermomicrobium roseum DSM 5159 UniRef
                     RepID=B9L4T5_THERP"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase, beta domain-containing protein
                     region"
                     /protein_id="YP_005653270.1"
                     /db_xref="GI:384438546"
                     /db_xref="GeneID:12251501"
                     /translation="MEADLEAYLAQATERLREALDLEALYLFGSHARGTADRRSDLDL
                     LVVARTPLPPLARLELVLQLLADAPLPVEALVLTPEELAERRELPFLKGVLREAKPLY
                     ERGKAA"
     misc_feature    complement(162779..163045)
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(162851..162853,162857..162859,
                     162941..162943,162947..162952,162971..162973,
                     162980..162988))
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(162941..162943,162947..162952,
                     162971..162973,162980..162988))
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(162851..162853,162941..162943,
                     162947..162949))
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(162851..162853,162857..162859))
                     /locus_tag="TCCBUS3UF1_1470"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            complement(163079..163765)
                     /locus_tag="TCCBUS3UF1_1480"
                     /db_xref="GeneID:12251502"
     CDS             complement(163079..163765)
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="similar to DNA polymerase beta domain protein
                     region of Thermus UniRef RepID=B7AB15_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase beta domain-containing protein
                     region"
                     /protein_id="YP_005653271.1"
                     /db_xref="GI:384438547"
                     /db_xref="GeneID:12251502"
                     /translation="MERSRDFLLQAGRDLEQARLSLREGFYGWAAFAAQQGAEKAVKA
                     VFQRLGAVAWGHSVARLLEELAQTFPVPEALLDGASELDKAYIPSRYPDALPRERPSR
                     ITEGRRPSGFLHMRRKSMPSVQVFYPPWNRETLLERLRKGLEALAQEVPLEAAYLFGS
                     WARGRAVAGSDVDLLLLYRGPRREDLHRLARRAFPGLPLELHAYTLEEAQALGPVLAR
                     MLQGAVPLMG"
     misc_feature    complement(<163478..163753)
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="HEPN domain; Region: HEPN; pfam05168"
                     /db_xref="CDD:253056"
     misc_feature    complement(163142..163369)
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(163166..163168,163172..163174,
                     163247..163249,163253..163258,163277..163279,
                     163286..163294))
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(163247..163249,163253..163258,
                     163277..163279,163286..163294))
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(163166..163168,163247..163249,
                     163253..163255))
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    complement(order(163166..163168,163172..163174))
                     /locus_tag="TCCBUS3UF1_1480"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            complement(163770..164621)
                     /locus_tag="TCCBUS3UF1_1490"
                     /db_xref="GeneID:12251503"
     CDS             complement(163770..164621)
                     /locus_tag="TCCBUS3UF1_1490"
                     /note="similar to Cobalamin biosynthesis protein CobD of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7AB17_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin biosynthesis protein CobD"
                     /protein_id="YP_005653272.1"
                     /db_xref="GI:384438548"
                     /db_xref="GeneID:12251503"
                     /translation="MSLLLALLLDALLGEPPARGHPVVLMGRYLAWAWPRVRGFWSGA
                     LYWGLGALLFTLPALLLDLLLRPLGLGWLLLGLLLKPLFSLRMLLLEVLEVERALGKG
                     LEAGRRQVARLVSRPTGGLSEEEVREAALESLAENLSDSLLAPLLYYALLGLAGAALY
                     RYANTADAMWGYPEHGERGAFAARADDLLNLLPARLAGFLLCPPRLWPRLLQEARKTP
                     SPNAGFPMGAMALRLGVRLRKPGVYALNPTAPSPTPAHLRRGVWLAGAWGYGLGLALG
                     ILLEVVG"
     misc_feature    complement(163824..164582)
                     /locus_tag="TCCBUS3UF1_1490"
                     /note="CobD/Cbib protein; Region: CobD_Cbib; pfam03186"
                     /db_xref="CDD:251784"
     gene            complement(164618..165136)
                     /locus_tag="TCCBUS3UF1_1500"
                     /db_xref="GeneID:12251504"
     CDS             complement(164618..165136)
                     /locus_tag="TCCBUS3UF1_1500"
                     /note="similar to Alpha-ribazole-5'-phosphate phosphatase
                     of Thermus UniRef RepID=Q53WB3_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ribazole-5'-phosphate phosphatase"
                     /protein_id="YP_005653273.1"
                     /db_xref="GI:384438549"
                     /db_xref="GeneID:12251504"
                     /translation="MELWLVRHGETLWNREGRLLGWTDLPLTPLGEAQARALQGLLPP
                     LPAYSSDLSRALRTALLAGFSPTPTPSLREIHFGSLEGALWDALDPGLKEAMLRFQGF
                     HPPEGESLDRFQERVLAFLGGLRAPAVLFTHGGVIRAALRALGEDGLIPLGSAVVLEW
                     PKRVLDRILPSP"
     misc_feature    complement(164657..165133)
                     /locus_tag="TCCBUS3UF1_1500"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    complement(order(164735..164740,164975..164977,
                     165113..165118))
                     /locus_tag="TCCBUS3UF1_1500"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            165179..166186
                     /locus_tag="TCCBUS3UF1_1510"
                     /db_xref="GeneID:12251505"
     CDS             165179..166186
                     /locus_tag="TCCBUS3UF1_1510"
                     /note="similar to
                     nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase PRK00105;
                     similar to Nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase of Deinococci UniRef
                     RepID=COBT_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotinate-nucleotide--dimethylbenzimidazole
                     phosphoribosyltransferase"
                     /protein_id="YP_005653274.1"
                     /db_xref="GI:384438550"
                     /db_xref="GeneID:12251505"
                     /translation="MEGIREAAQRRMERLTKPPRSLGRLEEVALRLAAIQGRVRPELG
                     PGGVVVAAADHGVAEEGVSAYPQEVTRQMVLNFLRGGAAINQFAQVAGCEVYVLDVGV
                     KGELPDHPRLLKAKVREGSRNLAREAALTLEEAERALEAGREAARRAIAEGATLLAAG
                     DMGIGNTTTAAALTAALLGLPPEAVVGRGTGVGEEGLRRKREAVARALGRLGPGMGPL
                     EVAAQVGGLELLAIAGVYLEGYARGLPLVLDGFPVTSGALLAWRLAPGIRDHLFAGHL
                     SREPGHRHALEALDLKPLLDLDLALGEGTGAVLAMPLLRAAARILHMATFEEAGVSDR
                     L"
     misc_feature    165224..166165
                     /locus_tag="TCCBUS3UF1_1510"
                     /note="Nicotinate-nucleotide-dimethylbenzimidazole
                     phosphoribosyltransferase (DMB-PRT), also called CobT;
                     Region: DMB-PRT_CobT; cd02439"
                     /db_xref="CDD:143332"
     misc_feature    order(165224..165253,165368..165370,165383..165385,
                     165392..165397,165419..165427,165434..165439,
                     165443..165445,166010..166012,166052..166054,
                     166058..166075,166079..166081,166103..166105,
                     166112..166114,166124..166126,166133..166138,
                     166145..166150,166163..166165)
                     /locus_tag="TCCBUS3UF1_1510"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143332"
     misc_feature    order(165224..165226,165230..165235,165365..165367,
                     165383..165385,165395..165397,165659..165679,
                     165926..165934,166007..166009,166079..166087,
                     166151..166153)
                     /locus_tag="TCCBUS3UF1_1510"
                     /note="active site pocket [active]"
                     /db_xref="CDD:143332"
     misc_feature    166085..166087
                     /locus_tag="TCCBUS3UF1_1510"
                     /note="putative cataytic base [active]"
                     /db_xref="CDD:143332"
     gene            166191..166889
                     /locus_tag="TCCBUS3UF1_1520"
                     /db_xref="GeneID:12251506"
     CDS             166191..166889
                     /locus_tag="TCCBUS3UF1_1520"
                     /note="similar to cobalamin synthase PRK00235;
                     similar to Cobalamin synthase of Thermus UniRef
                     RepID=Q53WB6_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthase"
                     /protein_id="YP_005653275.1"
                     /db_xref="GI:384438551"
                     /db_xref="GeneID:12251506"
                     /translation="MLLAFRLALALLTLLPVAPHGAKEEDFRRSTAFFPLVGYLLGLP
                     LALLAPLPLPEGLWGALALGLLLGLTGFLHLDGLLDAADALLGTRTREERLRILKDPH
                     LGAFAFGVGGVYLLFLWQALALVRDPLFLLLFPGFARFLPLPLLHRYPLLGPGMAGLI
                     RGGPLLLPALLALPFPLLYPLPALLALLAAWGVARLALLRLGGLNGDVLGAGIALAEL
                     SALLSYALWRSLSG"
     misc_feature    <166416..166871
                     /locus_tag="TCCBUS3UF1_1520"
                     /note="Cobalamin-5-phosphate synthase; Region: CobS;
                     cl00415"
                     /db_xref="CDD:241851"
     gene            166886..167431
                     /locus_tag="TCCBUS3UF1_1530"
                     /db_xref="GeneID:12251507"
     CDS             166886..167431
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="similar to Cob(I)alamin adenosyltransferase of
                     Bacteria UniRef RepID=D7CRM9_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Cob(I)alamin adenosyltransferase"
                     /protein_id="YP_005653276.1"
                     /db_xref="GI:384438552"
                     /db_xref="GeneID:12251507"
                     /translation="MKPYRKPEGERRGLLLVYTGEGKGKSTAAFGLALRAHGRGLRVR
                     IFQFLKHQGARFGEHRAFALLGVPVEGLGDGFTWRSRDLEATAGLAREGWARAKGVLL
                     SGEADLVVLDEATYPLRYGWIPLEEFLEALKARPRHVHLVVTGRGAPEALVALADTVT
                     EMRKVKHAFDQGVPAQRGMEH"
     misc_feature    166913..167425
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="ATP:corrinoid adenosyltransferase [Coenzyme
                     metabolism]; Region: BtuR; COG2109"
                     /db_xref="CDD:225020"
     misc_feature    166916..167392
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="ATP:corrinoid adenosyltransferase BtuR/CobO/CobP.
                     This family consists of the BtuR, CobO, CobP proteins all
                     of which are Cob(I)alamin (vitamin B12)
                     adenosyltransferase, which is involved in cobalamin
                     (vitamin B12) biosynthesis. This enzyme is a homodimer;
                     Region: CobA_CobO_BtuR; cd00561"
                     /db_xref="CDD:238314"
     misc_feature    order(166919..166921,166952..166954,166964..166966,
                     166976..166981,166985..167002,167048..167050,
                     167054..167059,167063..167068,167303..167305,
                     167342..167347,167351..167374,167378..167383,
                     167387..167389)
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238314"
     misc_feature    166943..166963
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238314"
     misc_feature    order(166952..166954,166958..166966,166988..166990,
                     167222..167224)
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238314"
     misc_feature    order(167033..167035,167045..167047,167117..167119,
                     167231..167233,167243..167245,167321..167323,
                     167390..167392)
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="hydroxycobalamin binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238314"
     misc_feature    167207..167221
                     /locus_tag="TCCBUS3UF1_1530"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238314"
     gene            complement(167496..169415)
                     /locus_tag="TCCBUS3UF1_1540"
                     /db_xref="GeneID:12251508"
     CDS             complement(167496..169415)
                     /locus_tag="TCCBUS3UF1_1540"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653277.1"
                     /db_xref="GI:384438553"
                     /db_xref="GeneID:12251508"
                     /translation="MSRKGIALVIALATLVVVSGIGTLLFVRTLGEIRHSGQDQGIVQ
                     TLMLARGAANVGGTFLSTTGRDRLNTIVRNTASNTACWAYGGNANCQSGQTPDPVAVA
                     QALGTVASQLQSQVDGSLCPNGTPRNLAPSGLNANVTLRLHFTATACGQGLPPGTQLP
                     AGRFVDGSPRTAGASNTAQTYALPFVMVAQAEMGPYRRNVVLQGEYRFTVGRASFARW
                     ALFTHIHTLPDGTDVWFTERTLFDGPVHTNSHLRLYRRPWFGGEVTSAGCTNPGDSSC
                     SGQTRAGAYFYGVNGGNLVLATNMQPSASAPSYTNTFGTHAPEFTAGVDWNAPFIPLP
                     QNNQDQRSAAQSGGLYFQRTITNLRLERKCIENLTGLEVTCALPLPVGVSKFQYITVT
                     YCANNNCNQTATEIYRYGPDLKLYQRVTQGNTTTWQPVRRNNNDVYFNGVIFSDGEIQ
                     NLSGPSRTNANDPNTAGPALAEFAQITVAANNTIQITGDLKYENPPCSGTPTRNPNGT
                     VNPASCDNLSAENVLGIFSQNGDVLIDQGAPRDLHIHGTLMSARGVVQVENYNSIANK
                     GNVYLIGGIIERFYGAFGTFNPQTGQNNTGYGRAFTYDRRFLQGLAPPFFPTTGVDQV
                     MGVSVFSYGQREQVY"
     gene            complement(169427..170335)
                     /locus_tag="TCCBUS3UF1_1550"
                     /db_xref="GeneID:12251509"
     CDS             complement(169427..170335)
                     /locus_tag="TCCBUS3UF1_1550"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653278.1"
                     /db_xref="GI:384438554"
                     /db_xref="GeneID:12251509"
                     /translation="MRAKGLGNRGLSLVEVLLALTIFGIVMAIAYGSVVQFMQTRSDL
                     DATVSAQAKLRRIVEVFTQDLRSAVFGGLASTPYPTGRNSISFALIDGGAGYPVLPHD
                     SGNNNSFKQAAEVKILALATQASQIGINRGDYVLMVNRNGDGVILPVTGVNAVGGQAN
                     RWHVVHAGCGNTIDYTPNTLLFRVRTVGLTYDPATKQLSYREGSGNPLPMAFDLTGFR
                     IDYVYEAGSQDVLVNPGPYNYGAPSASPPYQFTAAGKTYTLKRLSLTLSAGFASRGRT
                     FERTYTSQVELSSNTQYQVKRIIPCQ"
     misc_feature    complement(170243..170314)
                     /locus_tag="TCCBUS3UF1_1550"
                     /note="prepilin-type N-terminal cleavage/methylation
                     domain; Region: IV_pilin_GFxxxE; TIGR02532"
                     /db_xref="CDD:213719"
     gene            complement(170352..170840)
                     /locus_tag="TCCBUS3UF1_1560"
                     /db_xref="GeneID:12251510"
     CDS             complement(170352..170840)
                     /locus_tag="TCCBUS3UF1_1560"
                     /note="similar to Type II secretory pathway, component
                     PulJ COG4795;
                     similar to Probable secretion system protein of Thermus
                     thermophilus UniRef RepID=Q53W48_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion system protein"
                     /protein_id="YP_005653279.1"
                     /db_xref="GI:384438555"
                     /db_xref="GeneID:12251510"
                     /translation="MKRGGFFRKGLTLVEVLIAITVLSLVLLALNALLVSSLRHTSIS
                     GARTQAVQILNYVGRRIVGGETLLLPGSTPLNYGYGSLRQNFPDLPQEVRFANPDLYR
                     VAISNLGTPTWASSLGVGVNEYRILVCWRQGGREHCAEGRTFSAPPSTASPSTPPLEG
                     IN"
     gene            complement(170837..171142)
                     /locus_tag="TCCBUS3UF1_1570"
                     /db_xref="GeneID:12251511"
     CDS             complement(170837..171142)
                     /locus_tag="TCCBUS3UF1_1570"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q746I0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653280.1"
                     /db_xref="GI:384438556"
                     /db_xref="GeneID:12251511"
                     /translation="MQGLFWQGATEAASRGAELSLVRQGNRLQLRLGSQTLRTVDIPQ
                     GVNLSLPQGTVVRFSPPGKLLDAQGQNLSSPLSFTISIGQRTYAYTVSLIGEVKGAP"
     gene            171801..172655
                     /locus_tag="TCCBUS3UF1_1580"
                     /db_xref="GeneID:12251512"
     CDS             171801..172655
                     /locus_tag="TCCBUS3UF1_1580"
                     /note="similar to DNA-binding transcriptional activator of
                     the SARP family COG3629;
                     similar to Putative Transcriptional regulator,
                     AfsR/DnrI/RedD family of Deinococcus deserti VCD115 UniRef
                     RepID=C1CWF9_DEIDV"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulator, AfsR/DnrI/RedD"
                     /protein_id="YP_005653281.1"
                     /db_xref="GI:384438557"
                     /db_xref="GeneID:12251512"
                     /translation="MLRFRLLGIPALEQAGRRVALPTHKLLALLAYLALEGPTARTKL
                     AGLLWSEQDEAGARANLRRELNRLRHTPVAAVLRTEGGWLALEPLETDVEAFRASVEH
                     GDLQAALSLYQGPLLEGLDLPGATGFADWLEGRREGLAQLWREALHRQAQRLEAAHDL
                     RGALASRLTLLREDELQEFHHREAMRLQALLGEREAALARFARLKELLRCELHLEPLP
                     ETLELVRQIQEGTLNPVRLPPVREVIGVVSRVPFVGREQEWAQMEAAWRAQQAIYVSG
                     PGRVRIYV"
     misc_feature    171801..172481
                     /locus_tag="TCCBUS3UF1_1580"
                     /note="DNA-binding transcriptional activator of the SARP
                     family [Signal transduction mechanisms]; Region: DnrI;
                     COG3629"
                     /db_xref="CDD:226156"
     gene            172662..173882
                     /locus_tag="TCCBUS3UF1_1590"
                     /db_xref="GeneID:12251513"
     CDS             172662..173882
                     /locus_tag="TCCBUS3UF1_1590"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653282.1"
                     /db_xref="GI:384438558"
                     /db_xref="GeneID:12251513"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    172701..173849
                     /locus_tag="TCCBUS3UF1_1590"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    172737..173786
                     /locus_tag="TCCBUS3UF1_1590"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            173925..176567
                     /locus_tag="TCCBUS3UF1_1600"
                     /db_xref="GeneID:12251514"
     CDS             173925..176567
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653283.1"
                     /db_xref="GI:384438559"
                     /db_xref="GeneID:12251514"
                     /translation="MEFAQRQGPMFFLRADPSDGGIPYAFYTRGLRESLGQFPALELP
                     LWARREVSRLLPELGEGSLAPASGLEGKVRLLEAITEVIRALGRQGVRSVVADDLHFV
                     RDAASLEAATYAMARLLPEGMLRPLVAFRPEELDPAFLRAIREQVEGGKAILLELKPL
                     SETDLLRLVRALSGSSGATRFTQRLYQATGGNPLFVLETLKALFESGALQVGPEGWHT
                     PYDQETTDYRELPLPASVREAVWRRIEGLGAAPRRLLEAASLAGDGFSLEVLRGATAL
                     SEWESLEALEQALAADLLRRQDAGYAFSHELVRRSVREGLGPERRRLLHRKMAQSLAR
                     QGGSPARVAEHWEEGGRPQEAIPWRLRAALAAVRVYAHREALEQYQLALSDGAEGKVA
                     YEIERERARLWQTLDERTPWAEALGAMERLAQELGEAALQAETRLGWAEHHLLCGRYK
                     EALAEAEGVGQSGPLAAPLQAKALYLGGRALGAMGELGAAEARLLQAQVLLPAEPLTL
                     EVYDWLSIFAYRQGKLEAALGYTEAERALAQKLGNRTGQNNALQNAATFTAAQGRYQE
                     AVQLAERAIAEAREMGDITLLRYALLNLFAIHYQRSNFEAALGPLEEGLQMAREPQNP
                     EMEAKFLNNLSLVHWYRGALGEAYRAVSRALELSQRSGHRADALFYQVVLADDLHWLG
                     QPAEARRLLEAAVRSIQELGLWGRLPWAETHLARCEVSLGQPEQALKRLGRLRQEPHL
                     ADSLNPPRVAWVEGLAWLRLDQPARALQAVQDTHSDDPTTTSQLWSVRLWAQARLGQV
                     SQDDLQAGLKFLQAPEIPPLEKLALRQAVTAALRARGNLRQAQEQQRLCEQALRALCE
                     SLEGYPLLKEACRKAYGLYPGSPS"
     misc_feature    175437..175664
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    175569..175895
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(175569..175574,175578..175583,175590..175595,
                     175698..175703,175707..175712,175719..175724,
                     175818..175823,175830..175835,175842..175847)
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    175569..175784
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    order(175587..175589,175623..175625,175635..175637,
                     175644..175646,175707..175709,175743..175745,
                     175755..175757,175764..175766,175827..175829,
                     175863..175865,175875..175877,175884..175886)
                     /locus_tag="TCCBUS3UF1_1600"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            176690..176860
                     /locus_tag="TCCBUS3UF1_1610"
                     /db_xref="GeneID:12251515"
     CDS             176690..176860
                     /locus_tag="TCCBUS3UF1_1610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653284.1"
                     /db_xref="GI:384438560"
                     /db_xref="GeneID:12251515"
                     /translation="MDEEESQREYRLIVRLPDETHPWQARLERAGEVLEFASPLELVA
                     WLEAAFHHEGLS"
     gene            176871..179282
                     /locus_tag="TCCBUS3UF1_1620"
                     /db_xref="GeneID:12251516"
     CDS             176871..179282
                     /locus_tag="TCCBUS3UF1_1620"
                     /note="similar to Peptidase C1A papain of Meiothermus
                     silvanus DSM 9946 UniRef RepID=D7BHB9_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase C1A papain"
                     /protein_id="YP_005653285.1"
                     /db_xref="GI:384438561"
                     /db_xref="GeneID:12251516"
                     /translation="MKPKLMLALFLGILGACTSPSPQGGPVGPDIQEFLTVGGYPAVR
                     LGNGEVKRLDKPEETAWYLDRFPPPATPGLAQVGPQNLPLAVDLTPYQTPVKDQGGRG
                     TCTAFAVVGALEAAYKRAYNLTLDLSEEFLNWQDKVNVLDTQSPPVPPSQSENFLAVW
                     GGGSVNYKLQSILNGERGIPLENQAPYNGQESFGDSGQWLPPITRNSPQRSMGEANLS
                     QRSQTYRIPFPLDWLMLPQLALEEGRYRVNQAVFAGGSQLTNPEWFKAQLAAGREVAF
                     GVRIPNNGKGVKGGIWMPGDMDWGDHAMLMVGYDDSKQAFRVKNSWGTSWNEGGYVWM
                     SYEFVRRGKVYEAASILSVMPPNFAVYTPQLFFGRYLLSHDGWRGVLDIYHIPNPSLF
                     RFQNDTDRRLGTYYGADGMARRVNGVIHGRQIDFYLDWGNTVARSYGELSGMRFTGFL
                     ADDNRTLAGTLDDGSGTTQGFYAVKLRDYLSGTPGGSLGLSAYLGNWQIDGLDVTAGS
                     FSITAVNPSTGQVTGTVFGGDPLVGTVSPTQPRRFTFQLGGQSYEGYMLALDPGVMAG
                     KVGSSKGFIATRRDFSAPQVSIQSPQSGATLYRTQTYTLSGQARGDNGSGFIVDLPCR
                     WASSDAGDTQFPLQGSCNPTFTLRPGSPASVTFTLSATAQGGASAQTSVTVNVQNPPN
                     SGPPSVSIIEPASGSSASVGSTVTLGGRAVGGTPPYRNYRWSWQASKPGCAEIDISVR
                     ALPNQPIGGGQYWEWNTAGAQNIPNGCGFDNAGGTLRLYVTDDLNLTGSASIAFRLFY
                     VPPPN"
     misc_feature    177126..177890
                     /locus_tag="TCCBUS3UF1_1620"
                     /note="C1 Peptidase family (MEROPS database nomenclature),
                     also referred to as the papain family; composed of two
                     subfamilies of cysteine peptidases (CPs), C1A (papain) and
                     C1B (bleomycin hydrolase). Papain-like enzymes are mostly
                     endopeptidases with some...; Region: Peptidase_C1;
                     cd02619"
                     /db_xref="CDD:239110"
     misc_feature    order(177162..177164,177180..177182,177774..177776,
                     177828..177830)
                     /locus_tag="TCCBUS3UF1_1620"
                     /note="active site"
                     /db_xref="CDD:239110"
     gene            179299..179835
                     /locus_tag="TCCBUS3UF1_1630"
                     /db_xref="GeneID:12251517"
     CDS             179299..179835
                     /locus_tag="TCCBUS3UF1_1630"
                     /note="similar to Putative uncharacterized protein of
                     Meiothermus ruber DSM 1279 UniRef RepID=D3PKM1_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653286.1"
                     /db_xref="GI:384438562"
                     /db_xref="GeneID:12251517"
                     /translation="MKRFLIFALVLGSLGLAQKDPHPCYLMGIFNPNNTPNALGSVGF
                     VMSNEGLLQDGKPLSSPGGQAVAQAMAQSIGSVQPMYYCIHNLSGGVVQLQYFRSSPE
                     GAKDWLGKIRKGAPSWVGLQVGDEAGLFRGDQSQPGFNLAFRYREYAFLLTNSSVNDP
                     ESYRKWALAVIERVQKFK"
     gene            179884..180567
                     /locus_tag="TCCBUS3UF1_1640"
                     /db_xref="GeneID:12251518"
     CDS             179884..180567
                     /locus_tag="TCCBUS3UF1_1640"
                     /note="similar to Putative uncharacterized protein of
                     Meiothermus ruber DSM 1279 UniRef RepID=D3PKM2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653287.1"
                     /db_xref="GI:384438563"
                     /db_xref="GeneID:12251518"
                     /translation="MNKLWQTILVLALGLSLLALAQSAQRLILNGQVASTRVIVVQGV
                     AYVPLADVAKALGQTVVKVQGGYEIRAAGGANQLMGQFQGKVGDQILTGLFRVQVQKV
                     ERMESYTTRFDGGNRAIQPNNAQEELVVVTGVLKNAKQSGTVAPSLGTNNPGNTALAG
                     ADGRSFPPIAYDSPAGVNVGGGFTLLPGAALNFAVIFSVPRGTEAKALVLRVGEYGEV
                     GSKDVRVAF"
     gene            180597..181607
                     /locus_tag="TCCBUS3UF1_1650"
                     /db_xref="GeneID:12251519"
     CDS             180597..181607
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="similar to Zn-dependent alcohol dehydrogenase of
                     cellular organisms UniRef RepID=B3DXV2_METI4"
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent alcohol dehydrogenase"
                     /protein_id="YP_005653288.1"
                     /db_xref="GI:384438564"
                     /db_xref="GeneID:12251519"
                     /translation="MGQAGNNRAMRAMVLRRVGEPLALEDLSLPRPGPGEVLLKVEAC
                     GVCRTDQHIADGELPPPRLPLVLGHQVVGRVAALGEGVEGIPLGARRGVGWLGGTCGA
                     CKFCRRGQENLCPQAEFTGYGRDGGYAEYTLARAAFTYPLPEGLPAEGLAPWLCAGLI
                     GYRAYRMVRDREVLGLYGFGAAAHLLLQVARHEGKRVYAFVRPGDEAAKAFARELGAV
                     WAGDSTEDPPEPLEGALIFAPVGELVPKALADTEPGGVVVLGGIHMSPIPSMPYRLLW
                     GERTLRSVANLTREDARAFLEVAPKVPVRAEVEVFPLEEANRALEALRGGGLRGAAVL
                     VP"
     misc_feature    180624..181604
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="Zn-dependent alcohol dehydrogenases [General
                     function prediction only]; Region: AdhP; COG1064"
                     /db_xref="CDD:223992"
     misc_feature    180624..181598
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD2; cd08298"
                     /db_xref="CDD:176258"
     misc_feature    order(180735..180743,180750..180752,181062..181064,
                     181074..181076,181128..181145,181197..181202,
                     181218..181220,181251..181253,181311..181316,
                     181320..181322,181374..181379,181452..181460)
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176258"
     misc_feature    order(180735..180737,180741..180743,180801..180803,
                     180879..180881,181062..181064,181458..181460)
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176258"
     misc_feature    order(180735..180737,180741..180743,180801..180803,
                     181062..181064)
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176258"
     misc_feature    order(180894..180896,180903..180905,180912..180914,
                     180936..180938)
                     /locus_tag="TCCBUS3UF1_1650"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176258"
     gene            complement(181689..181877)
                     /locus_tag="TCCBUS3UF1_1660"
                     /db_xref="GeneID:12251520"
     CDS             complement(181689..181877)
                     /locus_tag="TCCBUS3UF1_1660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653289.1"
                     /db_xref="GI:384438565"
                     /db_xref="GeneID:12251520"
                     /translation="MASKPRSSYREFWLALLGALFGVWLYELQKEGGWQGIWRGIWPG
                     ILFFAGGVALVLYAYRKR"
     gene            complement(181948..182118)
                     /locus_tag="TCCBUS3UF1_1670"
                     /db_xref="GeneID:12251521"
     CDS             complement(181948..182118)
                     /locus_tag="TCCBUS3UF1_1670"
                     /note="similar to motif cd01948"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653290.1"
                     /db_xref="GI:384438566"
                     /db_xref="GeneID:12251521"
                     /translation="MGPILAHLVEMAHGLGLGVVLEGVEREEEVALARHLGCDLAQGF
                     LLHRPSPEPVCP"
     misc_feature    complement(181960..>182109)
                     /locus_tag="TCCBUS3UF1_1670"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cl00290"
                     /db_xref="CDD:260330"
     gene            182213..183673
                     /locus_tag="TCCBUS3UF1_1680"
                     /db_xref="GeneID:12251522"
     CDS             182213..183673
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="similar to c-di-GMP phosphodiesterase class II
                     (HD-GYP domain) COG2206;
                     similar to Hypothetical conserved protein of Thermus
                     thermophilus HB27 UniRef RepID=Q746H6_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653291.1"
                     /db_xref="GI:384438567"
                     /db_xref="GeneID:12251522"
                     /translation="MRSVALFLHLMRAETLPELHAWAAQGAMHLAQAEGAYLLRAEMG
                     RFRVVGAAGVGRVARGLRLPLEWEPYRGPTPPPGPLGFSPDGKARWGYLAHRGHLVLA
                     LEGTPSLSEDQEELLQMLLEAVALREGRMVGLSTLEGLLSLSRRLREGASLEAEVRGV
                     LEELLRYLGLDAGFLFGLAEGVLVPWVAAGEFPKGYPELYRRFPVVLGEGATRALEGG
                     KAFALIPDYQEYPHALPPMKQAGLRTVLLIRLERGDSPYGVLVLASFRRPRDVPPEAQ
                     TFLLVARGELEAHLERRLQVEGTLEAIAAILERLDYETEGHMRRVSELAVLLGERAGV
                     KDLEGLRMGAYLHDLGKLFIPREILEKDAPLVTQEWRVVKTHPEAGHEVLSRIPFLPQ
                     TALEVVLHHHEHWDGTGYPLGLKGEAIPLAARVFAVVDVWDALRSARPYKPAYPEEEA
                     MAELLAMAGRKLDPRLVELFLLLVREKVLTGKEKRR"
     misc_feature    182666..183049
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="GAF domain; Region: GAF; pfam01590"
                     /db_xref="CDD:250726"
     misc_feature    <183089..183640
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    183146..183577
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(183161..183163,183251..183256,183500..183502)
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    183254..183256
                     /locus_tag="TCCBUS3UF1_1680"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            183670..183894
                     /locus_tag="TCCBUS3UF1_1690"
                     /db_xref="GeneID:12251523"
     CDS             183670..183894
                     /locus_tag="TCCBUS3UF1_1690"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653292.1"
                     /db_xref="GI:384438568"
                     /db_xref="GeneID:12251523"
                     /translation="MKGETLEIFLDTPELPEAQREALARELQAAVERHLPGRPVRLLS
                     GVDGQGRRWLRLVIEMEPGRSLEAPKEVRG"
     gene            183945..186494
                     /locus_tag="TCCBUS3UF1_1700"
                     /db_xref="GeneID:12251524"
     CDS             183945..186494
                     /locus_tag="TCCBUS3UF1_1700"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653293.1"
                     /db_xref="GI:384438569"
                     /db_xref="GeneID:12251524"
                     /translation="MKRLGLWLFLAALPGLLGGCREGGPSFPPPYAARPDGVYKGGAL
                     LPLYGLNWFGLETCDRAPHGLWAGRSVGEFLAQVRGLGFNALRLPVSPEVLRDQGQVA
                     PWARTGDPGYPQSPLAGLRYVLERAQGLGFHVLLDLHTFRCDLIGGSLPGRPFDPARG
                     YTRGDWHADLRRLARLSLEFPNVFAIDLFNEPHGLTWSEWKALVQEAAQEVLKVNPRI
                     LVAVEGVGNLSDHGGYPAFWGGNLKEATDDLGLGDRLLYLPHVYGPSVHAMPYFSHPG
                     FPENLPPIWDLHFGHLSGRGLPWGVGEFGGRYTGQDQVWQDRFALYLRQKGVKVWFYW
                     ALNPNSGDTGGILQDDWRTPVAGKVNLLKGLMGAPSGQAFDFLPEGGEVPGPERGFSV
                     DSHYPNTPLLDAPGLVAQWRAQGFEVRLIRRVYYLHAFAGQDTLPQAFLHTLAQDLAS
                     AEAAGVKLILRFAYRPDENRAGGPTYCDPPTARILGHIAQLGPVLRSRIGVIAYLEAG
                     FIGPWGEWHSASPEAALMDPLPGYQEGAQPPCGRQNYDRKLPNAATLEIVQALLGEVP
                     GRKVALRYPMAKAKLVELAQGGVAGTYPSPSSFTPLTPQEAHGNTLKARLGAHNDCFL
                     ASADDYGTYYYTPGPQQEREKEYWSQDNRFTVMGGETCTPAPHVPSGEDPARYVYEQF
                     RRYRYNNLNLLYHPDMMAWFRSQPFGTGTLLEALKRDLGYRLYLRRVEVSGVHLSPNQ
                     AFTVRLYLENQGFGGLYNPKGLELVFIREGDGLRVARTLQATGFYGPPPGEEGMYAYT
                     VPAPGQPGTYALWLRIYDPDLPNNPAYSVPLASRLERREGRNALGFVVEVR"
     misc_feature    184077..184997
                     /locus_tag="TCCBUS3UF1_1700"
                     /note="Endoglucanase [Carbohydrate transport and
                     metabolism]; Region: BglC; COG2730"
                     /db_xref="CDD:225344"
     misc_feature    184086..184964
                     /locus_tag="TCCBUS3UF1_1700"
                     /note="Cellulase (glycosyl hydrolase family 5); Region:
                     Cellulase; pfam00150"
                     /db_xref="CDD:249631"
     gene            186588..186890
                     /locus_tag="TCCBUS3UF1_1710"
                     /db_xref="GeneID:12251525"
     CDS             186588..186890
                     /locus_tag="TCCBUS3UF1_1710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653294.1"
                     /db_xref="GI:384438570"
                     /db_xref="GeneID:12251525"
                     /translation="MPGPEIGIRTRGFGSRRPSQGWEFRGAEGRGPLGQGWPREERGK
                     KPPYAREVRRGQDPCGGLWCEKGFIPLEGKARGCGAGVASRVFTRFSHALGMIYRG"
     gene            186893..187381
                     /locus_tag="TCCBUS3UF1_1720"
                     /db_xref="GeneID:12251526"
     CDS             186893..187381
                     /locus_tag="TCCBUS3UF1_1720"
                     /note="similar to Uncharacterized protein conserved in
                     bacteria COG4719;
                     similar to Putative uncharacterized protein TTHB179 of
                     Thermaceae UniRef RepID=Q53VZ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653295.1"
                     /db_xref="GI:384438571"
                     /db_xref="GeneID:12251526"
                     /translation="MRKALVPALFLALLVALAQALNLDLRPYLVKAVEGKETYEENPL
                     GVRPGDLLEWRLLAENRSQGALRQVALVIPIPKETRYLEGTAKPLSLGSATIRPEFSF
                     DGGKTFGFPPLKKRIRVVENGKEVEKEVEVKPEEYTHARWVLPEMPKGARVQVSLRTV
                     VK"
     misc_feature    <187028..187378
                     /locus_tag="TCCBUS3UF1_1720"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4719"
                     /db_xref="CDD:227063"
     gene            187398..190064
                     /locus_tag="TCCBUS3UF1_1730"
                     /db_xref="GeneID:12251527"
     CDS             187398..190064
                     /locus_tag="TCCBUS3UF1_1730"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653296.1"
                     /db_xref="GI:384438572"
                     /db_xref="GeneID:12251527"
                     /translation="MKRIHVGFLLVVLMGLALAAGTPAGTAITNQATATYIDSAGQPR
                     TTTSNLVTTIVQQVYSFTITPDGNNEGNPGQVRSGLPGSQVLFNYRVRNNGNGTDTIN
                     LSIAQGTSDNFDLQNVRIHLDANCNGNVDAGEGQVTQVTLPADGEACLVVAAVIPSGA
                     TSGQYGNLNLVGTSQGNASVVDNNNWARAVATAQAALTAFKAATPSGSVAPGTPITYT
                     ISGANTGGSGAYGYPVTVDSTSRTGILIEDVIPNGLRVTAMPTGSAGAGTVRFVYNTG
                     SGWSTLTSSNLPLTGNGTVRIGMLIEGSGPFFPQGAQYTFSFQAQVPSGVPAGTSYSN
                     FAVVRFDANGDGDADDPGETVTTNTTTNTVGAAYAVQVGPYGYPLGNGTGTYLVGAYT
                     ITRNADQQTVSAVYSGTTVIFRHTLRNTGNTADSFTLSPSGQPSGWACQLVADDLATP
                     ISGPVGPVAAGADLNFALRCQVPAGYTSASAINITVTATSVGDPSKWDATQDTVTQVL
                     LGYGVDLAARGRAGDNDQSNDNPPAQSANPGQAAYFPLEVYNAGQNPDVYNLAASLPS
                     GWSAIFYPDANCDGMPDGAPITNTALLNPGAKQCVVAAVSVPAGTAPGSNPVGFTATS
                     TTLPGVSDVVSSTVTVNLVAQVTLDPDRSGTVTSPGTLVYTHTLTNSSNAPAYCDISG
                     NGGAHGWTYQYSTDGSNWYGALTDVYVAPNGGTATIYVRLQVPAGQPVGRTDVNTVTA
                     NCDVTTGTPDNVYEATDTATETTTIVGGELRLQKTVDKSTAYPGDVLTYTVTAENIGT
                     GNLKEVKISDPLPHHTTFVSISATATGFPAGATILYSTDGTTWSSTPPTSLPAGGVVY
                     VGVDTDGDGNITSADFMLPAAKVTITLKVQVQ"
     misc_feature    189717..189875
                     /locus_tag="TCCBUS3UF1_1730"
                     /note="conserved repeat domain; Region: B_ant_repeat;
                     TIGR01451"
                     /db_xref="CDD:213626"
     gene            190201..192876
                     /locus_tag="TCCBUS3UF1_1740"
                     /db_xref="GeneID:12251528"
     CDS             190201..192876
                     /locus_tag="TCCBUS3UF1_1740"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653297.1"
                     /db_xref="GI:384438573"
                     /db_xref="GeneID:12251528"
                     /translation="MLGRNRMWPKSFGALLWLLSIAFALTPAGTVIRNQAVAYAGGER
                     YLSNEVEVLVRPLCVPLLSPDGTTALPGQEAGVSPGGYAYLPFLLTNGGNDRFSLRLS
                     HLFGPRDWNPEEVHLYPDRDGDALPDPGASPLAEVSLAMGESLRLVLRVKAPSGASGA
                     LLLSPVASCPEGQEDRDNWARVVVQPGPVLALQKGMPLEALPGQEVLVVLRVRNLGDR
                     EAQGVVATDAPLPLPFVPSSASAPKGRVEYWDGALWAPSEPSGVRGVRLVLERLGVGE
                     EAFLAFRLLVPPGTPPGFVENLARAEGPGGPVEARASLRVLPLYAHHLGPRGNPRALP
                     GGEGSPDDRQAQRGLEGQTLCFAHTLENAGTGQDTYDLRVEGLPQGVDFWWEGPTGTP
                     LGLPLTLSPGESRDFSLCLRPSAPMGFTARVVATSRATGASNATWDLLEVLPASALTL
                     WKEADPPSGTTLRPGQEVVYTLRIQNAFAPLRGARVEDALSPWLEFVEASHGGLWDPT
                     RRLVVWNLDPLPLGETRLTLRVRVREDTPDDTLVQNAFSLRAQDLTQPILSPPTRHPV
                     FGVRLLLRKEVSPKSARVGDLLLYRLTLENPSPSLLTVRLRDLPPPGTAYEPGTAFLG
                     CGASKLPLEPKVQEGLLLWEGLELPGRGRICLEYKLRLLPGAPEELVNTAEAQGLSAN
                     GAATASGRAQALARLDLGPFALGGVLLGRVFLDLDGDGVFGKGDLPLPGARILLSNGT
                     QALTDAMGRYAFRNLSGLHQVMLDPDSAPFAPLPLPEGLGEGYRKRVLVQGATVADFP
                     LRVPKGYVRVLRATTLRMGPLSVEKRVVEVAGKALAELRVRSLEALPELTLRDPLPGG
                     GERVFAFGLFQGEEVLAYPLERPILTDPEVRWRYP"
     misc_feature    190723..190920
                     /locus_tag="TCCBUS3UF1_1740"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     cl17728"
                     /db_xref="CDD:266796"
     misc_feature    <191524..191700
                     /locus_tag="TCCBUS3UF1_1740"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     cl17728"
                     /db_xref="CDD:266796"
     misc_feature    <191902..192060
                     /locus_tag="TCCBUS3UF1_1740"
                     /note="Domain of unknown function DUF11; Region: DUF11;
                     pfam01345"
                     /db_xref="CDD:250549"
     gene            192873..197318
                     /locus_tag="TCCBUS3UF1_1750"
                     /db_xref="GeneID:12251529"
     CDS             192873..197318
                     /locus_tag="TCCBUS3UF1_1750"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653298.1"
                     /db_xref="GI:384438574"
                     /db_xref="GeneID:12251529"
                     /translation="MRFGLVLLLAFLLIQGVVGASEAPKAELRVRVFLDLPGGERPGE
                     GLLRAGGEERRVVGETVLALAPGRYPLAFLVEGAEVEGPSEVVLAPGERREVVYRLRP
                     RVELVLTPPSQRLPEGEEARFLLRATTDYPGLLPGELALELPEGLEALSPTRLVGVLS
                     RGRPAELSVAVRGPVGQYQVRGVLAPYGLVRAAGVEFYRKATFALRKEALTPRVERGG
                     EARFRLTVANQGDEAGRVRLRDLGGEGLEGPGLDQEVYLEAGQARSYEVAFRVVGEGV
                     AVNRAELLGPEGVVARAEARVEVLLPKPLLARELPFRRYLPGEAVEHRLVVRNLGQAP
                     LRYVLEDTCPDFLEPSGARFEGTLPPGGETVHTYRAQVRFGLEAEGVCQALLRHQGEG
                     VRAEVPLARVLLDLRKEVSPQRILEGSEATFLLKVHNPADHPVRVRLLDTPPKGLPME
                     GLAWEGLLEAGEVRIFPLKASGVPAGLHVNRASAFVGEVPAAFPAEASLAALPLLLPE
                     RLSEMALPFRVEGRGEELLLAFSLPEGAEYVPGSARILREGSLLPLADPLFLQEGGRL
                     YWRLPFQGEGEVRFLLRHREALPPLAEPGLTLLASGREVPLQGAASLAEYRRAKPLKG
                     ERQGAIREPQDGQVFQDQGAIRVVVEAPLGPLVLRVNGEPVGQDRLGKAELDEGRGWQ
                     RLEYYGVPLRVGRNLLEVEGVAQDRLEVFRAGNPVRLRLTLVEAKTDGRTPLRVLVEA
                     LDENGLPSGFGPLSVETDLEPLNPDAFLALSGYQILLKDGRGELLLRPLVAPREFYVR
                     VGFNRLEAQSRFFAGEGAKGLWLAQGSVGVALRDPGAGLRLENLHPFGLARAYAEGPF
                     LGGQAQGALDTAGGLGQKLTQERFPVTGAAAEPKRPLTSDDPIAFRYDQPGFTLAYER
                     APLGASLPEATALRLSTRGEARLEGFLALLPRGIVRETIRPDGTSFYRLSQPPRPGSL
                     TLTLVEGSKETRLEAGRDYAVDDLGNLQLARPLFPTTPDLAPVYLVAEYAPQNAPRDL
                     LAYGLGAAYEGGGWRFGLSAAYLGAWRYGAELGYQEGTDRLGIRAGYAEGRLSLALGA
                     EARLGAFRLRGDLRSEDLAQGVRGLQGEARLAYEEGSLGVALEQTTPAQTAFLLEYRT
                     RPFSLGAGLGYLWTEGALALLGRAGYEEGGRRLLLTHTQALGPAKAITRLDAGLPLDP
                     NLGLEAGLAYTWGEGFGGTVALKQRFQGANLALSYELPTASGQGNRARFGVEAPLPLD
                     ERWSLNLSAGAERSFARGEGLTSFGLAARYKAEEFSATLGAETAFAQETKLVLKGGAA
                     GSLDPENTLSADFAYQVLPRPQGRFTLAYALFAPQANLLTYHRLLWEGEPVLEGEALF
                     AYHQPGFQLRPGLAYRVKPQDPAANTFQVGLGGNLYLTERFGLGAALYYVFQPATGRS
                     RLAPSAEFSLRALEGLWLNLGYGFGESLLQPEGLYLRLDLFGGSR"
     misc_feature    <195894..196361
                     /locus_tag="TCCBUS3UF1_1750"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            197843..198934
                     /locus_tag="TCCBUS3UF1_1760"
                     /db_xref="GeneID:12251530"
     CDS             197843..198934
                     /locus_tag="TCCBUS3UF1_1760"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653299.1"
                     /db_xref="GI:384438575"
                     /db_xref="GeneID:12251530"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     misc_feature    <198272..198712
                     /locus_tag="TCCBUS3UF1_1760"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            199622..202252
                     /locus_tag="TCCBUS3UF1_1770"
                     /db_xref="GeneID:12251531"
     CDS             199622..202252
                     /locus_tag="TCCBUS3UF1_1770"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653300.1"
                     /db_xref="GI:384438576"
                     /db_xref="GeneID:12251531"
                     /translation="MGSLKNNAHPHALAVLSGTTYYQATASKHFSGAGGMVFYLGGHN
                     YNDNNLPSYNGRRMFLNTVFVPSTRPQTCGLLFGMLRGSVFLDLDADGIWDAGEPPLP
                     GISVNLTGPENRTLTTSNSGSFAAGVDLGTYQVTVVVPSWAQVTTGNAIQTLNVLPYR
                     VNQTTPVGLTYQASPLSGQLVINELLFRQRSGDVDEFIELYNAGSSPVDLTGFRLMDG
                     NILINLPNLLDGTGSITGSNTPFSFPSGTVLGPGEYLVVWVGSPSTERNAPGARYQFY
                     LAQTQPRLNDSGDDLWLYDAQLRLVDYVAWGSFSENYYPRHLWDASYQANLVSVGPGQ
                     SISLTPNGQDTHTSACWEPTTSNQAQGRCLGWLPTVDTDEVAGRITSVGRNNNGFTVA
                     GFVYHDRQPNGMRDPAEDWSDGATIWVKLVQGSTVVATAQVDPGSGAFGFQGVMPGSY
                     TLLVDNNSSTSDLTPTPPSGWLFVTPPGGSLSVNVSGNVQGLLFGLFQGSLVEGRVFW
                     DDGLGGGVANDALQNGGEGGVGGVEVRATDGANLRTALTDGAGFYRLYLPASWGSVVL
                     SHPLRPATGWNDGSVAQRVTSWSQAASPSSPGAQVALGAASNLAGSTLVRNFGAVRES
                     RLYPDGSGQTGSPGVYTFAHSYRPGTLGSVVFSLASPPRYAYQVRLDANCNGSFDPGE
                     GWTPFPASLAVGPTWPREPDGSLRACALEVRALVPAGEPQGAVDVALVQATLTWANLA
                     SVQEVDGLTDTLQVVGGEVRLSKRVRNVTQGTPLGTTGQGRPGDILEYCIAYRNLGTS
                     PVGSFTLTDPVPFFTNPESSVGDYGNRAIRWVQGGTTSFLTAAQDGDAGEIVGGVVRV
                     LVGSLGPGGEGEVCYRVRVR"
     misc_feature    200153..200554
                     /locus_tag="TCCBUS3UF1_1770"
                     /note="Lamin Tail Domain; Region: LTD; pfam00932"
                     /db_xref="CDD:250237"
     gene            complement(202271..202627)
                     /locus_tag="TCCBUS3UF1_1780"
                     /db_xref="GeneID:12251532"
     CDS             complement(202271..202627)
                     /locus_tag="TCCBUS3UF1_1780"
                     /note="similar to Putative uncharacterized protein of
                     Rubrobacter xylanophilus DSM 9941 UniRef
                     RepID=Q1AYN8_RUBXD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653301.1"
                     /db_xref="GI:384438577"
                     /db_xref="GeneID:12251532"
                     /translation="MPVLVDFHSESVFEKLGCTYLFDGQISALLGTHTHVATQDARVL
                     PKGTAYVSDVGMVGADGGYQGYEPDFLVEALRRRLPPKGLALRPASGPLRVSYIFLEL
                     EGKRARAIRHASEILD"
     misc_feature    complement(202295..>202621)
                     /locus_tag="TCCBUS3UF1_1780"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     gene            complement(202634..203062)
                     /locus_tag="TCCBUS3UF1_1790"
                     /db_xref="GeneID:12251533"
     CDS             complement(202634..203062)
                     /locus_tag="TCCBUS3UF1_1790"
                     /note="similar to Metallophosphoesterase of
                     Thermanaerovibrio acidaminovorans DSM 6589 UniRef
                     RepID=D1B651_THEAS"
                     /codon_start=1
                     /transl_table=11
                     /product="Metallophosphoesterase"
                     /protein_id="YP_005653302.1"
                     /db_xref="GI:384438578"
                     /db_xref="GeneID:12251533"
                     /translation="MRVLFFGDVVGEPGVRALERELPRLRRELEPDFVVANGENLDLT
                     VPELGKAGMRPESVERLVRLGVDALTGGNHSFDPPEAEMVLGHARVLRPLNYSRHAPG
                     KGSLLLRKGGRELLVVNLAGRSALPLAGDPLEALEALLEG"
     misc_feature    complement(<202640..203059)
                     /locus_tag="TCCBUS3UF1_1790"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    complement(order(202841..202846,202946..202948,
                     203033..203035,203039..203041))
                     /locus_tag="TCCBUS3UF1_1790"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    complement(order(202844..202846,202946..202948,
                     203033..203035,203039..203041))
                     /locus_tag="TCCBUS3UF1_1790"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            complement(203059..203871)
                     /locus_tag="TCCBUS3UF1_1800"
                     /db_xref="GeneID:12251534"
     CDS             complement(203059..203871)
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="similar to ABC-type sugar transport system,
                     permease component COG0395;
                     similar to Binding-protein-dependent transport systems
                     inner membrane component of Bacillus tusciae DSM 2912
                     UniRef RepID=D5WR51_BACT2"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="YP_005653303.1"
                     /db_xref="GI:384438579"
                     /db_xref="GeneID:12251534"
                     /translation="MGRRLLPHLLLLLAAGLTLLPFAYQVGLSLTPPQALFTSPWPFA
                     HPLTLENYRVVLEKLPWARYTLNTLAFALGSALGQVLLGVLAGYAFAFRRPPLGGFFL
                     GLFVLSMLVPFVVTYLPSYLLVARLGLLNTFPGLILPMLTAGYAAFLLRQHFLGFPRE
                     ILEAAIVDGAGTKDLLLRVLLPANRPTLLALFLTLFIGAWNQFVWPMLVANRPEMYVL
                     TVAVQRFAGGEGSNAWGPLMAASVLATLPTLVLFLLFHRRILETLMEGGVRG"
     misc_feature    complement(203068..203787)
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(203125..203676)
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(203125..203130,203137..203142,
                     203149..203154,203158..203163,203170..203172,
                     203176..203178,203206..203211,203248..203253,
                     203260..203271,203290..203292,203299..203304,
                     203344..203346,203395..203397,203404..203409,
                     203419..203421,203425..203430,203437..203439,
                     203443..203445,203509..203511,203515..203520,
                     203527..203556,203560..203571,203599..203601,
                     203614..203619,203626..203631))
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(203254..203271,203509..203553))
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(203176..203178,203206..203208,
                     203215..203217,203251..203253,203449..203451,
                     203509..203511))
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(203323..203325,203335..203340,
                     203356..203394))
                     /locus_tag="TCCBUS3UF1_1800"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(203864..204781)
                     /locus_tag="TCCBUS3UF1_1810"
                     /db_xref="GeneID:12251535"
     CDS             complement(203864..204781)
                     /locus_tag="TCCBUS3UF1_1810"
                     /note="similar to ABC-type sugar transport systems,
                     permease components COG1175;
                     similar to Glycerol-3-phosphate ABC transporter permease
                     of Bacillus clausii KSM-K16 UniRef RepID=Q5WL74_BACSK"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycerol-3-phosphate ABC transporter permease"
                     /protein_id="YP_005653304.1"
                     /db_xref="GI:384438580"
                     /db_xref="GeneID:12251535"
                     /translation="MQGVGAARGLGQGGRRRQADLEALLLLAPGLLLLLVFVYWPLLY
                     NLWLSLHDWNLVRPKAEFVGLANYRLLLQDPLFGQLLRQSLLYMGLALLGNFLLPLGL
                     ALLTLQVKGRWAELYQALLFAPTVAAVSVAALVWLYLYLPAAGPLAKGLAALGLPAPN
                     FLADPRYALPAIALVANWKFLGFHYLIALAGLKALPREVLEAARVDGAQGWPLLRHVL
                     LPLLFPTLLFLLLSALASALDYAFVPVEVMTQGGPFGHTSHLMYAVYQEAFRFFRAGV
                     AAAQAVLLTLGLGALILGQLYLLGRRGYG"
     misc_feature    complement(203867..204676)
                     /locus_tag="TCCBUS3UF1_1810"
                     /note="ABC-type sugar transport systems, permease
                     components [Carbohydrate transport and metabolism];
                     Region: UgpA; COG1175"
                     /db_xref="CDD:224096"
     gene            complement(204769..206049)
                     /locus_tag="TCCBUS3UF1_1820"
                     /db_xref="GeneID:12251536"
     CDS             complement(204769..206049)
                     /locus_tag="TCCBUS3UF1_1820"
                     /note="similar to ABC-type sugar transport system,
                     periplasmic component COG1653;
                     similar to Extracellular solute-binding protein, family 1
                     of Bacteria UniRef RepID=Q2RIE5_MOOTA"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular solute-binding protein, family 1"
                     /protein_id="YP_005653305.1"
                     /db_xref="GI:384438581"
                     /db_xref="GeneID:12251536"
                     /translation="MKGMKGLLGFVVAAGLSLAQAPITLQYWHINTEVFGLPALRELI
                     REFERRNPGIKVEERYNPNAYTGLLQNLQAALAAGNPPDVVQMGYLYTRYAAKNLPYV
                     PIDELAKRYGGERHLRRFAPNVLALGQVDGVLVGMPYSLSNIVAYYNADLFRRAGLDP
                     DRPPATWEGWRRAARQIKERTGKYGIYLILLDDNWAVEALIRSNGGTLLRCEGGFFRT
                     GLDSKEAAEALGMWAGLVREGLALGVPLQQGEQAFLAGEAASFMTTIARRAGLQEQTR
                     GRFELRATRFPTFGGKPPALPSGGNVLMVFSQDPKRQEAAWKFIQFLTSPEGFTLWTK
                     GTGYVPLLPELIRDPRYLKDFVEKNPIQRVAVEQLPFTAPWTGFPGPNGLAASQTLFR
                     AVQKALAGQATPEAALKEAAAEINRLIGTERCRE"
     misc_feature    complement(204838..206049)
                     /locus_tag="TCCBUS3UF1_1820"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    complement(204970..205926)
                     /locus_tag="TCCBUS3UF1_1820"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            206110..206493
                     /locus_tag="TCCBUS3UF1_1830"
                     /db_xref="GeneID:12251537"
     CDS             206110..206493
                     /locus_tag="TCCBUS3UF1_1830"
                     /note="similar to Putative HEPN domain of Thermomicrobium
                     roseum DSM 5159 UniRef RepID=B9L2T5_THERP"
                     /codon_start=1
                     /transl_table=11
                     /product="HEPN domain-containing protein"
                     /protein_id="YP_005653306.1"
                     /db_xref="GI:384438582"
                     /db_xref="GeneID:12251537"
                     /translation="MNRARDWLEQARHNLGHAQRSLDLGDYAWACFAAQQSAEAALKG
                     LHLSKGQVAWGHSILDLLSGLPEGVEPPEALLEAAKVLDKYYIPTRYPDAHPAGPAAR
                     HYTRLEAQEALRLAEEILRFVEARM"
     misc_feature    206119..206481
                     /locus_tag="TCCBUS3UF1_1830"
                     /note="HEPN domain; Region: HEPN; pfam05168"
                     /db_xref="CDD:253056"
     gene            206490..206894
                     /locus_tag="TCCBUS3UF1_1840"
                     /db_xref="GeneID:12251538"
     CDS             206490..206894
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653307.1"
                     /db_xref="GI:384438583"
                     /db_xref="GeneID:12251538"
                     /translation="MTRIFPFDPKARLEEVRRAAQSLQEWPEVLGVVLFGSLARGEAT
                     AFSDADLLVLLAHTPLPFPERLLRYRPQGVRGVEVFPYTLEEVRQSLRGAWGLAPVAL
                     REGVVLWEREGALRALAAELGDAILGGSAGGG"
     misc_feature    206517..206813
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(206592..206600,206607..206609,206628..206633,
                     206637..206639,206721..206723)
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(206592..206600,206607..206609,206628..206633,
                     206637..206639)
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(206631..206633,206637..206639,206721..206723)
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    206721..206723
                     /locus_tag="TCCBUS3UF1_1840"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            complement(206863..207768)
                     /locus_tag="TCCBUS3UF1_1850"
                     /db_xref="GeneID:12251539"
     CDS             complement(206863..207768)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="similar to ABC-type spermidine/putrescine transport
                     systems, ATPase components COG3842;
                     similar to ABC transporter related protein of Meiothermus
                     ruber DSM 1279 UniRef RepID=D3PR79_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653308.1"
                     /db_xref="GI:384438584"
                     /db_xref="GeneID:12251539"
                     /translation="MRLEGLSKRYPRGGGVEGVDLEVGEGEVLVLLGASGSGKTTLLH
                     LVAGLLLPDRGRVYLGGKEVTHLPPERRQVGYVFQDQALWPHLTALEHLLLVMPRPDR
                     KEALALLERVGLLDHAGKRPGELSGGQRQRVGLARALARRPKVLLLDEPYSALDPVLR
                     EELRLEVRVLLKEMGTTALHVTHDPEEAMLLADRVGVMAEGRLLQVGSPEEVYEAPGS
                     LAAFLALGRANLLPQDGEVLAFRQEWVREGGEVEALVLERRTLRGEVLCRVHLPWGEA
                     WVRLEARPGERVGLGFTRLLRFPQG"
     misc_feature    complement(206887..207768)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(207148..207768)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="ATP-binding cassette domain of the carbohydrate and
                     solute transporters-like; Region: ABC_Carb_Solutes_like;
                     cd03259"
                     /db_xref="CDD:213226"
     misc_feature    complement(207649..207672)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(order(207220..207222,207319..207324,
                     207532..207534,207646..207654,207658..207663))
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(207532..207543)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(207367..207396)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(207319..207336)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="Walker B; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(207301..207312)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="D-loop; other site"
                     /db_xref="CDD:213226"
     misc_feature    complement(207214..207234)
                     /locus_tag="TCCBUS3UF1_1850"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213226"
     gene            complement(207765..209222)
                     /locus_tag="TCCBUS3UF1_1860"
                     /db_xref="GeneID:12251540"
     CDS             complement(207765..209222)
                     /locus_tag="TCCBUS3UF1_1860"
                     /note="similar to putrescine transporter subunit: membrane
                     component of ABC superfamily PRK10592;
                     similar to Binding-protein-dependent transport systems
                     inner membrane component of Meiothermus ruber DSM 1279
                     UniRef RepID=D3PR80_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="YP_005653309.1"
                     /db_xref="GI:384438585"
                     /db_xref="GeneID:12251540"
                     /translation="MKTLPLLRIFLWGLALALALPLFLLFLRGLPTFPRTLQDLDVVL
                     QSLALAGAGTLLTLLLALALAAWGLLGRVGRGWEGLLLLGYLVPPFVTGMGVLFSLEG
                     IGMEAYGAPGILLAWTLHYTPLAYLLLKPQVRVALGLLGAARVHGVVGVRALRVFLPP
                     LLPPLLAAGGALYLALLGNFGVPAVLGLPERVYVLPTLAYARLMSPLAQDPLGEAAAL
                     GIWLALLALPALLLSRPPLLEAQEPLLPPPRPIYRHLFALYALLALALTLLGLVREAL
                     QNPYTGALDPAFGEALALPLVQRGLRNSLLLALATTGLLLLLALALRPFPQALGRLRR
                     VLDLHYLLPGTLLGLGLILLLGPTPLYGTPWILFLAYLLNFAALALRALEGSVRVEGA
                     VWAGRVHGLGAWRAWLRLGYPLLLPSAFAGFFLIFPLAFAEITLSALLYAPGAETVGV
                     AVLSALNGGLYREAAALGLLLMALSATTLLGRPRW"
     misc_feature    complement(207840..209000)
                     /locus_tag="TCCBUS3UF1_1860"
                     /note="ABC-type Fe3+ transport system, permease component
                     [Inorganic ion transport and metabolism]; Region: ThiP;
                     COG1178"
                     /db_xref="CDD:224099"
     misc_feature    complement(207813..>208145)
                     /locus_tag="TCCBUS3UF1_1860"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     gene            complement(209219..210163)
                     /locus_tag="TCCBUS3UF1_1870"
                     /db_xref="GeneID:12251541"
     CDS             complement(209219..210163)
                     /locus_tag="TCCBUS3UF1_1870"
                     /note="similar to ABC-type Fe3+ transport system,
                     periplasmic component COG1840;
                     similar to Extracellular solute-binding protein family 1
                     of Meiothermus ruber DSM 1279 UniRef RepID=D3PR81_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular solute-binding protein family 1"
                     /protein_id="YP_005653310.1"
                     /db_xref="GI:384438586"
                     /db_xref="GeneID:12251541"
                     /translation="MKGKSVLTLALLVGSALAQGTLTLYTSEVLADVNALVEAFRARN
                     PGVQVQVFRSGTGEVVAKLRAELEAGNPQPDLLWFANEDFLKELGAKGLLRRVPPTVP
                     GYPVQYAPGGGLYHEVRLLYNILAVNTQRVRTPPALWRDLLRPEYRNLLAMPDPNFSG
                     AALATVGTLAERLGMGFFAQLKEQGLRIEQSNPVLQQKLARGEYGLAITTDFGVRQEI
                     ARGAPLAVVYPRDGAILVPTPVAVASWSKNPELAVRFLNFLLSPEAQRIFAERGYYPV
                     MPGAPRPQGAPEQVVGLKARFADSATLERFNTLFGLRR"
     misc_feature    complement(209294..210058)
                     /locus_tag="TCCBUS3UF1_1870"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            complement(210329..211606)
                     /locus_tag="TCCBUS3UF1_1880"
                     /db_xref="GeneID:12251542"
     CDS             complement(210329..211606)
                     /locus_tag="TCCBUS3UF1_1880"
                     /note="similar to Uncharacterized protein conserved in
                     bacteria COG4222;
                     similar to Putative uncharacterized protein of Meiothermus
                     ruber DSM 1279 UniRef RepID=D3PTP2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653311.1"
                     /db_xref="GI:384438587"
                     /db_xref="GeneID:12251542"
                     /translation="MKNLLPLLTLLAFLGYLASPRGAGQGEATPALELVGWALLPADT
                     FAPGPPSGAYRETPGFRSPSPAFAGQPVQGFSAIQRGPVAGTYWVLSDNGFGSKANSP
                     DYLLRLYLVRPEPKTAQGGEGGVEVLRHVQLRDPLRKVPFPILNEGTRERLLTGYDFD
                     PESFVIGPDGSLWVGDEFGPYLLRFGPDGVLLDPPYPTPDFGQGKDPAKDQVRAPQNP
                     ALLLNPPAPGQAYPANLATSRGFEGMAINPGKTRIYPMLEGAVAGDPPGTLRIYEFDP
                     AARRYLGLAGLYRLEDPAHAIGDIVAVNEEEYLVIERDSRQGDEARFKRVYLVNLKRK
                     DAQGFVSKELLVDLLNLRDPRGLSPFSRGGAYRFPYFTIEAVLPLDGETLLLVNDNNY
                     PATGGRGAGVKDPNEFIWIRLAKPLNLDPALKR"
     misc_feature    complement(210386..211525)
                     /locus_tag="TCCBUS3UF1_1880"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4222"
                     /db_xref="CDD:226675"
     misc_feature    complement(210419..211408)
                     /locus_tag="TCCBUS3UF1_1880"
                     /note="Esterase-like activity of phytase; Region:
                     Phytase-like; pfam13449"
                     /db_xref="CDD:257774"
     gene            211807..212175
                     /locus_tag="TCCBUS3UF1_1890"
                     /db_xref="GeneID:12251543"
     CDS             211807..212175
                     /locus_tag="TCCBUS3UF1_1890"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653312.1"
                     /db_xref="GI:384438588"
                     /db_xref="GeneID:12251543"
                     /translation="MPELEVSRRFGLVVPDGVLLAREGEGPVEVTEFRFPPDSSYRAY
                     SLEELGERLRAQLEARGFSLRCRTYNALPLFGGPQYTVRLARGAEGVGTFLRPLPQPD
                     AYRVEVAPGDPNPPLGCPAR"
     gene            212272..213555
                     /locus_tag="TCCBUS3UF1_1900"
                     /db_xref="GeneID:12251544"
     CDS             212272..213555
                     /locus_tag="TCCBUS3UF1_1900"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653313.1"
                     /db_xref="GI:384438589"
                     /db_xref="GeneID:12251544"
                     /translation="MRKPSPLFWTLSLLALLGAQGQAPGAGEVQVVGPYALPPTPIRA
                     LNPHLREAEVQEALRRGWPVADRPAIGSGLAYLGGGRFLGLTDRGPNGDCPGGKFFPL
                     PRFAPALVPFRLDEAGRAIRLEAPLLLRTPGGSPLTGLPNREEEDIPFAAADCKEKLP
                     LDPSGVDTEDLAVLPGGKGYLLVEENSPSLLYVDPRGRLLVRYTPEGVRFSARYPVRD
                     ILPKVLALRRNNRGLENLALSGDGKTAWAVLQSPIGSTRDPAYDASLVARAVRLDVSD
                     PERVRVTGMYLVPFSDPKDYPKPNRPRDMKYSAATWVDGEKILLLERAEGGARVYLVD
                     FAQATDLLAHPKGASPELDRAGTDYAALGIRLAPRRLLLETWRFPAFDTDKLEGLALL
                     EDGRTLAIVDDNDFAITGKEGPSRAWLVRLAEGLR"
     misc_feature    212440..213489
                     /locus_tag="TCCBUS3UF1_1900"
                     /note="Esterase-like activity of phytase; Region:
                     Phytase-like; pfam13449"
                     /db_xref="CDD:257774"
     misc_feature    <212731..213522
                     /locus_tag="TCCBUS3UF1_1900"
                     /note="SdiA-regulated; Region: SdiA-regulated; cl19046"
                     /db_xref="CDD:267399"
     gene            213571..216987
                     /locus_tag="TCCBUS3UF1_1910"
                     /db_xref="GeneID:12251545"
     CDS             213571..216987
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="similar to Predicted extracellular nuclease
                     COG2374;
                     similar to Extracellular nuclease containing Fibronectin
                     III domain of Bacteria UniRef RepID=Q1IZR2_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular nuclease containing Fibronectin
                     III domain protein"
                     /protein_id="YP_005653314.1"
                     /db_xref="GI:384438590"
                     /db_xref="GeneID:12251545"
                     /translation="MRKVGWLWLWTVGLLAACTGQRSSTGGETPVRVLNVPDTVQAVT
                     LEVNGTPYPVAREGEVWTARVRLPQGEHTFIARGLDAPGGIVLYKAHERKRVVPGQEV
                     RLRMYRLTSDLEVEVENPAPGEAYLAKAAGAMAALPGGRGLLQGVPTGRGVSLLVEAR
                     DPSGMLLRQGTAQVDLSETPRSVRVRLGEVAHEPPRVRLVGPVQVERGQAYTLRVEAE
                     DPNPQDRGVVLSRLAVEWGDGAREEVALSGRQAVRELVHTYTASGSYTVSVRVENSAR
                     LAAQESLALAVLEPETPVTIEPGPDLARVALAVTGAPEGTEALLAEITPETPLVPQAL
                     RPLDLRNRYQVALFPQGGAWRGGLHLPRGLGYRLLLRARVGGQEVLSREEAFRTDGAE
                     VVLERPFVPAPEYACPAPGAPLKAAYEVQGRGARSPLEGQTVAVRGVVTAFFPGLQGF
                     FLQDPRGDGDPATSDGLFVYYGNTSLSLTPGQYVQVVGQVAEYAASGDTLGTLTQLRL
                     SGHAVCGEAGLPQAVSLSLPAQDLEALEGMRVRLSGLTVTEVYNLGRFGELTLAPSRL
                     VHPNADGDPATRLDPNTPPYPGHTLVLDDASTRQNPSPIPYLPQGGTLRVGDRLVAAE
                     GVLEWRYGAYRLQPTQAPTFQAANPRPAPPSGPGLRVASFNLYNWFTTLSGTFTPPGC
                     TTPLDRRGATSQQELERQRAKLVAALTALDADVVALQEVQNNGATAIQALVDALNAAL
                     GPGTYAYVPDPEGGLGCDAIKVGFIYKPARVEPVGAPKALQSPTFERYPLAQAFRDKA
                     TGGVFTAVSVHLKSKGGCDPSDPDTGQGCWNRRRTAQAQALAGWVDTLKAVDPDVVVL
                     GDFNAYEEEDPLALLRGRGLVPLLSGHHTYVYMGLSGALDHAYATPSLSAQVRGALAW
                     AINAEEPRVLDYTLANKPDDRFAPDPYRSSDHNPLLLRLELAPDRPPCAGEGARVVIN
                     EFRFRGPSGGNDEFIELFNRSCTPVNLGGWKVQGLSGTGSTWSDRATLANVTLEPGQY
                     YLLANTSSGGYSLGVAPDQTYTTGISDNRAVRLLDAGGQVVDLVGFASSGQFEGQGLA
                     DGPTSSTGLGQISWKRIPSGKDTDNNLQDFQFGQGWANPQNRQSPLYGDN"
     misc_feature    <214258..214431
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="polycystic kidney disease I (PKD) domain; similar
                     to other cell-surface modules, with an IG-like fold;
                     domain probably functions as a ligand binding site in
                     protein-protein or protein-carbohydrate interactions; a
                     single instance of the repeat is...; Region: PKD; cd00146"
                     /db_xref="CDD:238084"
     misc_feature    214876..215121
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="YhcR_OBF_like: A subfamily of OB-fold domains
                     similar to the OB folds of Bacillus subtilis YhcR. YhcR is
                     a sugar-nonspecific nuclease, which is active in the
                     presence of Ca2+ and Mn2+. It cleaves RNA
                     endonucleolytically, producing 3'-monophosphate...;
                     Region: YhcR_OBF_like; cd04486"
                     /db_xref="CDD:239932"
     misc_feature    order(214888..214896,214915..214926,214930..214932,
                     214945..214953,214957..214959,215014..215016,
                     215035..215043,215083..215088)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239932"
     misc_feature    order(215017..215019,215023..215025,215029..215031,
                     215113..215115)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239932"
     misc_feature    215545..216429
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="Mycoplasma pulmonis MnuA nuclease-like; Region:
                     MnuA_DNase1-like; cd10283"
                     /db_xref="CDD:197338"
     misc_feature    order(215563..215568,215572..215574,215728..215730,
                     215734..215739,215848..215850,215929..215931,
                     215995..215997,216142..216144,216148..216150,
                     216253..216258,216403..216408)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative active site [active]"
                     /db_xref="CDD:197338"
     misc_feature    order(215563..215565,215728..215730,215848..215850,
                     215995..215997,216142..216144,216148..216150,
                     216256..216258,216403..216408)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197338"
     misc_feature    order(215563..215565,215728..215730,216403..216405)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative Mg binding site IVb [ion binding]; other
                     site"
                     /db_xref="CDD:197338"
     misc_feature    order(215569..215571,215995..215997,216142..216144,
                     216148..216150,216406..216408)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197338"
     misc_feature    order(215572..215574,215734..215739,215848..215850,
                     215929..215931,215995..215997,216142..216144,
                     216148..216150,216253..216255,216406..216408)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:197338"
     misc_feature    order(216142..216144,216256..216258,216406..216408)
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="putative Mg binding site IVa [ion binding]; other
                     site"
                     /db_xref="CDD:197338"
     misc_feature    216469..216810
                     /locus_tag="TCCBUS3UF1_1910"
                     /note="Lamin Tail Domain; Region: LTD; pfam00932"
                     /db_xref="CDD:250237"
     gene            217114..217854
                     /locus_tag="TCCBUS3UF1_1920"
                     /db_xref="GeneID:12251546"
     CDS             217114..217854
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="similar to Transcriptional regulators of sugar
                     metabolism COG1349;
                     similar to Transcriptional regulator, deoR family of
                     Aurantimonas manganoxydans SI85-9A1 UniRef
                     RepID=Q1YGQ8_MOBAS"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulator, deoR"
                     /protein_id="YP_005653315.1"
                     /db_xref="GI:384438591"
                     /db_xref="GeneID:12251546"
                     /translation="MPLATLRRQNLLELLRQHRGLSTKELARRLGVSEATVRRDLAAL
                     ARQGLLQREHGGAIAPEAEPPYAEKLARNREAKEAIAQRAALLVPDGATVVLDSGTTL
                     LALARLLSGRPLRAIALDLPIAQALAQGETEVLLAGGRVRNGFFSLVGPWAEELLGRV
                     RADLFFLGADAFDPEGVTNHTFEEAAVKRKAMEVSRKTVLLADGSKWGKRAPAFVTPL
                     SALERVITDLEDPTLEALVPVEVVRGAL"
     misc_feature    217120..217809
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    217120..>217281
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(217129..217137,217177..217185,217210..217221,
                     217225..217230,217237..217242,217246..217251,
                     217267..217275)
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(217177..217179,217186..217188)
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    217324..217794
                     /locus_tag="TCCBUS3UF1_1920"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            217841..218641
                     /locus_tag="TCCBUS3UF1_1930"
                     /db_xref="GeneID:12251547"
     CDS             217841..218641
                     /locus_tag="TCCBUS3UF1_1930"
                     /note="similar to Photosystem I assembly BtpA of
                     Alphaproteobacteria UniRef RepID=Q28QI3_JANSC"
                     /codon_start=1
                     /transl_table=11
                     /product="Photosystem I assembly BtpA"
                     /protein_id="YP_005653316.1"
                     /db_xref="GI:384438592"
                     /db_xref="GeneID:12251547"
                     /translation="MERFEALFGPKPVIAMVHLRALPGTPLYEGDLEGIVEAARRDLL
                     ALQEAGVDAVMFGNENDRPYQLRVDPASTATMAYVIGRLRGEIRVPFGVDVLWDPLAT
                     MALAAATGAAFAREIFTGVYGSDMGLWQGRAGEALRYRRLLGREDLFLLYNVSAEFAS
                     PLDARTLPERARSAVFSSLADAVLVSGPMTGEGVALEHLRAVKEALPGVPVLANTGVR
                     HETVAEILGVADGVIVGTALKRDGVTWNEVDPERARAFMDRVREARGR"
     misc_feature    217868..218632
                     /locus_tag="TCCBUS3UF1_1930"
                     /note="BtpA family; Region: BtpA; cl00440"
                     /db_xref="CDD:241865"
     gene            218638..220113
                     /locus_tag="TCCBUS3UF1_1940"
                     /db_xref="GeneID:12251548"
     CDS             218638..220113
                     /locus_tag="TCCBUS3UF1_1940"
                     /note="similar to Sugar (pentulose and hexulose) kinases
                     COG1070;
                     similar to Carbohydrate kinase, FGGY of Rhodospirillum
                     rubrum ATCC 11170 UniRef RepID=Q2RUX7_RHORT"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbohydrate kinase, FGGY"
                     /protein_id="YP_005653317.1"
                     /db_xref="GI:384438593"
                     /db_xref="GeneID:12251548"
                     /translation="MMVLGVDIGTTGVKALLLSEEGRVLAEAEHPHALRAPAPGFAEE
                     DPEDWWQGLRATLARLLEGRDKASLRAIGLSGMVPALVLHDGEGRPLRPSLQQNDARA
                     VREIRELEAHFGNQWLFARTGATWNQQVLAPKLLWLRRHEPQAFAQARWISGSYEHLA
                     FRLTGERYQEANWALESGLWDPKAEAWLAEVLAYVGLEPDRLGPVRRPHEGVGEVTGE
                     AARATGLPKGLPVIAGSADHIAAALASGLKEPGEAVVKLGGAGDFLYAIDRFAPVPEL
                     FIDFHDLPGLFVINGCMATTGSLLKWFQGAFRPGVGFAQLDAEAEGIPPGSQGLVVLP
                     YFLGEKTPIHDPEARGTVVGLTLSHTPAHLWRALLEAVAYAFRHHLEVLEARGHRVER
                     LFVMDGGARSPLWRRILASVLERPLERLLGGERGSAYGTAFLAGVAAGLWGFADLRRE
                     VAEVTEPEPTWIPPYRELYGVYREVYQRLKDLYPRLGGGYA"
     misc_feature    218638..220095
                     /locus_tag="TCCBUS3UF1_1940"
                     /note="Sugar (pentulose and hexulose) kinases
                     [Carbohydrate transport and metabolism]; Region: XylB;
                     COG1070"
                     /db_xref="CDD:223996"
     misc_feature    218641..220086
                     /locus_tag="TCCBUS3UF1_1940"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    order(218656..218667,218671..218673,218677..218679,
                     219346..219348,219403..219414,219826..219828)
                     /locus_tag="TCCBUS3UF1_1940"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            220106..220876
                     /locus_tag="TCCBUS3UF1_1950"
                     /db_xref="GeneID:12251549"
     CDS             220106..220876
                     /locus_tag="TCCBUS3UF1_1950"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK05653;
                     similar to Short-chain dehydrogenase/reductase SDR of
                     Starkeya novella DSM 506 UniRef RepID=D7AAX8_THINO"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_005653318.1"
                     /db_xref="GI:384438594"
                     /db_xref="GeneID:12251549"
                     /translation="MPNALVTGAGTGIGRAIAERLVRDGFKVWVTDLKEEWAQEVGEA
                     LGMPHLKVDVTRRTDLEQARERVYAEDGRLDLLVANAGVSTMNPFLDLTEEEWDFNFA
                     VNAKGTFLTLQTFARAMVAQPPMPGRGVRGKLVAIASMAARQAAPLLAHYSASKFAVL
                     GLVQAAAKELAPYRITVNAVNPGFVRTSMQEREVAWEARLRGLTPEEVVQDYLRQTPL
                     GRLEAPEDVAGVVSFLAGPDADFITGEAVEVNGGAWIF"
     misc_feature    220115..220861
                     /locus_tag="TCCBUS3UF1_1950"
                     /note="acetoin reductases; Region: 23BDH; TIGR02415"
                     /db_xref="CDD:131468"
     misc_feature    220115..220861
                     /locus_tag="TCCBUS3UF1_1950"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(220127..220129,220133..220138,220142..220144,
                     220199..220207,220343..220351,220514..220522,
                     220559..220561,220571..220573,220649..220660)
                     /locus_tag="TCCBUS3UF1_1950"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(220415..220417,220520..220522,220559..220561,
                     220571..220573)
                     /locus_tag="TCCBUS3UF1_1950"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            220860..221675
                     /locus_tag="TCCBUS3UF1_1960"
                     /db_xref="GeneID:12251550"
     CDS             220860..221675
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="similar to ABC-type sugar transport system,
                     permease component COG0395;
                     similar to Binding-protein-dependent transport systems
                     inner membrane component of Bacteria UniRef
                     RepID=C5CIF6_KOSOT"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="YP_005653319.1"
                     /db_xref="GI:384438595"
                     /db_xref="GeneID:12251550"
                     /translation="MPGSSRGLRHLAHALLWAYSLAFLLPLLWTLRSALLPEGLAYAL
                     PPAWGPWTLENFAQVLQGPLGKAFRNSLLVAGLVVALGLPLAAGLGYALARHRLGGEP
                     LRFAVLATQMLPPIVLALPLFALFRALGLSGSLWALVLAYLAFALPFMAWLLLGFFQG
                     LPRELLEAAYVDGASPYQAFFRVVLPLSAPGLFAAGVLGFLLSWNEFLFALLLSGRET
                     QTVPVALSALVTQRGVLFAQVAAGVVLSVIPVALLARTVDRYLVEGLTLGAVK"
     misc_feature    220860..221672
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    221061..221615
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(221109..221114,221121..221126,221139..221141,
                     221166..221177,221181..221210,221217..221222,
                     221226..221228,221289..221294,221298..221300,
                     221304..221306,221313..221318,221322..221324,
                     221334..221339,221346..221348,221397..221399,
                     221439..221444,221451..221453,221472..221483,
                     221490..221495,221532..221537,221565..221570,
                     221577..221582,221586..221591,221598..221603,
                     221610..221615)
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221184..221228,221472..221489)
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221226..221228,221274..221276,221490..221492,
                     221526..221528,221535..221537,221565..221567)
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221349..221387,221403..221408,221418..221420)
                     /locus_tag="TCCBUS3UF1_1960"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            221689..222951
                     /locus_tag="TCCBUS3UF1_1970"
                     /db_xref="GeneID:12251551"
     CDS             221689..222951
                     /locus_tag="TCCBUS3UF1_1970"
                     /note="similar to ABC-type sugar transport system,
                     periplasmic component COG1653;
                     similar to Extracellular solute-binding protein family 1
                     of Starkeya novella DSM 506 UniRef RepID=D7AAX5_THINO"
                     /codon_start=1
                     /transl_table=11
                     /product="Extracellular solute-binding protein family 1"
                     /protein_id="YP_005653320.1"
                     /db_xref="GI:384438596"
                     /db_xref="GeneID:12251551"
                     /translation="MRRLLAVALALWGLSLAQGVVLRALMEDVPETRIIEALLPEFER
                     ATGIRVEFEKVQYAAMHDKLVAQLLAPESAYDFLQVDFLWAGEFPAAGWLEPLEPFVK
                     ASGFDLTPYYPSMLDLVGYYRGTLYMIPMYNYAMGLIYRKDLLERKDLKGRFQSQFKR
                     PLALPKNLQEYVDLSLFMARNAGVAGAAMQGQRGDPNFMEFSNYLFAAGGDYVDKGGR
                     VVLNSPQGERALTLYVRNLREGAQKGALNANLDDTFRVMCQGGAFSMVTYWWMLPQLN
                     DPKQCPKVAGKVALSPMPGGVGVSGGWGWAIPKNSRNKEAAWRFISWVESKEIVRQRA
                     LQGHAPTRKDAFQDPEVLRKYPYYKEAERILARAKKVPIFAYTAEMEDVVGREISLAA
                     AGQKGVKQALQDAAKGLEALLRKAGLLR"
     misc_feature    221698..222933
                     /locus_tag="TCCBUS3UF1_1970"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    221770..222672
                     /locus_tag="TCCBUS3UF1_1970"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            222961..223806
                     /locus_tag="TCCBUS3UF1_1980"
                     /db_xref="GeneID:12251552"
     CDS             222961..223806
                     /locus_tag="TCCBUS3UF1_1980"
                     /note="similar to ABC-type sugar transport systems,
                     permease components COG1175;
                     similar to Binding-protein-dependent transport systems
                     inner membrane component of Kosmotoga olearia TBF 19.5.1
                     UniRef RepID=C5CIF8_KOSOT"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="YP_005653321.1"
                     /db_xref="GI:384438597"
                     /db_xref="GeneID:12251552"
                     /translation="MGERRSAWVLALPGLLLLAGVVGFPLLYALFLSLTGYTFLRPSY
                     ALQGLARYREALADPYFLNALGLTALYLLLTVGLTLALGLLLAVLLHQNLPFRGFHYF
                     AVSLPMLIAPVGVGLIWKMILHPELGILAYLLGGVDFFGEARYALLSLALVDVWQQVS
                     FAALVLLAGLRSLPREPLEAAYVDGATPWQAFWRVTFPLLRPVLLALLVLQTLTEVRT
                     YDLVYVLTRGGPGSSTDLVSYYIYRKAFLGLDLSGASAMGYLLLLLSLLLVAAYYRLL
                     TRGWT"
     misc_feature    223246..>223551
                     /locus_tag="TCCBUS3UF1_1980"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(223246..223257,223261..223290,223297..223302,
                     223306..223308,223423..223428,223435..223437,
                     223441..223443,223450..223455,223459..223461,
                     223471..223476,223483..223485,223534..223536)
                     /locus_tag="TCCBUS3UF1_1980"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    223264..223308
                     /locus_tag="TCCBUS3UF1_1980"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(223486..223524,223540..223545)
                     /locus_tag="TCCBUS3UF1_1980"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            223803..224576
                     /locus_tag="TCCBUS3UF1_1990"
                     /db_xref="GeneID:12251553"
     CDS             223803..224576
                     /locus_tag="TCCBUS3UF1_1990"
                     /note="similar to L-xylulose 5-phosphate 3-epimerase
                     PRK13209;
                     similar to Deoxyribonuclease IV (BER) (Nfo) of
                     Thermococcus UniRef RepID=C5A4T0_THEGJ"
                     /codon_start=1
                     /transl_table=11
                     /product="Deoxyribonuclease IV (BER)"
                     /protein_id="YP_005653322.1"
                     /db_xref="GI:384438598"
                     /db_xref="GeneID:12251553"
                     /translation="MRLGFRPPKDPEGFLAYARVLAGRYAFIEVPGSAAPHLEGVAQE
                     ARGMGYRLTYHARYLDLYPGSPVPEIREASLRLLREDLERAARMGAFLVNVHAGNIPW
                     TDYPPPGLSPAHEALREAEGRLRREYLERALEALAGLASLALDLGLKLTLENLPAPQE
                     VPRTPEEMALFLAVPGLEFCLDLGHAQMAGQDPKGFLEALGGRLVHVHAHRNDGRFDL
                     HLPPRPEDLNPFLDTPCTLLVELPPRGVGEYLALVGDQP"
     misc_feature    223821..224468
                     /locus_tag="TCCBUS3UF1_1990"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    223875..224468
                     /locus_tag="TCCBUS3UF1_1990"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            224668..224988
                     /locus_tag="TCCBUS3UF1_2000"
                     /db_xref="GeneID:12251554"
     CDS             224668..224988
                     /locus_tag="TCCBUS3UF1_2000"
                     /note="similar to Uncharacterized enzyme involved in
                     biosynthesis of extracellular polysaccharides COG2329;
                     similar to Antibiotic biosynthesis monooxygenase of
                     Bacteria UniRef RepID=Q1IW94_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="antibiotic biosynthesis monooxygenase"
                     /protein_id="YP_005653323.1"
                     /db_xref="GI:384438599"
                     /db_xref="GeneID:12251554"
                     /translation="MFVVMNRIPVKPEYADRFEEVFRTRARLVDRMPGFIRNLVLRPK
                     DPEDPYIVITFWESEEAFRAWTESPEFREGHARSGTLPKEAFRGPNRLETFSVFLDSQ
                     DSHG"
     misc_feature    224668..224979
                     /locus_tag="TCCBUS3UF1_2000"
                     /note="Uncharacterized enzyme involved in biosynthesis of
                     extracellular polysaccharides [General function prediction
                     only]; Region: COG2329"
                     /db_xref="CDD:225209"
     gene            224981..225610
                     /locus_tag="TCCBUS3UF1_2010"
                     /db_xref="GeneID:12251555"
     CDS             224981..225610
                     /locus_tag="TCCBUS3UF1_2010"
                     /note="similar to Hypothetical conserved protein of
                     Thermus thermophilus UniRef RepID=Q745X5_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653324.1"
                     /db_xref="GI:384438600"
                     /db_xref="GeneID:12251555"
                     /translation="MARPDIETPSAWVLLKRARERVYTLPEDFPGFRGTLALFAGGLW
                     HFGRVEVQGFSPKVDLLGHLRSVAERELASLLGHRRPVPFPEGEGKYPMRLFEEGPLG
                     TGIALEDPFRSRIWVKGNRLQVIERHLAGGSFRIHLEVWREVEEGLLPQRFLLVHRDP
                     EGRVVRVERFRDEYQKVGPYWLPVEREVVVEAKGLEVLVLRLEELEVNG"
     misc_feature    224999..225601
                     /locus_tag="TCCBUS3UF1_2010"
                     /note="Protein of unknown function (DUF3386); Region:
                     DUF3386; pfam11866"
                     /db_xref="CDD:152302"
     gene            225607..226512
                     /locus_tag="TCCBUS3UF1_2020"
                     /db_xref="GeneID:12251556"
     CDS             225607..226512
                     /locus_tag="TCCBUS3UF1_2020"
                     /note="similar to Hemin-binding periplasmic protein hmuT
                     of Thermus thermophilus UniRef RepID=Q745X6_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Hemin-binding periplasmic protein hmuT"
                     /protein_id="YP_005653325.1"
                     /db_xref="GI:384438601"
                     /db_xref="GeneID:12251556"
                     /translation="MKGFYVGLLLLSCTLAQAQPFRVVDAKGTEIQVRSLERIVSLDG
                     ITTEILFALGVGDKVVGRDDSSYYPPEVLKRPSVGYQFRLSAEGILSLRPTLVIGRED
                     VRPPQVVDQLRGAGVAVVLVPTEPTVEGAKRKIRTVAQAVGRLEQGEALVRALERDLL
                     ALRAFQAQQAPKGRLRGLFLYLRGPQTTFVCGEGSTPVGMMELAGLINAAKGIRECQP
                     MTAESVVAARPDVLVVFQKGLESVGGLEGLLKLPGVAQTPAGQNRKVVAMDDLYLGSF
                     GPRAGRAALDLFRAAYLREGFVEVR"
     misc_feature    225715..226422
                     /locus_tag="TCCBUS3UF1_2020"
                     /note="Hemin binding protein HutB.  These proteins have
                     been shown to function as initial receptors in ABC
                     transport of hemin and hemoproteins in many eubacterial
                     species.  They belong to the TroA superfamily of
                     periplasmic metal binding proteins that share a...;
                     Region: HutB; cd01149"
                     /db_xref="CDD:238569"
     misc_feature    225721..226416
                     /locus_tag="TCCBUS3UF1_2020"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    225817..225819
                     /locus_tag="TCCBUS3UF1_2020"
                     /note="putative hemin binding site; other site"
                     /db_xref="CDD:238569"
     gene            226512..226631
                     /locus_tag="TCCBUS3UF1_2030"
                     /db_xref="GeneID:12251557"
     CDS             226512..226631
                     /locus_tag="TCCBUS3UF1_2030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653326.1"
                     /db_xref="GI:384438602"
                     /db_xref="GeneID:12251557"
                     /translation="MVSPRLYRAFLKALFLLWLLGKPLPQSPREAFGGQEVRG"
     gene            226628..227659
                     /locus_tag="TCCBUS3UF1_2040"
                     /db_xref="GeneID:12251558"
     CDS             226628..227659
                     /locus_tag="TCCBUS3UF1_2040"
                     /note="similar to Hemin transport system permease protein
                     hmuU of Thermus UniRef RepID=Q745X7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Hemin transport system permease protein hmuU"
                     /protein_id="YP_005653327.1"
                     /db_xref="GI:384438603"
                     /db_xref="GeneID:12251558"
                     /translation="MSGLGVALRARAYRLALLGLALLLPLALLLGAGLGAYPIPPLAI
                     PGILYRGEGLEYQVLTALRFPRVLGAALVGGLLALAGAVLQGFFRNPLVDPGLIGVSS
                     GAALGAALFIVLVPGAGNLEVYALPLFAFLGGLLATLLLWRIAQTPLGVQVSVLLLSG
                     IALNALVGGGIGILTFLASEQELRSLTFWTLGGFSGLTWRLLLAALPLALLALYLLFP
                     LARGLNALALGEREAFHLGVGLEGLKRRAVAGAALGVGVSVALAGGIGFIGLVAPHLF
                     RLLAGPDHRYLLPGAFLLGASLAVLADLLARTLAAPAEMPVGVITALLGGPFFLYLVL
                     RYKREVYRA"
     misc_feature    226826..227626
                     /locus_tag="TCCBUS3UF1_2040"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(226880..226882,226892..226900,227276..227281,
                     227285..227293,227297..227302,227306..227323,
                     227327..227335,227456..227458,227477..227479)
                     /locus_tag="TCCBUS3UF1_2040"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(226895..226897,226901..226903,226916..226918,
                     227090..227092,227096..227101,227108..227113,
                     227120..227125,227132..227134,227141..227146,
                     227150..227152,227186..227191,227198..227200,
                     227426..227428,227582..227584,227591..227596,
                     227603..227605,227612..227617,227624..227626)
                     /locus_tag="TCCBUS3UF1_2040"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(227150..227152,227228..227230,227402..227404,
                     227414..227416,227546..227548,227573..227575)
                     /locus_tag="TCCBUS3UF1_2040"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            227652..228428
                     /locus_tag="TCCBUS3UF1_2050"
                     /db_xref="GeneID:12251559"
     CDS             227652..228428
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="similar to hemin importer ATP-binding subunit
                     PRK13548;
                     similar to Transporter of Thermus UniRef
                     RepID=Q745X8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="YP_005653328.1"
                     /db_xref="GI:384438604"
                     /db_xref="GeneID:12251559"
                     /translation="MLEARGLGYRKEGRWLLRGVDLSLAPGDFLAVLGPNGSGKTTLL
                     RLLAGELSPSEGEVRLLGRPLGSYTPLELARQRAVLSQNRELAFSFTAYEVAFLGRHP
                     HLEGRERSLDHEKTLEALRRAQALPLRERLYPTLSGGEGIRVEVARLLNQEPRFFLLD
                     EPTNHLDPRYALEVLLLFRALAYEGRGVLAVLHDLNLASLFANRLLLLKGGRVLAYGS
                     PEAVLCPELLEEAYEVPFYALAHGGVSLFLPVPREVVRGT"
     misc_feature    227652..228407
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    227658..228302
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    227751..227774
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(227760..227765,227769..227777,227895..227897,
                     228129..228134,228228..228230)
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    227886..227897
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    228057..228086
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    228117..228134
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    228141..228152
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    228216..228236
                     /locus_tag="TCCBUS3UF1_2050"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            228418..228729
                     /locus_tag="TCCBUS3UF1_2060"
                     /db_xref="GeneID:12251560"
     CDS             228418..228729
                     /locus_tag="TCCBUS3UF1_2060"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q745X9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653329.1"
                     /db_xref="GI:384438605"
                     /db_xref="GeneID:12251560"
                     /translation="MEPEHAQEVARLSPTRYLARCACHGGTYHLHWDAGTFRLNQEGI
                     AFLMRVLQEVLENGTGGVVWLGSVGLRFGPEEGEELLRLLRAGLALPWDRPVFWFRQI
                     H"
     gene            complement(228743..229963)
                     /locus_tag="TCCBUS3UF1_2070"
                     /db_xref="GeneID:12251561"
     CDS             complement(228743..229963)
                     /locus_tag="TCCBUS3UF1_2070"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653330.1"
                     /db_xref="GI:384438606"
                     /db_xref="GeneID:12251561"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    complement(228776..229924)
                     /locus_tag="TCCBUS3UF1_2070"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(228839..229888)
                     /locus_tag="TCCBUS3UF1_2070"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            230009..230926
                     /locus_tag="TCCBUS3UF1_2080"
                     /db_xref="GeneID:12251562"
     CDS             230009..230926
                     /locus_tag="TCCBUS3UF1_2080"
                     /note="similar to iron-dicitrate transporter
                     substrate-binding subunit PRK11411;
                     similar to Ferrichrome-binding protein of Thermus
                     thermophilus UniRef RepID=Q745Y0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653331.1"
                     /db_xref="GI:384438607"
                     /db_xref="GeneID:12251562"
                     /translation="MRRVFFAFLFTAVALAQQGTCPGERVPHDLGEVCLSKVPDRVAA
                     LDWRPLEDLLLLGVRPVAGADLADFPKWVKVPLPQGIADLGGRTAPNLERLLALRPDL
                     ILGYTGFQGRLYPELSRIAPTALYDYLPSEGQLAAMRRHFLLHAQLVGKAKEGERILS
                     DLDRFLAQARERLEQRGLGGRPFLLVQAWARDKVYNIFTRSTLASEVLEAVGLRNAWT
                     GKAEAYGLSRVGPEGLVRLVRENPGVQVLLIAQPGNNPLADPAIGPLLRLQGARVHPM
                     DPATWTYGGPLSVRVLVEEALRVLLGGKP"
     misc_feature    230009..230923
                     /locus_tag="TCCBUS3UF1_2080"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    230117..230887
                     /locus_tag="TCCBUS3UF1_2080"
                     /note="Fe3+-siderophore binding domain FhuD.  These
                     proteins have been shown to function as initial receptors
                     in ABC transport of Fe3+-siderophores in many eubacterial
                     species. They belong to the TroA-like superfamily of
                     helical backbone metal receptor proteins...; Region: FhuD;
                     cd01146"
                     /db_xref="CDD:238566"
     misc_feature    order(230222..230224,230267..230272,230333..230335,
                     230594..230596)
                     /locus_tag="TCCBUS3UF1_2080"
                     /note="siderophore binding site; other site"
                     /db_xref="CDD:238566"
     gene            231028..231153
                     /locus_tag="TCCBUS3UF1_2090"
                     /db_xref="GeneID:12251563"
     CDS             231028..231153
                     /locus_tag="TCCBUS3UF1_2090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653332.1"
                     /db_xref="GI:384438608"
                     /db_xref="GeneID:12251563"
                     /translation="MAFDPPFPRGGKGEALGVAWWASCPNIEMMPILLDPPHNPW"
     gene            231477..231854
                     /locus_tag="TCCBUS3UF1_2100"
                     /db_xref="GeneID:12251564"
     CDS             231477..231854
                     /locus_tag="TCCBUS3UF1_2100"
                     /note="similar to Acyl-CoA hydrolase COG1607;
                     similar to Thioesterase superfamily protein of Truepera
                     radiovictrix DSM 17093 UniRef RepID=D7CXC6_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase super"
                     /protein_id="YP_005653333.1"
                     /db_xref="GI:384438609"
                     /db_xref="GeneID:12251564"
                     /translation="MRETRMVHLVFPGETNHYGTLFGGTVMAWMDQAAFVAATRHARR
                     KVVTVHSDAVDFQRPVPLGSIVELVARVVGVGRTSMRVAVELWVEPLEGDRYLAAKGG
                     FVLVALDGEGRPAPVPPLEGVKE"
     misc_feature    231483..231830
                     /locus_tag="TCCBUS3UF1_2100"
                     /note="Brown fat-inducible thioesterase (BFIT).  Brain
                     acyl-CoA hydrolase (BACH).  These enzymes deacylate
                     long-chain fatty acids by hydrolyzing acyl-CoA thioesters
                     to free fatty acids and CoA-SH. Eukaryotic members of this
                     family are expressed in brain, testis; Region: BFIT_BACH;
                     cd03442"
                     /db_xref="CDD:239526"
     gene            231857..234001
                     /locus_tag="TCCBUS3UF1_2110"
                     /db_xref="GeneID:12251565"
     CDS             231857..234001
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="similar to
                     5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase PRK05222;
                     similar to 5-methyltetrahydropteroyltriglutamate--
                     homocysteine methyltransferase of Ammonifex degensii KC4
                     UniRef RepID=C9RDB6_AMMDK"
                     /codon_start=1
                     /transl_table=11
                     /product="5-
                     methyltetrahydropteroyltriglutamate/homocysteine
                     S-methyltransferase"
                     /protein_id="YP_005653334.1"
                     /db_xref="GI:384438610"
                     /db_xref="GeneID:12251565"
                     /translation="MRTLAYGFPRLGPDREYKRLLEGFWSGEVSEEAFRQGLEGLEAL
                     RLAAYRRHVDLYPVGEMSLYDPLLDLAVMVGVYPIDPQDLGAYYALARGKGALPLRKW
                     FGTNYHYLAPLLPEAPRYKPHWNKPLEAFRKHPEGLPHLLGPYTLLRLAQNPPEGGER
                     ARHLEALGEVYAAFLGELKGAGAPLALLEEPALGLDGAEEDLPALERVYGRLLEALPL
                     ALLTPYLLPRPEVGAGLYPLPWAAASRDLEAPRGGPRVPILGVVEGQGVWRTPLLEVA
                     RRLREALGEGEVWLAPRAPLYHLPWRVGSPPPGLEGRLAFAEERLGELALLARLLRGE
                     EGALAEAQAWRAPGEPPRLPPLSPPPGPRPPGPVRKEAQRDLPLPPFPTTTIGSFPQT
                     QELRALRARFRSGKLSPEAYGEAIREAIARTIRFQEAVGLDLLVHGEPERSDMVEFFA
                     ERLEGFHTHPSGWVLSYGSRVYRPPILAGPVRRKGPLALEELRYAQSLTPKPVKAILT
                     GPITLAAWSYLPEGASFAEAVLHLAEAIGEEVRALEGAGFRFLQIDEPALLEKLPLRA
                     EAQPAYLELVREAFRRAVPVGPGVQVHLHLCYSEYAALRPFLEAMDPDVVSLEAARQE
                     PRFLGALEGLDLGLGPGAFDVHSPRAVSPEEMEGRLLAYLDHIPPSRLWVNPDCGLKT
                     RTWPEAEANLKAMVEAARRLRARFGGEDAHRT"
     misc_feature    231857..233977
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="5-methyltetrahydropteroyltriglutamate--homocysteine
                     S-methyltransferase; Provisional; Region: PRK05222"
                     /db_xref="CDD:235367"
     misc_feature    231875..232813
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="The URO-D_CIMS_like protein superfamily includes
                     bacterial and eukaryotic uroporphyrinogen decarboxylases
                     (URO-D), coenzyme M methyltransferases and other putative
                     bacterial methyltransferases, as well as cobalamine (B12)
                     independent methionine synthases; Region: URO-D_CIMS_like;
                     cl00464"
                     /db_xref="CDD:260440"
     misc_feature    233000..233956
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="CIMS - Cobalamine-independent methonine synthase,
                     or MetE, C-terminal domain_like. Many members have been
                     characterized as
                     5-methyltetrahydropteroyltriglutamate-homocysteine
                     methyltransferases, EC:2.1.1.14, mostly from bacteria and
                     plants. This enzyme...; Region: CIMS_C_terminal_like;
                     cd03311"
                     /db_xref="CDD:239427"
     misc_feature    order(233012..233020,233171..233173,233189..233191,
                     233510..233512,233516..233518,233639..233641,
                     233645..233647,233888..233893)
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239427"
     misc_feature    order(233264..233272,233402..233404,233522..233524)
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="THF binding site; other site"
                     /db_xref="CDD:239427"
     misc_feature    order(233639..233641,233645..233647,233711..233713,
                     233888..233890)
                     /locus_tag="TCCBUS3UF1_2110"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:239427"
     gene            233985..234950
                     /locus_tag="TCCBUS3UF1_2120"
                     /db_xref="GeneID:12251566"
     CDS             233985..234950
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="similar to ribonucleotide-diphosphate reductase
                     subunit beta PRK13967;
                     similar to Ribonucleoside-diphosphate reductase beta chain
                     of Thermus UniRef RepID=Q745Z4_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase subunit
                     beta"
                     /protein_id="YP_005653335.1"
                     /db_xref="GI:384438611"
                     /db_xref="GeneID:12251566"
                     /translation="MLTEPRVHYRPYEYPGLLRFRDAIRHSYWVHTEFSYAADVQDYA
                     LVGEAERSLVRRALLAISQVELSVKLFWARVYEVFPKPEVAEVGMTFAESEVRHANAY
                     AHLLDLLSLSEAFPKALEEPPLKARQRLLASVLERARGGSLREYALALLLFSAFTEHI
                     SLFSQFYILMALNRRQGRFKGISNAIEATSKEENLHGLFGVELLRLLRMERPELFVGF
                     DEEALGFAQELFRAEEDLLSWLFAGGEPEAVAFAEVREFLKARYNEVLALHGLPRPFA
                     VKEELLRDTDWFALELLADKEVDFFNKRSVAYARRVQSYDPESLF"
     misc_feature    234009..234824
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="Ribonucleotide Reductase, R2/beta subunit,
                     ferritin-like diiron-binding domain; Region: RNRR2;
                     cd01049"
                     /db_xref="CDD:153108"
     misc_feature    order(234036..234038,234057..234059,234249..234254,
                     234261..234263,234270..234275,234282..234284,
                     234291..234293,234327..234332,234339..234341)
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(234069..234071,234177..234179,234267..234269,
                     234276..234278,234288..234290,234555..234560,
                     234570..234572)
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="putative radical transfer pathway; other site"
                     /db_xref="CDD:153108"
     misc_feature    order(234177..234179,234267..234269,234276..234278,
                     234456..234458,234561..234563,234570..234572)
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="diiron center [ion binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    234288..234290
                     /locus_tag="TCCBUS3UF1_2120"
                     /note="tyrosyl radical; other site"
                     /db_xref="CDD:153108"
     gene            234960..237728
                     /locus_tag="TCCBUS3UF1_2130"
                     /db_xref="GeneID:12251567"
     CDS             234960..237728
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="similar to ribonucleotide-diphosphate reductase
                     subunit alpha PRK09102;
                     similar to Ribonucleoside-diphosphate reductase, alpha
                     chain of Salinibacter ruber UniRef RepID=Q2S696_SALRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonucleoside-diphosphate reductase, alpha
                     chain"
                     /protein_id="YP_005653336.1"
                     /db_xref="GI:384438612"
                     /db_xref="GeneID:12251567"
                     /translation="MRKTKREYEPWYWANEWTRLYMSRGYLLPGVSVEERVRQIARRA
                     EALTRIEGFAEKFERYMARGWYSLATPIWANYGLGRGLPISCYGTYVEDDTASILRAV
                     AEIGMMSKQGGGTSVYLGNLRPRGAPIRDNGESNGSYAFASLFDRVIEVFNQGSTRRG
                     QCAAYIPIEHPDFPEWLRIQREGSEIQSLFWGVTVGDAWLEAMVAGDREKRERWAQVL
                     KSRAEVGIPYIFFRDNANRARPEIFKRLGVEIHGSNLCVVGSSLAVTSEGIRRVEDLY
                     REGKPLTLFDGEKPVPASPMYLIERDADVYTVITKSGRRHTVTGYHKVKTQRGMVPAL
                     ELKPGDKIAIQRNEGLFGSYHNPDLAFLLGLYHGDGTQTDKQIFIDLWEHDFDLKEKI
                     EACVERVYLANGWDAYEVFVPSVRTASRRASIPRFYPTPQVGKEKKLRLGSTKLKQLG
                     FEKFLIPDWIWQGDKETQAAYLKGLFYADGTVRVGESEGNPIQLALASVNKEFLRQVQ
                     IILTNLGINSRIYKLHDAGNTLLPDGRGGHKEYPTKDSWRLVIGDKNSALKFEDLTGF
                     LSRKGVHLERREYRDNTKKWDEVVAVEYAGKEDVYCCTVYTDEHVWVCDGIITSNCTE
                     IALPSTPEESFVCCLSSLNLLHFDEWKDTDAVETLTIFLDSVLDDFIEKAQGIPYMER
                     AVRFARRYRAIGIGVLGWHSYLQSKGIPLESADAVFLNGLIFKTILERAEEASRWLRA
                     RHPEDELAELMERRNATLMAVAPTKSSSFILGQVSPSIEPYTSNYYLKDLQKARVPFK
                     NPFLEELLRAKGKDEERVWRSILEHNGSVQHLDFLTDEEKDVFKTFAEVSQKTLINLA
                     AGRQRYIDQGQSLNLVIHPEAPPRDVNELYLHAWRSGLKALYYQFSSSTAQAYSRDLL
                     LSCRACEG"
     misc_feature    235110..>235727
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:245211"
     misc_feature    235725..>236003
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="Hedgehog/Intein domain, found in Hedgehog proteins
                     as well as proteins which contain inteins and undergo
                     protein splicing (e.g. DnaB, RIR1-2, GyrA and Pol). In
                     protein splicing an intervening polypeptide sequence - the
                     intein - is excised from a protein; Region: Hint; cd00081"
                     /db_xref="CDD:238035"
     misc_feature    order(235725..235727,235914..235916,235923..235925)
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="thioester formation/cholesterol transfer; other
                     site"
                     /db_xref="CDD:238035"
     misc_feature    order(235725..235727,235923..235925)
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="protein-splicing catalytic site; other site"
                     /db_xref="CDD:238035"
     misc_feature    235869..236822
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="Intein/homing endonuclease [DNA replication,
                     recombination, and repair]; Region: COG1372"
                     /db_xref="CDD:224291"
     misc_feature    236364..236642
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="LAGLIDADG-like domain; Region: LAGLIDADG_3;
                     pfam14528"
                     /db_xref="CDD:258668"
     misc_feature    236715..236834
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="Hint (Hedgehog/Intein) domain C-terminal region;
                     Region: HintC; smart00305"
                     /db_xref="CDD:197641"
     misc_feature    <236808..237665
                     /locus_tag="TCCBUS3UF1_2130"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:245211"
     gene            237745..238605
                     /locus_tag="TCCBUS3UF1_2140"
                     /db_xref="GeneID:12251568"
     CDS             237745..238605
                     /locus_tag="TCCBUS3UF1_2140"
                     /note="similar to vitamin B12-transporter protein BtuF
                     PRK03379;
                     similar to Putative periplasmic substrate-binding protein
                     of Thermaceae UniRef RepID=D3PLB6_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic substrate-binding protein"
                     /protein_id="YP_005653337.1"
                     /db_xref="GI:384438613"
                     /db_xref="GeneID:12251568"
                     /translation="MRVASLVPSGTLLLRALGVEPVGVSHACPNPRGAVVLTESLIPK
                     GLSQEEIDRRVREAYAQGASLYRVRGEALEALAPDLLVAQGVCEVCAATPQEVAGALR
                     FLSQRPRVLELRGTRLGDLFAELQALGEATGREGEARALTQALRERLLALPLPSHRPS
                     VAFLEWLDPPYLGGHWVAEVVEGAGGRYLGPGPGERSRRVDPKGLPQAEVVLLAFCGY
                     SLAEAQEAVARHLSRGGWLGEYLRGRRAYLLDAAPFQALTHLTVEGVELLSRLLRGEE
                     GVEGLALPLA"
     misc_feature    237745..238416
                     /locus_tag="TCCBUS3UF1_2140"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    237751..238497
                     /locus_tag="TCCBUS3UF1_2140"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    order(238024..238029,238036..238038,238132..238134)
                     /locus_tag="TCCBUS3UF1_2140"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            238640..239230
                     /locus_tag="TCCBUS3UF1_2150"
                     /db_xref="GeneID:12251569"
     CDS             238640..239230
                     /locus_tag="TCCBUS3UF1_2150"
                     /note="similar to Putative uncharacterized protein of
                     Meiothermus ruber DSM 1279 UniRef RepID=D3PMF3_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653338.1"
                     /db_xref="GI:384438614"
                     /db_xref="GeneID:12251569"
                     /translation="MAKVRRTGPGALALLVGLSLLLAACGGPAGSLQDPRLEVLEDMR
                     RLGLPPEVIATYGEALESLGPRLAPQGTGDLQLVQAIALGSVPHYEAYYARRQDYPQF
                     DWSRDGCSAPEGLGLGYRETFRPACNVHDFGYRNFPRFPELYNERGRRLADDNFLVNM
                     NAICRPMGLVNRAACYSAAHAYYWAVRAFGGGHFYR"
     misc_feature    238892..239209
                     /locus_tag="TCCBUS3UF1_2150"
                     /note="Prokaryotic phospholipase A2; Region:
                     Phospholip_A2_3; pfam09056"
                     /db_xref="CDD:255157"
     gene            239254..239643
                     /locus_tag="TCCBUS3UF1_2160"
                     /db_xref="GeneID:12251570"
     CDS             239254..239643
                     /locus_tag="TCCBUS3UF1_2160"
                     /note="similar to Mg/Co/Ni transporter MgtE (contains CBS
                     domain) COG2239;
                     similar to Magnesium transporter of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A6A1_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Magnesium transporter"
                     /protein_id="YP_005653339.1"
                     /db_xref="GI:384438615"
                     /db_xref="GeneID:12251570"
                     /translation="MGGNTGSQTATLLIRSMALGQVRPRLGDFLLVLRRDIPVALGVV
                     IALLEALLAFFSKGVGTEILLVVGLSMLTTTALGSLVGIFLPFLAKRLGADPATLSAL
                     VITSGMDLLGVMVYFGYAYAFLGDLLR"
     misc_feature    <239254..239637
                     /locus_tag="TCCBUS3UF1_2160"
                     /note="Mg/Co/Ni transporter MgtE (contains CBS domain)
                     [Inorganic ion transport and metabolism]; Region: MgtE;
                     COG2239"
                     /db_xref="CDD:225148"
     misc_feature    239254..239613
                     /locus_tag="TCCBUS3UF1_2160"
                     /note="Divalent cation transporter; Region: MgtE; cl00786"
                     /db_xref="CDD:242091"
     gene            239932..240282
                     /locus_tag="TCCBUS3UF1_2170"
                     /db_xref="GeneID:12251571"
     CDS             239932..240282
                     /locus_tag="TCCBUS3UF1_2170"
                     /note="similar to flagellar motor protein PRK09109;
                     similar to TolQ protein of Thermus thermophilus UniRef
                     RepID=Q72KP0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653340.1"
                     /db_xref="GI:384438616"
                     /db_xref="GeneID:12251571"
                     /translation="MRGGELILQAGLVFWVLVVLSVYVFYLLLYALFLLQREGKVEPS
                     LLLRLEGLAQLAPLVGLLGTALGMIQAFLALSGEGNPQGLAKGIAEALVNTAMGLLVA
                     VVAYGGRVFLERGR"
     misc_feature    <240085..240249
                     /locus_tag="TCCBUS3UF1_2170"
                     /note="MotA/TolQ/ExbB proton channel family; Region:
                     MotA_ExbB; cl00568"
                     /db_xref="CDD:260505"
     gene            240279..240662
                     /locus_tag="TCCBUS3UF1_2180"
                     /db_xref="GeneID:12251572"
     CDS             240279..240662
                     /locus_tag="TCCBUS3UF1_2180"
                     /note="similar to Probable TolR-type transport protein of
                     Thermus thermophilus UniRef RepID=Q5SKG0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="TolR-type transport protein"
                     /protein_id="YP_005653341.1"
                     /db_xref="GI:384438617"
                     /db_xref="GeneID:12251572"
                     /translation="MRPLNLVPLIDLFLLLALFGLMLAQFPEALSGGIAQERALRVEL
                     PQGEGTPGGGALLIELSRDGRLALEGKPLPSLKALEEALKALPLGDRPVRLEADREAA
                     HGQVVAVMEAVRRAGGKGVQVAVKK"
     misc_feature    <240378..240659
                     /locus_tag="TCCBUS3UF1_2180"
                     /note="Biopolymer transport protein ExbD/TolR; Region:
                     ExbD; pfam02472"
                     /db_xref="CDD:251318"
     gene            240622..241851
                     /locus_tag="TCCBUS3UF1_2190"
                     /db_xref="GeneID:12251573"
     CDS             240622..241851
                     /locus_tag="TCCBUS3UF1_2190"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653342.1"
                     /db_xref="GI:384438618"
                     /db_xref="GeneID:12251573"
                     /translation="MLGERESRWRSRSRRRAFLLSLLLHSLLGWGLLLYDLLPPMLPQ
                     EGAYTYTVTFPLPRPPEPSKANEPPMPKPNSPQREALPGKGEGRREGPADGAPSQVRG
                     TPLPPMGERQGSSSQRLPLKGSQRGREEGGEGKPLAPTPSREAVGPLDPRPPEVPGVE
                     GEVGRREGPLGAPFPPQEVAPQGAEAPGGAKEETSPSLGQAPSPGPKEEPLSQARSPL
                     LGEKKEEISPGNGKAQLSSGVEALRNGQGSSPVPTGEPLSQGRALSRGEGEGEALGRA
                     SREGLGREGLPPVGKGGSGEEGARCAVVVELRGLPYAQGPSPAILDPQGRLVWPDPKR
                     VQGVPTEVVDRSGIALFFRPGEFREEAYGRVYRVRALATRPRTPGSRFPELVVVGEEE
                     ARLLLGAPPTCQAVFIR"
     misc_feature    <240748..241302
                     /locus_tag="TCCBUS3UF1_2190"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            241862..242473
                     /locus_tag="TCCBUS3UF1_2200"
                     /db_xref="GeneID:12251574"
     CDS             241862..242473
                     /locus_tag="TCCBUS3UF1_2200"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653343.1"
                     /db_xref="GI:384438619"
                     /db_xref="GeneID:12251574"
                     /translation="MRKGFVLIPLLVLVPSLAWSPAPTLEEAQGVVEGVYSRLPRLPV
                     AWESEAPPWRPWRGECPSSGGSRPVAVRVGGQLEVVEILAERARNEFRRVRAQEVLPQ
                     AKRFLPDGHLRVYLTVEGLARLEWREAYTLGALVGDKPRRAYRVTYLDDWQKEEKGYR
                     GTLVFYLDLSEGVDPQGELLLLLMTEAEADCVYALSVPLGRFR"
     gene            242575..242691
                     /locus_tag="TCCBUS3UF1_2210"
                     /db_xref="GeneID:12251575"
     CDS             242575..242691
                     /locus_tag="TCCBUS3UF1_2210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653344.1"
                     /db_xref="GI:384438620"
                     /db_xref="GeneID:12251575"
                     /translation="MLPEPLVQRHQGPYLQEAVARFSLHYKAGWRVLREGEA"
     gene            complement(242688..244766)
                     /locus_tag="TCCBUS3UF1_2220"
                     /db_xref="GeneID:12251576"
     CDS             complement(242688..244766)
                     /locus_tag="TCCBUS3UF1_2220"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus UniRef RepID=Q746M7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653345.1"
                     /db_xref="GI:384438621"
                     /db_xref="GeneID:12251576"
                     /translation="MIGPVQTVEVFLNRFPLRPLEEEEASPWLLQVQLDPPPEPEATY
                     ALLGRLARQVGPMVARFGTGLVSWSLPEGLALEGQVAGSRGSHAYRLLPQGRRPLDPA
                     RPGDREALNALARRRLELGLQQAFPKGYRVEGRRLLGLKPLREGPGWRLLRGAELDLM
                     VDPEGRWLLEVDLVHRLEATLDLEGWLAQGHPLPARARNAYGGGYRGVWEVVRLGEEA
                     PEEVLLENGLSLLAYHKQKGHWEGGSPGRVVWVRDPRRAKETPHLTGLLVPVLTLEEL
                     EEPLALQIPPEPRRKDAEQVARVVAQRLFGLPEARPLRVQARRLPQAQLRAHGGKRVG
                     KPADALRVGALGAREATVALLRLDGGQGWPPLLLEALKGVARASGVSMRFLIGQTPLP
                     ERELAFRQALEGIRAQGAEALLVLTPPLSPERRNRLKALALQEGLPTQLLNTPLGPGD
                     RHRMANALLGLLAKLGWPVVALEGRYAAELAVGFDAGGRDTLRFGGAACATTGDGSFL
                     GWALPEAQVGERIPERVAWDLLANTLKGFHNAYGRFPRHVLLLRDGRIPQGEFRLALE
                     GLRQEEISYDLISVRKTGGGRIYPVRGRLGDGVFLPLEGDAFLLLTVHREGRGTPRPL
                     KVVREAGETPLEEVARQVYHLTRLYPPSGFLFPRLPAPLHLADRLVKERARVGSFPQG
                     RIQPSSLFFV"
     misc_feature    complement(<243447..243854)
                     /locus_tag="TCCBUS3UF1_2220"
                     /note="Piwi-like: PIWI domain. Domain found in proteins
                     involved in RNA silencing. RNA silencing refers to a group
                     of related gene-silencing mechanisms mediated by short RNA
                     molecules, including siRNAs, miRNAs, and
                     heterochromatin-related guide RNAs. The...; Region:
                     Piwi-like; cl00628"
                     /db_xref="CDD:260542"
     misc_feature    complement(242736..>243590)
                     /locus_tag="TCCBUS3UF1_2220"
                     /note="Piwi-like: PIWI domain. Domain found in proteins
                     involved in RNA silencing. RNA silencing refers to a group
                     of related gene-silencing mechanisms mediated by short RNA
                     molecules, including siRNAs, miRNAs, and
                     heterochromatin-related guide RNAs. The...; Region:
                     Piwi-like; cl00628"
                     /db_xref="CDD:260542"
     misc_feature    complement(order(243375..243377,243387..243389,
                     243399..243401,243408..243410,243432..243434,
                     243441..243443,243444..243449,243480..243482,
                     243492..243494))
                     /locus_tag="TCCBUS3UF1_2220"
                     /note="5' RNA guide strand anchoring site; other site"
                     /db_xref="CDD:239208"
     misc_feature    complement(order(242766..242768,243108..243110,
                     243306..243308,243312..243314))
                     /locus_tag="TCCBUS3UF1_2220"
                     /note="active site"
                     /db_xref="CDD:239208"
     gene            244773..246092
                     /locus_tag="TCCBUS3UF1_2230"
                     /db_xref="GeneID:12251577"
     CDS             244773..246092
                     /locus_tag="TCCBUS3UF1_2230"
                     /note="similar to cobyrinic acid a,c-diamide synthase
                     PRK01077;
                     similar to Cobyrinic acid a,c-diamide synthase of
                     Deinococci UniRef RepID=Q1J3Z4_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobyrinic acid a,c-diamide synthase"
                     /protein_id="YP_005653346.1"
                     /db_xref="GI:384438622"
                     /db_xref="GeneID:12251577"
                     /translation="MQLPRLLLAAPHSGAGKTTLALALLQALRERGLAVQPFKVGPDY
                     IDPTHLELASGRRPYNLDGFFLDGEGLLSLFRHGARGADLALIEGVMGLFDGKDPQGR
                     VGSTAQVARLLQAPVVLVVDAGGMAGSIAPLVQGFARFDPGVRVVGVLANRVGSARHA
                     EILREALAPLGLPLLGWLPLDPGLELPERHLGLVLAGEVRPPLEALRKALRLDLEGLL
                     RLAGEAPPLPEAPPFLPERHPPRARVAYAWDRAFRFYYPEALELLEALGAELIPFSPL
                     ADGALPQAEALLLGGGYPELFARELSENTPMREAIRRFRGPVVAECGGYMYLSRGLWV
                     GEAFFPMVGLVPGEARMGERPVLGYREVEALRDSPLAQRGEAFKGHEFHYAHLPPSPS
                     PAWRRVGGEEVEGYTDGRVLASFVHLYLPARPQGALRLLLSAQNPLG"
     misc_feature    244773..246077
                     /locus_tag="TCCBUS3UF1_2230"
                     /note="cobyrinic acid a,c-diamide synthase; Validated;
                     Region: PRK01077"
                     /db_xref="CDD:234896"
     misc_feature    <244953..245264
                     /locus_tag="TCCBUS3UF1_2230"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    245502..246065
                     /locus_tag="TCCBUS3UF1_2230"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cobyrinic Acid a,c-Diamide Synthase; Region:
                     GATase1_CobB; cd03130"
                     /db_xref="CDD:153224"
     misc_feature    order(245736..245738,246027..246029,246033..246035)
                     /locus_tag="TCCBUS3UF1_2230"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153224"
     gene            complement(246084..246299)
                     /locus_tag="TCCBUS3UF1_2240"
                     /db_xref="GeneID:12251578"
     CDS             complement(246084..246299)
                     /locus_tag="TCCBUS3UF1_2240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653347.1"
                     /db_xref="GI:384438623"
                     /db_xref="GeneID:12251578"
                     /translation="MLYQSQARGYHKSIKKKDKNPLRSTPSHKSDSHGGRLIQLPHLF
                     GQLGQGEVKEASPRENRGQRTLPKPLP"
     gene            246318..247226
                     /locus_tag="TCCBUS3UF1_2250"
                     /db_xref="GeneID:12251579"
     CDS             246318..247226
                     /locus_tag="TCCBUS3UF1_2250"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653348.1"
                     /db_xref="GI:384438624"
                     /db_xref="GeneID:12251579"
                     /translation="MKPTPGRNNPTRLLPWVDFKEILGAGLYSYEEGVRHPGWEREWS
                     NPLRETEEDGFQSFAHRERRPFPFQAFWEFLQGLPPMSSGPRGLCASPTIPRLSSSQA
                     EESLAPRGPRGGGSPSRGSLPGPRRRGGGHGNRFHRPGDPAAAGAGTGPGRLSGVEDQ
                     PADLRSRPRSSGRWGACPCRMSMGSSRRPPAVALDWACSCPHGARLWGKGNPPPRGRH
                     RALAEGPGRGILWGITTEERLLKLEGIVEAVVRLLPERKPGRQAGGFPAGAQGGDLGP
                     EGRDQAEGNRPAAGDGKGYRRFVAGG"
     misc_feature    <246366..>246560
                     /locus_tag="TCCBUS3UF1_2250"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     gene            247189..247314
                     /locus_tag="TCCBUS3UF1_2260"
                     /db_xref="GeneID:12251580"
     CDS             247189..247314
                     /locus_tag="TCCBUS3UF1_2260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653349.1"
                     /db_xref="GI:384438625"
                     /db_xref="GeneID:12251580"
                     /translation="MERGIAALWQEVKAEINTPFNRLMLVFTGLGVVLPLLTLLR"
     gene            247320..249431
                     /locus_tag="TCCBUS3UF1_2270"
                     /db_xref="GeneID:12251581"
     CDS             247320..249431
                     /locus_tag="TCCBUS3UF1_2270"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653350.1"
                     /db_xref="GI:384438626"
                     /db_xref="GeneID:12251581"
                     /translation="MVSPKGLGPRADREQKYQVACPSPASGNGPAGRNLPAFPQVAWV
                     AWGLVLENTFAVHWALVSLVGNDPAPGAMGARVFLRRFAASTPAPRVFLVRDHSPEEP
                     LRRPRLEALQGWLHGLGFRVEWVDLGFVEGHQEPLVLNLTGGDKATFFRLYRLASARG
                     WPGFLIEAHGAQPVLVELSGWVGPLPKEEGLSLEDYLALYARPAGAKPRGEPGRVPPA
                     LAGVSWTLLDLEGEEVLYGVEAGRPLVFLPRPHPAFKDQVNRLREKAKRLGGQQALGV
                     ALLPMDKVLGQHENNREWVLAHYQTYAREAGVLALDPREEGALGRALSLPSPNPGAKD
                     LPFRPPEAGPVLLGLLSEQPIPLLASFLVHRPKEVLLVSTQDLERRLGRLASAQAAFS
                     RLGARVQVRQVSGPWALDEVEALFAPVLGAIQARGLSGVANLAGGTKAMALGLLRVLP
                     PGFRVEYLRGSTLEGLPEGDPLPVPWAEVGPEAVLHLYGYQLERDPKLGQIQPHQEVL
                     ARAEEFLRHVEDPQRARAFLEAWEKSFAAEAEGFRLRWRDLRPSAGLALEYLAFFHLH
                     RLLTPRGARVEPGAHLRPLWAHPGLNPREVDGLVWHRGSLAFVECKPDLRSALSKHQE
                     DAALFVLQENFGGVFGRGLLLVQRGRWKPHEKPPAELPWVLRNPRLRLLSLEGGTPYP
                     GGRVYAFPEELEEALRDWGWP"
     gene            complement(249428..250450)
                     /locus_tag="TCCBUS3UF1_2280"
                     /db_xref="GeneID:12251582"
     CDS             complement(249428..250450)
                     /locus_tag="TCCBUS3UF1_2280"
                     /note="similar to CRISPR-associated RAMP protein, Cmr6
                     family of Thermus UniRef RepID=B7A6X1_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated RAMP protein, Cmr6"
                     /protein_id="YP_005653351.1"
                     /db_xref="GI:384438627"
                     /db_xref="GeneID:12251582"
                     /translation="MGRREALQGVRLDPQGTHRGLWLDKYLAEAEREDTEAKGRLVKE
                     VAGIAEPQGYGAFFARYLEALEAMGAETRRATTRSRLVVGLGGEGVLETSLTLHRTYS
                     VPYIPGSALKGLASRYAHLYLEGEAWRRDPRGEAQAGLFGTTEEQGAVVFFDALPYPK
                     TWRIHPDLMNPHHADYYGGGGAPPADWDSPVPVPFLSVKGTFLLALAPAPGVPREEAR
                     PWLQAAWRILAWALREEGVGAKTASGYGRMDLEGESAPSPPQAASSPAYEALRTQLRS
                     TKYRDLPAFLEREAQAILGLSPQELRGLKEAMEERKFLQNAADLKAWAKRSETLRQVL
                     QKLGVL"
     misc_feature    complement(249704..250225)
                     /locus_tag="TCCBUS3UF1_2280"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr6; Region: Cmr6_III-B; cl18978"
                     /db_xref="CDD:267331"
     gene            complement(250453..250797)
                     /locus_tag="TCCBUS3UF1_2290"
                     /db_xref="GeneID:12251583"
     CDS             complement(250453..250797)
                     /locus_tag="TCCBUS3UF1_2290"
                     /note="similar to CRISPR-associated protein, Cmr5 family
                     of Thermus UniRef RepID=B7A6X2_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Cmr5"
                     /protein_id="YP_005653352.1"
                     /db_xref="GI:384438628"
                     /db_xref="GeneID:12251583"
                     /translation="MRTRSQNWAQAAYERVRARKDWEKREEYQDMALKLPVLVRQAGL
                     SQALAFVHSRGKEGHRAVGDDLAAVLGHGNLEALAEAARRAELLQYLRLTREVLQVAE
                     WFKRFAQALLED"
     misc_feature    complement(250462..250791)
                     /locus_tag="TCCBUS3UF1_2290"
                     /note="CRISPR/Cas system-associated protein Cmr5; Region:
                     Cmr5_III-B; cl19034"
                     /db_xref="CDD:267387"
     gene            complement(250801..251664)
                     /locus_tag="TCCBUS3UF1_2300"
                     /db_xref="GeneID:12251584"
     CDS             complement(250801..251664)
                     /locus_tag="TCCBUS3UF1_2300"
                     /note="similar to Uncharacterized protein of Bacteria
                     UniRef RepID=A5D0Z1_PELTS"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653353.1"
                     /db_xref="GI:384438629"
                     /db_xref="GeneID:12251584"
                     /translation="MKGHATALLFLHALSPLHPGTGQGLGAIDLPIAREKATGIPYLP
                     GSSLKGVLRDRARGEGWDEDTLEAVFGPETERASEHAGALQVGDARLLLLPVRSLYGV
                     FAHVTSPYLLERFLREARMVGLNPPEGPAAPPQEGVAVAPGSHLAAEGRVFLEDLDLR
                     AQAGEAVGAWEAWLSQQTQAPVGGRMAVVHDDLMGFLLETATEVVARIRLEDTTKTVA
                     RGALWYEESLPAESVLYSLVRTEASHRKTKPLGAASVLELFQGLVDGQALQLGGKATV
                     GRGLCRVRVGR"
     misc_feature    complement(250819..251646)
                     /locus_tag="TCCBUS3UF1_2300"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr4; Region: Cmr4_III-B; cd09682"
                     /db_xref="CDD:187813"
     gene            complement(251661..252911)
                     /locus_tag="TCCBUS3UF1_2310"
                     /db_xref="GeneID:12251585"
     CDS             complement(251661..252911)
                     /locus_tag="TCCBUS3UF1_2310"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653354.1"
                     /db_xref="GI:384438630"
                     /db_xref="GeneID:12251585"
                     /translation="MRKFQEAFGPRKREAGGSLVRRDGVRILTWERSYLLLTPLFGGG
                     VEPKRADPVSVVRATEVRGQLRFWWRAVRGWQAEGDLGRLWRLEASLFGHAGEGGASP
                     LAVELEVVEEGKEEAAFQDLPGKNFPRGRSDIAHPYLAFPLQRTRQDPVNHPVRVGVR
                     FRLRLACPERIEGLDPKEELEAALWAWETFGGIGGRTRRGFGALALEGSSPPTEEGIR
                     AQLRRYSRERGWPPGVPHLTPKSLVRVMGLSWREVAEAYRAFRQRRAKDDPRNPGRSR
                     WPEPDQVRRLTGRNHPRHPPRHPVGKFPRARFGLPIIFHFKDEGDPPDTTLKPPLEGT
                     DRLASPLILRPLGKGITLVAILEGSGVPGDRAVLETHDKKRSWEVQVGLTPEEAQRIE
                     PLGGEVDPLRAFLRYLENRAGGGR"
     misc_feature    complement(251883..252806)
                     /locus_tag="TCCBUS3UF1_2310"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr1; Region: Cmr1_III-B; cl17436"
                     /db_xref="CDD:247990"
     gene            complement(252908..254017)
                     /locus_tag="TCCBUS3UF1_2320"
                     /db_xref="GeneID:12251586"
     CDS             complement(252908..254017)
                     /locus_tag="TCCBUS3UF1_2320"
                     /note="similar to Putative uncharacterized protein TTHB161
                     of Thermus thermophilus UniRef RepID=Q53W08_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653355.1"
                     /db_xref="GI:384438631"
                     /db_xref="GeneID:12251586"
                     /translation="MLIEPRDPLIVRDGRPFTNSPGARAHSLAFPLPQTLAGAYRARR
                     GMEEGLSFPQDADRVREWGLKGPLLAEEAETGWRLLAPRPLDALKLGERVYALRPLEV
                     PEGAGTNLPQGLFPVGLPKTGLKGKPSPLPAFWYWEDWQRWLLEEAPEGFQPKGHGGP
                     TIEVRTHVSLRPEAGTAREGALFQTSGLEFAYRRGEGDGRPHRLALALWPEDGVEVEG
                     IHPLGGERRLAYWRRGGPPLPPMPSGLLEALWEHRAARIVLLTPAFFRKGYLPEKDAF
                     LGAQVVGAAVGRPVVVSGWDLKKGRPKPTRRAVPPGSVYFVRLPGEWSREEVRAFAEK
                     VWLQNLSEEETDRKDGFGLAALGVWSGKPWRWEEV"
     misc_feature    complement(252947..254011)
                     /locus_tag="TCCBUS3UF1_2320"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cmr3; Region: Cmr3_III-B; cd09748"
                     /db_xref="CDD:187879"
     gene            complement(254007..255779)
                     /locus_tag="TCCBUS3UF1_2330"
                     /db_xref="GeneID:12251587"
     CDS             complement(254007..255779)
                     /locus_tag="TCCBUS3UF1_2330"
                     /note="similar to CRISPR-associated protein, Crm2 family
                     of Thermus UniRef RepID=B7A6X6_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Crm2"
                     /protein_id="YP_005653356.1"
                     /db_xref="GI:384438632"
                     /db_xref="GeneID:12251587"
                     /translation="MESLLAISLGPVQDFIATARRTRDLYAGSRLLSEAAGKAAEVLA
                     ERLGPERLIFPAPKTKEELAKLGQAGIPNVLLARVSEGLDPGALAEVALGAAREYLRE
                     KAKELFTREGRRAYVSLEAALDQVGDLLEGYYAHLPLQGDYPQARERVMALLGARKNT
                     RDFRPVSWGSPAYKSSLDGARESVLLLPESRAEALRVRLRLGLREGEYLSGPDLLKRW
                     WEAEGGFVSTIHMAALPFWEGVRKAGKEGLFRKGLEDLAQLAGEEAKGNTRHPALRDT
                     PFWEWDVRLLYESRLEEFPALGEDPRRLEEARGRLRRLLGELGLGSPGSYYALLHADG
                     DRMGEAIDRQKTPEAHRELSRALALDFAAQVRELVQGRGGGLVYSGGDDVLALLPLHR
                     ALETAWALARRFQEVMARFGGGEGKPSLSVGLAVVHHLEPLQDALELARKAERLAKEG
                     PEGTPEDEKRNALGVAYSPRSGSELLVRGRWDETPRLTQRLLRYADLLRAGEVPSRAA
                     HELRELLAWRKGLSEEALVAEALRILGRKAMEKKYRQELSDWIQNARDVERLAQELIL
                     ARPLAEALDQAGIPVESREVWDAH"
     misc_feature    complement(254358..255773)
                     /locus_tag="TCCBUS3UF1_2330"
                     /note="CRISPR/Cas system-associated protein Cas10; Region:
                     Cas10_III; cd09679"
                     /db_xref="CDD:187810"
     misc_feature    complement(254433..255770)
                     /locus_tag="TCCBUS3UF1_2330"
                     /note="CRISPR-associated protein Cas10/Cmr2, subtype
                     III-B; Region: cas_TM1794_Cmr2; TIGR02577"
                     /db_xref="CDD:233935"
     gene            complement(255828..256067)
                     /locus_tag="TCCBUS3UF1_2340"
                     /db_xref="GeneID:12251588"
     CDS             complement(255828..256067)
                     /locus_tag="TCCBUS3UF1_2340"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653357.1"
                     /db_xref="GI:384438633"
                     /db_xref="GeneID:12251588"
                     /translation="MAFLRVLEDPVLKAKQVKGLQDLVGVLQSRNQPLLIHGLLVPTE
                     KQVEQVQQLGRELLKALQEEGAPSLELEVLPLERL"
     misc_feature    complement(255894..>256064)
                     /locus_tag="TCCBUS3UF1_2340"
                     /note="CRISPR/Cas system-associated protein Csx1; Region:
                     Csx1_III-U; cl19032"
                     /db_xref="CDD:267385"
     gene            complement(257448..258431)
                     /locus_tag="TCCBUS3UF1_2350"
                     /db_xref="GeneID:12251589"
     CDS             complement(257448..258431)
                     /locus_tag="TCCBUS3UF1_2350"
                     /note="similar to CRISPR-associated protein Cas1 of
                     Bacteria UniRef RepID=B0K547_THEPX"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="YP_005653358.1"
                     /db_xref="GI:384438634"
                     /db_xref="GeneID:12251589"
                     /translation="MPKPVYIFSSGRLSRLANTLVLETEDRKRHLPVEQVSELYLFGE
                     VDLNKRFLEFAAQKGILLHFFNRFGYYVGSFYPREHLLSGYLTLRQAQHYLDANRRLN
                     LARRFVEGGLENIRRLLRKEEAKGKRVSDALDTIGEILSQVKGAQHVGELMALEGRAR
                     ESYYAVWDELLGEEWSLERNRRPPKDPVNALVSFGNTLLYTAILAQIYQTHLDPRIGF
                     LHEANYRRHSLNLDVAEVFKPVLVDRMIFRLIRRGQIKTGHFLREGQGVFLSEAGKRL
                     VVEEWENSLQATYRHLSLKRSVSYRTTLRLELYKLEKHLIEENPYIPYRFR"
     misc_feature    complement(257457..258422)
                     /locus_tag="TCCBUS3UF1_2350"
                     /note="CRISPR/Cas system-associated protein Cas1; Region:
                     Cas1_I-B; cd09722"
                     /db_xref="CDD:187853"
     gene            complement(258424..258591)
                     /locus_tag="TCCBUS3UF1_2360"
                     /db_xref="GeneID:12251590"
     CDS             complement(258424..258591)
                     /locus_tag="TCCBUS3UF1_2360"
                     /note="similar to CRISPR-associated protein Cas4 of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A748_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas4"
                     /protein_id="YP_005653359.1"
                     /db_xref="GI:384438635"
                     /db_xref="GeneID:12251590"
                     /translation="MERVKLTPELEAKVRETERRLKELLQQEKPPPARRIPACRACAY
                     LEFCFAEEEDA"
     misc_feature    complement(258442..>258591)
                     /locus_tag="TCCBUS3UF1_2360"
                     /note="CRISPR/Cas system-associated protein Cas4; Region:
                     Cas4_I-A_I-B_I-C_I-D_II-B; cl00641"
                     /db_xref="CDD:260548"
     gene            complement(258601..258870)
                     /locus_tag="TCCBUS3UF1_2370"
                     /db_xref="GeneID:12251591"
     CDS             complement(258601..258870)
                     /locus_tag="TCCBUS3UF1_2370"
                     /note="similar to CRISPR-associated protein Cas4 of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A748_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas4"
                     /protein_id="YP_005653360.1"
                     /db_xref="GI:384438636"
                     /db_xref="GeneID:12251591"
                     /translation="MGHALEPYPDHELLALGRLLQQTAYPEARKEVALPGIRMDLLMG
                     RGGTLVVAEVKRRSGSKEAHLLQLGYYLLRLREVGLEAEGELRYP"
     misc_feature    complement(<258604..258870)
                     /locus_tag="TCCBUS3UF1_2370"
                     /note="CRISPR/Cas system-associated protein Cas4; Region:
                     Cas4_I-A_I-B_I-C_I-D_II-B; cl00641"
                     /db_xref="CDD:260548"
     gene            complement(258921..261158)
                     /locus_tag="TCCBUS3UF1_2380"
                     /db_xref="GeneID:12251592"
     CDS             complement(258921..261158)
                     /locus_tag="TCCBUS3UF1_2380"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653361.1"
                     /db_xref="GI:384438637"
                     /db_xref="GeneID:12251592"
                     /translation="MLLARTSPDEPLLEHLLGVGALAEGYLAPLGLGEEGRLAGLCHD
                     LGKATPYFQEMLAGQRAKGDPLTWHALLGALYAAWTARQRGMGEKSLLLFLAVLEHHG
                     SLKTPWERIPLGPRQASEKAWKILPKQIRALQESPLFPALVADLGLPPPEAFLGEGAW
                     EEAERLAREADALLDREGRDLGLHYRLALLYSALLDADRRLAGQAPPKGEGIPIPPEA
                     AEAHLARKSRPTPLSPQREALFRGVGEVLEGPLERVFPARLTLTAPTGAGKTLAALRF
                     ALALRERVHRERGFRPKVVYALPYIAIADQVEEEARGVLQAAGLKPEEHLLVHHHLAL
                     AREEEGSVEEALLLQETWDAEVVVTTFHQLFPTLVGPGSALRPLHALAKGAILILDEV
                     QTLPAELWPFLGELLRQLPGQMTVISMTATQPGLVKGQEVAPHLPSYPRRVRLAWHGA
                     RTLEELGQALLQEGPKSRLVVVNTVREAISLYRFLREEGLPHLYLLTSHIIPKHRKAR
                     LGEIRAKLQEGQPLTLVATQVVEAGVDLDFQEGYRAFAPMESILQVAGRVNRSALGEG
                     RLWVLDLEGDGGRRVYGTILLDRSRRVLGPRLAEGLWDLEAYALLPQYYRLVEEGISQ
                     AKGQDLLAKLARLDYSQLRFTLIEEAPSIPIFIEWDQEATRLLGELEGALTLKDPGER
                     RKRLRPLLARIQGYTVSPLLQRALKNLPPPLLGREEWRHVPREAVADFYDEEMGFLWE
                     MEQFL"
     misc_feature    complement(260562..261149)
                     /locus_tag="TCCBUS3UF1_2380"
                     /note="CRISPR/Cas system-associated protein Cas3'';
                     Region: Cas3''_I; cd09641"
                     /db_xref="CDD:193608"
     misc_feature    complement(259371..260384)
                     /locus_tag="TCCBUS3UF1_2380"
                     /note="CRISPR-associated helicase Cas3; Region: cas3_core;
                     TIGR01587"
                     /db_xref="CDD:233483"
     misc_feature    complement(259413..260384)
                     /locus_tag="TCCBUS3UF1_2380"
                     /note="CRISPR/Cas system-associated protein Cas3; Region:
                     Cas3_I; cd09639"
                     /db_xref="CDD:187770"
     gene            261201..261923
                     /locus_tag="TCCBUS3UF1_2390"
                     /db_xref="GeneID:12251593"
     CDS             261201..261923
                     /locus_tag="TCCBUS3UF1_2390"
                     /note="similar to CRISPR-associated protein Cas6 of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A746_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas6"
                     /protein_id="YP_005653362.1"
                     /db_xref="GI:384438638"
                     /db_xref="GeneID:12251593"
                     /translation="MPSEGGRLSLRFFAEGRLPVTYREGLQAALYQALPLPLGQRLHD
                     GGLLEGHRPLKLFVFSRLQGLLYLREEKAFLAQGELVLHFASALPEVVEGLAKGVWER
                     GGLEVHGLFLRLLGMDLDPLPEGGDLVVEALSPITAYRTEGGRTLYFNPLNREFALLL
                     EANLVRKAQLLGLEAGSLALKPVGFRPQHKRVERYKDTWIEGWMGRYRLEGSPHLIRL
                     ALLTGLGAKNSQGFGFVREVKG"
     misc_feature    261363..261908
                     /locus_tag="TCCBUS3UF1_2390"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Cas6; Region: Cas6-I-III; cd09652"
                     /db_xref="CDD:187783"
     gene            261971..263791
                     /locus_tag="TCCBUS3UF1_2400"
                     /db_xref="GeneID:12251594"
     CDS             261971..263791
                     /locus_tag="TCCBUS3UF1_2400"
                     /note="similar to Putative uncharacterized protein of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A745_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653363.1"
                     /db_xref="GI:384438639"
                     /db_xref="GeneID:12251594"
                     /translation="MEDYVQRASGRLYLLDLDPQNRVAGFTPYELDEEKCARFLWVGD
                     PPASNAPRDRATTKDLRYLLGQVPTRMAEHSGLKSLLQGFLWDPGKPGGKARYLLDLR
                     GWRLQGAKDAEAPPFRIQGGRLEMDGTAEGKTAGELAEALAQVLRAAYDIRSPEKGGV
                     LLFSLALSGKPLAEYPEYGDYLRQRLLQEPFAEAQMGICHGCGRKDRVTGNFSAFRLK
                     FYITDKKSFAPGVDEGAFPRAYALCQTCFAALGVGERLAWERLRQRFLERDVLVLPEA
                     DFPQESLERLLERLVGQVQGLERLERWKDFLERAAHRQEEVRYLGFSLLFFQRAQAAT
                     KAEELVLEVPPSRVEAILKTLQEARERGFPVEGLRDWLFLMPLSRGRKGEMGQMGLAL
                     QAVSRIFLQLPLFPKDLLPLWLKTAERVYREDGTLYALTRYRAGQGVIDLVNLGAGWM
                     WVLQRLEVWGGNMEGEVKGALPLTEEEKPLFEAYGFGALRAGLYLLGQAMEAVGQAQA
                     RLSEYRKEPLLDSIGWQGMSLVRVRHLVPEVMAKATYYLEGDDRTRVLDLLGRATDLL
                     ERSRESLSEREVPYYILMGYAQARSKRLRSGRREEVTHGG"
     misc_feature    262013..263734
                     /locus_tag="TCCBUS3UF1_2400"
                     /note="CRISPR/Cas system-associated protein Cas8a1;
                     Region: Cas8a1_I-A; cl19018"
                     /db_xref="CDD:267371"
     gene            263781..264740
                     /locus_tag="TCCBUS3UF1_2410"
                     /db_xref="GeneID:12251595"
     CDS             263781..264740
                     /locus_tag="TCCBUS3UF1_2410"
                     /note="similar to CRISPR-associated protein, Csh2 family
                     of Thermus aquaticus Y51MC23 UniRef RepID=B7A744_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, Csh2"
                     /protein_id="YP_005653364.1"
                     /db_xref="GI:384438640"
                     /db_xref="GeneID:12251595"
                     /translation="MVANAEILYLYEAKDTNPNGDPDAENRPRMDYVGQRLLVSDVRL
                     KRYVRDYLLARGEDVWVRSREDGSRTDADGRLEDLKGLYKEETGRDAGAKKKDLDPEF
                     LAWYLRRLRDVRLFGAVLPIKAEGESKGGTGQFVGAVQFDWGYSLHPVEVYTATISSV
                     FAGRTEGGKGEHGTFGKDHRVHYALIAFWGRVSKRRGEAVGLTSEDLEVLEKGLLEGL
                     LEGATTRSKVGQTPRLYLRVDWKEGFRPMGDPRDGLSIRPVEGKAPEGIRSVRDYVLQ
                     AHALSESLNSLRESIARVRLWQHPDLQLEGLNLSGLSLEEVNL"
     misc_feature    263796..264686
                     /locus_tag="TCCBUS3UF1_2410"
                     /note="Family of unknown function (DUF694); Region:
                     DUF694; pfam05107"
                     /db_xref="CDD:253012"
     gene            264839..265453
                     /locus_tag="TCCBUS3UF1_2420"
                     /db_xref="GeneID:12251596"
     CDS             264839..265453
                     /locus_tag="TCCBUS3UF1_2420"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653365.1"
                     /db_xref="GI:384438641"
                     /db_xref="GeneID:12251596"
                     /translation="MQGLLAAALGLGEEYLGELRGLWVSARPTAPLRHAFQTVNYLFL
                     KEGKLEELRGLYREGRTQIPVQYLLGEEGRPVAFEVYVASERKGIVEGLGEALANPAY
                     PLALGPAYALAWAEGISILEADLRSHWTGIGLGWWEAGKLRLQGTPLGARLYRDRFPL
                     SLGPGRQPMRIGELALEVRGEPLPVQYEGEVLMLGEVAVGVVQV"
     gene            265457..265717
                     /locus_tag="TCCBUS3UF1_2430"
                     /db_xref="GeneID:12251597"
     CDS             265457..265717
                     /locus_tag="TCCBUS3UF1_2430"
                     /note="similar to CRISPR-associated protein Cas2 COG1343;
                     similar to CRISPR-associated protein Cas2 of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A742_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein Cas2"
                     /protein_id="YP_005653366.1"
                     /db_xref="GI:384438642"
                     /db_xref="GeneID:12251597"
                     /translation="MYVVMVYDVAVERVVKVLKVGRRYLTWVQNSVLEGELSPAQYAR
                     LKAEVRKIIEPSDAVRFYLFPNRDSLRIETIGSTKNEPDQFI"
     misc_feature    265463..265693
                     /locus_tag="TCCBUS3UF1_2430"
                     /note="CRISPR/Cas system-associated protein Cas2; Region:
                     Cas2_I_II_III; cd09725"
                     /db_xref="CDD:187856"
     gene            266245..266400
                     /locus_tag="TCCBUS3UF1_2440"
                     /db_xref="GeneID:12251598"
     CDS             266245..266400
                     /locus_tag="TCCBUS3UF1_2440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653367.1"
                     /db_xref="GI:384438643"
                     /db_xref="GeneID:12251598"
                     /translation="MNRTYKGLKLAVLHLFPAWAPNALNRTYKGLKQGMDPGAVVAAL
                     KRFEPYL"
     gene            complement(266880..267971)
                     /locus_tag="TCCBUS3UF1_2450"
                     /db_xref="GeneID:12251599"
     CDS             complement(266880..267971)
                     /locus_tag="TCCBUS3UF1_2450"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653368.1"
                     /db_xref="GI:384438644"
                     /db_xref="GeneID:12251599"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     misc_feature    complement(267102..>267542)
                     /locus_tag="TCCBUS3UF1_2450"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(269669..269788)
                     /locus_tag="TCCBUS3UF1_2460"
                     /db_xref="GeneID:12251600"
     CDS             complement(269669..269788)
                     /locus_tag="TCCBUS3UF1_2460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653369.1"
                     /db_xref="GI:384438645"
                     /db_xref="GeneID:12251600"
                     /translation="MGVLEVLEALPPCSQLIGRVQRQPPSPWAVQRFQDFKPL"
     gene            270256..271476
                     /locus_tag="TCCBUS3UF1_2470"
                     /db_xref="GeneID:12251601"
     CDS             270256..271476
                     /locus_tag="TCCBUS3UF1_2470"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653370.1"
                     /db_xref="GI:384438646"
                     /db_xref="GeneID:12251601"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVYKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    270295..271443
                     /locus_tag="TCCBUS3UF1_2470"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    270331..271380
                     /locus_tag="TCCBUS3UF1_2470"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            271715..272806
                     /locus_tag="TCCBUS3UF1_2480"
                     /db_xref="GeneID:12251602"
     CDS             271715..272806
                     /locus_tag="TCCBUS3UF1_2480"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653371.1"
                     /db_xref="GI:384438647"
                     /db_xref="GeneID:12251602"
                     /translation="MEQLTPLINALKRYWKADLRRLTFLAALVMALVTARTTSGPRLA
                     LSLGSIASPDPRSAYRRFQRFLAWPGLDGEGYARFIFALLRPQGLLLVMDRTEWELGK
                     SKVNLLMLAFLYQGLAVPLFWSFLPHDGNSSTPERIALMERALAFLRAHFPHLRVEGF
                     LADREFIGEAWFRYLEEKGIPRCIRIKANTRMWRLGSGPRAWELFASLKVGESRVPRR
                     RYWVYGRRMWVVGLRLGVREWLIVATDLDPHRVLEVYGLRWGIERLFGALKGRGFDLE
                     ATHVTRGERLSRLLVPLSLAFVWAFRTGLVLHRVRPVRPKKHGRLGQSLFRAGLDLLT
                     LWALALWGAGGGRRGSPLGLCPMEVLTCT"
     misc_feature    <272144..272584
                     /locus_tag="TCCBUS3UF1_2480"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(273178..275055)
                     /locus_tag="TCCBUS3UF1_2490"
                     /db_xref="GeneID:12251603"
     CDS             complement(273178..275055)
                     /locus_tag="TCCBUS3UF1_2490"
                     /note="similar to Putative uncharacterized protein of
                     Chroococcales UniRef RepID=B0JHQ0_MICAN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653372.1"
                     /db_xref="GI:384438648"
                     /db_xref="GeneID:12251603"
                     /translation="MPPVHRLLHITLDTTIDMNGADILLKGLNLKTQKKGGRRQMDNE
                     RIQTKVFRIRQLLESSVVYQVPRFQRPYSWSRVHWKTFLEDIENTCHLSKDGMPYLHF
                     LGAIITMARPSGVEVVAPYILVDGQQRLITIALLLAAIRNRAAEAGLSSLSHELDKLL
                     RNADEELELKVQPTEFDEAALRGIIRGTPLEELHSPIGNAYSFFTDKLKGRAPEELEV
                     LAKALLDQTEVVRIHLSQGENAYRIFESLNYKGSPLTPADLVRNYLFMRLAAEGKEKE
                     KETYEKVWAPVEEAYKKVFPPSPANSIPHLERMSLGIWHYVRTNGEEIPWDATYPALI
                     DRLNATLKEGKATESFALELKESLADYLFFERPHLETNPKLQRRLEAFRILGFGVAAP
                     LVMALKQRIRKGVLDIEDADQVLAVMEAYYLHRILASVPTNTVGRTVLSVLKNGLLDE
                     PNPAEKVRRFLKGLSGNRRWPDREELEKRNAERSIYVWDGGGRDPRTSHAYYILKRIE
                     QYLWKKLKRKELPNLENLTLEHIMPRTLSEAWKAEIGIDWERTHKSHLNALGNLTLTG
                     YNQEMGNKPFSEKLKVLRESTLSINQEYFRSVSLERWDEQAIRERTKWLLDLVYEIWP
                     A"
     misc_feature    complement(274261..274899)
                     /locus_tag="TCCBUS3UF1_2490"
                     /note="Protein of unknown function DUF262; Region: DUF262;
                     pfam03235"
                     /db_xref="CDD:251819"
     misc_feature    complement(273202..273648)
                     /locus_tag="TCCBUS3UF1_2490"
                     /note="Protein of unknown function (DUF1524); Region:
                     DUF1524; pfam07510"
                     /db_xref="CDD:254249"
     gene            complement(275018..276238)
                     /locus_tag="TCCBUS3UF1_2500"
                     /db_xref="GeneID:12251604"
     CDS             complement(275018..276238)
                     /locus_tag="TCCBUS3UF1_2500"
                     /note="similar to Transposase of Thermaceae UniRef
                     RepID=Q5SJJ0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_005653373.1"
                     /db_xref="GI:384438649"
                     /db_xref="GeneID:12251604"
                     /translation="MFNRGAHLSTRRCPVDQDTLRILLREAVRETVAEVLQTVLELDR
                     TAFLQVHGGRRNGYYPRKLETTFGQVDLKVPRDRESRYYPAFLKPYVRRLVDVGEVAV
                     ALYAAGVSQRKAAEILSLLLGHRYSHETLSALTDEVLEAAGAFRTRPLPEEMAFVYLD
                     GLSLKVFREGEGIVRESVYVALGIAPNGERRVLGFWLLPTESALGWEGVLGELWQRGL
                     RRVLLFITDGLPGLPEAIRRVYPQAEWQRCVVHGVRWSLSQVRARDRGLLAEDLRRVY
                     GAESREEALGALEEVKAAWGSRYPGVVGLWVQDSGAFLRFYGYPKVLWPYLRSTNLME
                     RFIREVRRGTKVRDHKFPKEEAVHKLLYLESERQEGRWAERKLKGFSEVKEVLEKMLQ
                     ERYAPRTQTLTHNS"
     misc_feature    complement(275051..276199)
                     /locus_tag="TCCBUS3UF1_2500"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(275114..276163)
                     /locus_tag="TCCBUS3UF1_2500"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            complement(276724..279642)
                     /locus_tag="TCCBUS3UF1_2510"
                     /db_xref="GeneID:12251605"
     CDS             complement(276724..279642)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="similar to Type I site-specific deoxyribonuclease,
                     HsdR family of Bacteria UniRef RepID=B8GAW6_CHLAD"
                     /codon_start=1
                     /transl_table=11
                     /product="Type I site-specific deoxyribonuclease, HsdR"
                     /protein_id="YP_005653374.1"
                     /db_xref="GI:384438650"
                     /db_xref="GeneID:12251605"
                     /translation="MSISSERRTVQNPLLRYATEAGWTYVPPDEALRLRSGEDKPFLH
                     AVLVEQLQRLNPGVVTHATKAEEVVRRLQALRADIEGNREAWEYLKGLKTIFVEADRR
                     ERNLRLLDPDRPEDNRFHVTDEFVFRSGARRIRADVVFFINGIPVLVIETKAATRLEG
                     IAEAFDQIRRYHAEAPDLLVHLQLFALTHLVQFFYGATWSLSRKMLFNWREEHGSGDF
                     ETLVKSFLAPRRVMRVLTEYILFARKDGELTKVVLRPHQMRATERVLARAHDPQKRRG
                     LIWHTQGSGKTYTMLTIARRLLEDPRFENPTVLLIVDRNELEQQLFQNLEAIGFSRVH
                     LALSKRHLRELLAADTRGIIVSMIHKFDDMPADLCTRHNVFVLVDEAHRSTGGDLGNY
                     LMGALPNATFIGFTGTPIDRTAHGKGTFKTFGTDDPQGYLDKYSIRESIEDGTTVPLH
                     YQLAPNDLIADREAMEREFWAAAELEGVADIEEINRVLDRAVTLTNMLKNPERVAKIA
                     AFVADHFKQYVQPMGYKAFLVAPDREGCVLYKEALDRHLPSEWSAVVISAGHNDPAHL
                     KRYHLSEDAERRLRQAFRKPGENPQIFIVTEKLLTGYDAPILYCMYLDKPMRDHVLLQ
                     AIARVNRPYESEQGQRKTTGLIVDFVGIFDNLERALAFDSQDVSGVVQGIDALKARFA
                     QLMDEGRHTYLPIAAGEVGDKAAEALLEHFRDKDRREAFYQFFRELEEVYEILSPDPF
                     LRPHLNDYQRLAEMYRLLRASYEPHIPVDKSFLRKTATIVQQHTHTSLVHEPSATYEI
                     GAAMLMALLNAEQPDTVKVFNLLKELYRLVEAKGHSAPYLLSIGERAEEIRRRFEERQ
                     IESQEALRELNELIRQLRAAEEERRQRGDLAARPHAEQAFTVEWWLRLHNIAPERAKE
                     VADTMEAAFAEFPHWMSDRRQEGELRKCLYKALFAISVSDVVAWTNAILDLLRRATDA
                     "
     misc_feature    complement(277663..279579)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="type I site-specific deoxyribonuclease, HsdR
                     family; Region: hsdR; TIGR00348"
                     /db_xref="CDD:232933"
     misc_feature    complement(279058..279387)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="Type I restriction enzyme R protein N terminus
                     (HSDR_N); Region: HSDR_N; pfam04313"
                     /db_xref="CDD:252519"
     misc_feature    complement(278416..278823)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(278782..278796)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(278497..278508)
                     /locus_tag="TCCBUS3UF1_2510"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(279639..280349)
                     /locus_tag="TCCBUS3UF1_2520"
                     /db_xref="GeneID:12251606"
     CDS             complement(279639..280349)
                     /locus_tag="TCCBUS3UF1_2520"
                     /note="similar to EcoKI restriction-modification system
                     protein HsdS PRK09737;
                     similar to Restriction modification system DNA specificity
                     domain protein of Methanosphaerula palustris E1-9c UniRef
                     RepID=B8GH35_METPE"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653375.1"
                     /db_xref="GI:384438651"
                     /db_xref="GeneID:12251606"
                     /translation="MEALRALKKSLMRHLFTYGPVPIDAAEHVPLRDTELGPLPAHWQ
                     VVRLGEVAEVKYGRAKPKAEGEIPVIGSGGIYGWADAPLVEFPTLVIGRKGTAGQVWL
                     VEQACWPSDTTYYLIWKKPVDVWFVFGFVSLNPLSGEHARTTLPSLKRHDLENYLIPL
                     PPLPEQREIARMLQAVDQRIQAEEAHVHALEALFRTLLHELMTARRRLPAEFIAKFAS
                     HGDQTLRAATPTIEERSL"
     misc_feature    complement(279735..>280349)
                     /locus_tag="TCCBUS3UF1_2520"
                     /note="Restriction endonuclease S subunits [Defense
                     mechanisms]; Region: HsdS; COG0732"
                     /db_xref="CDD:223804"
     misc_feature    complement(279795..280223)
                     /locus_tag="TCCBUS3UF1_2520"
                     /note="Type I restriction modification DNA specificity
                     domain; Region: Methylase_S; pfam01420"
                     /db_xref="CDD:250605"
     gene            complement(280913..282481)
                     /locus_tag="TCCBUS3UF1_2530"
                     /db_xref="GeneID:12251607"
     CDS             complement(280913..282481)
                     /locus_tag="TCCBUS3UF1_2530"
                     /note="similar to N-6 DNA methylase of Bacteria UniRef
                     RepID=D0MHM2_RHOM4"
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="YP_005653376.1"
                     /db_xref="GI:384438652"
                     /db_xref="GeneID:12251607"
                     /translation="MDLTTLENWLWEAACAIRGPVDAPKFKDYILPLIFLKRLSDVFE
                     DELRSLAVEFGGIDVAQNLVEQERAHGKVTLVRFYIPENARWETVRRQTSHLGEYLTD
                     AVRALARENPVLAGVIDIVDFNATAAGQRIVPDEYLARLINVLSRYRLGLGDVEPDIL
                     GRAYEYLLRKFAEDQGQSAGEFYTPREVGVLMARLLEPEPGMMVYDPTCGSGGLLIKC
                     HLRLLERFGKQENGRLKLPTNIAPLHVFGQEINPATFAIARMNAVIHDIQADIRIGDT
                     MRQPAFKGQGGGLQTFDLVVANPMWNQKFPQELYKNDPYNRFCYGAPPSSSADWGWLQ
                     HMLASLNERGRMAVVLDTGAVSRGSGNQGSNRERDIRKAFVEADLIEAVILLPENLFY
                     NTTAPGVIIVVNRRKRYPGQILLINASQLFAKGRPKNYLTEEHIETIASIYHAWGDPA
                     GANRDAPLHAIITREEAARNDYNLSPSRYVSISGSEEVLPLEEALVRLEEAEEERAEA
                     ERALQAVLQQLGLR"
     misc_feature    complement(282047..282466)
                     /locus_tag="TCCBUS3UF1_2530"
                     /note="HsdM N-terminal domain; Region: HsdM_N; pfam12161"
                     /db_xref="CDD:256881"
     misc_feature    complement(281021..282016)
                     /locus_tag="TCCBUS3UF1_2530"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
                     /db_xref="CDD:251262"
     misc_feature    complement(281432..281872)
                     /locus_tag="TCCBUS3UF1_2530"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            complement(283205..283984)
                     /locus_tag="TCCBUS3UF1_2540"
                     /db_xref="GeneID:12251608"
     CDS             complement(283205..283984)
                     /locus_tag="TCCBUS3UF1_2540"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653377.1"
                     /db_xref="GI:384438653"
                     /db_xref="GeneID:12251608"
                     /translation="MLYGRGGGALPWRLKEVLPEALKRAGGKERLQRGLVLASWKEVV
                     GRELARLTEAVALEEGVLTVWVADPVTAHQLTYSRLALLRRYEERFPGKVREIRFLVG
                     RLEAPSPEPPPPPKDPEAGRKALALAQLAPSELREAVARAAFALFAHKRGNPCPLCGT
                     PSETHPCPTCRRLLESPLVRKEAERLKRGRPPRLEGEALLVARHLARERLLAEMRELY
                     PQALREAGLRPLLRDLARRFQSLFPEEALPEGVQSLLAKED"
     misc_feature    complement(283688..283948)
                     /locus_tag="TCCBUS3UF1_2540"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; pfam05258"
                     /db_xref="CDD:253119"
     gene            complement(283942..284973)
                     /locus_tag="TCCBUS3UF1_2550"
                     /db_xref="GeneID:12251609"
     CDS             complement(283942..284973)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="similar to recombination protein F PRK14079;
                     similar to RecF protein of Thermus UniRef
                     RepID=Q72GX7_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653378.1"
                     /db_xref="GI:384438654"
                     /db_xref="GeneID:12251609"
                     /translation="MRLRLFRQKGFRNLYLETFHPPPVPFAVVGGNAQGKTSLLLGVH
                     LLLGGEVRASLADLVRFGEREAWLYGEVETELGRYRVEQRLFPEGREIRVNGKAVGLK
                     GLWELPGSVLLLPEDVEVVLGPKEERRGFLDRMIGRFSRRYAALLSAYEKVLRQRNAL
                     LKAGGNGLSVWDRELARYGTEIMAFRRRFLRRFLPTFQEVHRSLAPGEVGLALEESAQ
                     GDFLEALEQRRPEELLRGQTLLGPHRDDLVFLLAGRPAHRFASRGEAKALALALRLAE
                     HRLLWEHHGEAPLLLVDEWSEELDPGRRKALLTYAQGLPQAILAGLQTPEGMPVCSMA
                     GGVVLCPGG"
     misc_feature    complement(283948..284973)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="recombination protein F; Provisional; Region: recF;
                     PRK14079"
                     /db_xref="CDD:184491"
     misc_feature    complement(284011..284943)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(284863..284886)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(284092..284097,284629..284631,
                     284860..284868,284872..284877))
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(284629..284640)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(284167..284196)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(284092..284109)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(284074..284085)
                     /locus_tag="TCCBUS3UF1_2550"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     gene            complement(284974..286146)
                     /locus_tag="TCCBUS3UF1_2560"
                     /db_xref="GeneID:12251610"
     CDS             complement(284974..286146)
                     /locus_tag="TCCBUS3UF1_2560"
                     /note="similar to hypothetical protein PRK12382;
                     similar to Major facilitator superfamily MFS_1 of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A8T1_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator superfamily MFS_1"
                     /protein_id="YP_005653379.1"
                     /db_xref="GI:384438655"
                     /db_xref="GeneID:12251610"
                     /translation="MSALGLLFLTLFNSVLGLSLLFPILGPLGRSLGLSEVQVGLFST
                     GYALMQFLLAPYWGRRSEGGRKPVLLLGILGFAASFLLFGLLALLGQKGLLPPGLLFP
                     LLLLSRLLGGAFSSATLPTAQAYVADVTGRENRTAGMALLGAAFGLAVIVGPAIGAGL
                     AGLLGLLAPVFFASGIALLNALFVALVLPESRPQGTREERRLSPWDGRVFPLLLLGFA
                     LNLSSVALEQTVAFYFQDRLGLSGVATAQKVGLALVLYGAVAVLVQGFLVRRLAWPPK
                     TLLLLGLPLGLAGFLVLVLAQGFWALALGLALQGAGAALAGPGVTAALSLAVGEGEQG
                     PVAGLNASAQALGRMLGPLLGTGLYRLAPEAPYLLGAGLLLLSWALLPLLFRRVRL"
     misc_feature    complement(285070..286137)
                     /locus_tag="TCCBUS3UF1_2560"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(285091..286128)
                     /locus_tag="TCCBUS3UF1_2560"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(285103..285105,285112..285117,
                     285124..285129,285136..285141,285172..285174,
                     285181..285186,285196..285198,285205..285210,
                     285217..285219,285364..285366,285376..285378,
                     285385..285387,285397..285399,285412..285414,
                     285454..285456,285463..285468,285475..285480,
                     285487..285489,285697..285699,285715..285720,
                     285727..285732,285766..285768,285775..285780,
                     285787..285792,285799..285804,285973..285978,
                     285982..285987,285997..285999,286006..286011,
                     286018..286020,286069..286074,286078..286086,
                     286093..286095))
                     /locus_tag="TCCBUS3UF1_2560"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(286155..286967)
                     /locus_tag="TCCBUS3UF1_2570"
                     /db_xref="GeneID:12251611"
     CDS             complement(286155..286967)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="similar to ABC-type phosphate transport system,
                     ATPase component COG1117;
                     similar to Phosphate ABC transporter, ATPase subunit of
                     Ktedonobacter racemifer DSM 44963 UniRef
                     RepID=D6TRV9_9CHLR"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphate ABC transporter, ATPase subunit"
                     /protein_id="YP_005653380.1"
                     /db_xref="GI:384438656"
                     /db_xref="GeneID:12251611"
                     /translation="MSLEMLKEHETVRTAPVSPGEALVEVKDLNLYYGAKQALFHISV
                     RFPKNQVTAIIGPSGCGKSTLLRSLNRMNDLIPGVRVEGEVLYEGVNIYDPRVDPVAV
                     RRHIGMVFQKPNPFPKTIFENVAFGLKLMGVKGSELEDRVVEALKRAALWNEVQDIFK
                     KQSGLRLSGGQQQRLCIARAIAVEPPLLLMDEPTSALDPIATQAIEDLILELKERYTV
                     VIVTHNMQQAARISDRTLFMHLGVLVEEGPTEVIFTKPQHPYTEAYITGRFG"
     misc_feature    complement(286158..286907)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="ABC-type phosphate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: PstB; COG1117"
                     /db_xref="CDD:224042"
     misc_feature    complement(286212..286898)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    complement(286779..286802)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(order(286299..286301,286392..286397,
                     286635..286637,286776..286784,286788..286793))
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(286635..286646)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(286440..286469)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(286392..286409)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(286374..286385)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(286293..286313)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     misc_feature    complement(<286173..286241)
                     /locus_tag="TCCBUS3UF1_2570"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(286964..288178)
                     /locus_tag="TCCBUS3UF1_2580"
                     /db_xref="GeneID:12251612"
     CDS             complement(286964..288178)
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="similar to ABC-type phosphate transport system,
                     permease component COG0581;
                     similar to Phosphate transport system permease protein
                     pstA of Thermus UniRef RepID=Q72GX4_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system permease PstA"
                     /protein_id="YP_005653381.1"
                     /db_xref="GI:384438657"
                     /db_xref="GeneID:12251612"
                     /translation="MNKTLAQPPQEAFGTDPWKTRIDRTFARALVLPLILSIGLLILL
                     LGDTLYRSVSVQVVRADEGPGKTYPFGLSASEVLKQELLARGYTEEEVKALLQDPTER
                     RVLFLQNRVELMWNTQDGPFRYVVTGLRDERVEDFSLAEGLRRWNELKAGLGEGERLV
                     LNPWLDQSFLTRTPSRSPLTAGIGVAIWGTVWVLSLALLIAIPVGIGTAILLEEYLRE
                     GTLNRILEVNLRNLAGVPSIVYGLLGLAIFVRELGLGPTILAAALTLGLLGIPVIVVT
                     SREALRAVPESLRQAAFALGATRRQVVFRVVVPAALPGMVTGVILSAARLIGEAAPLL
                     LVGAAAYVPFFPSGPMSEYTVIPVQIYLWVSMNIPEFARVAAAGILVMLLALSGLYLL
                     ALYLRNRFRREW"
     misc_feature    complement(286967..287689)
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstA; COG0581"
                     /db_xref="CDD:223654"
     misc_feature    complement(287033..287620)
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(287033..287035,287042..287047,
                     287051..287056,287063..287068,287096..287101,
                     287174..287179,287186..287197,287216..287218,
                     287225..287230,287270..287272,287321..287323,
                     287330..287335,287345..287347,287351..287356,
                     287363..287365,287369..287371,287375..287380,
                     287444..287446,287450..287455,287462..287491,
                     287495..287506,287540..287542,287555..287560,
                     287567..287572))
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(287180..287197,287444..287488))
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(287066..287068,287096..287098,
                     287105..287107,287177..287179,287444..287446))
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(287249..287251,287261..287266,
                     287282..287320))
                     /locus_tag="TCCBUS3UF1_2580"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(288171..289073)
                     /locus_tag="TCCBUS3UF1_2590"
                     /db_xref="GeneID:12251613"
     CDS             complement(288171..289073)
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="similar to ABC-type phosphate transport system,
                     permease component COG0573;
                     similar to Phosphate ABC transporter, inner membrane
                     subunit PstC of Thermus aquaticus Y51MC23 UniRef
                     RepID=B7A8T4_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphate ABC transporter, inner membrane
                     subunit PstC"
                     /protein_id="YP_005653382.1"
                     /db_xref="GI:384438658"
                     /db_xref="GeneID:12251613"
                     /translation="MEILKQRPSRNPKEVLTFALLVLLSSVTLFTTLGVILSLIGDVA
                     QFFRRVPLLEFLLAPEWTPLFDEPRYGISPLIAGTFLVTFIALLVAVPLGLALAIYLS
                     EYASGPARARIKGTLELFEGIPTVVFGYFALLFVTPLLQRFIPDLNIFNPLSAGLVMG
                     FAIIPYISNVAADAMESVPRSIREAAYALGARPYEVALRVVFPAAISGIIAAIILATS
                     RAIGETMIVAIAAGQRPALTLDPRETIATMTSYIVQAATGDQPTGSTAFYALFAVGFT
                     LFLLTLLLNILAQYVVERYRERYE"
     misc_feature    complement(288177..289055)
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstC; COG0573"
                     /db_xref="CDD:223646"
     misc_feature    complement(288369..288848)
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(288387..288392,288399..288410,
                     288429..288431,288438..288443,288483..288485,
                     288534..288536,288543..288548,288558..288560,
                     288564..288569,288576..288578,288582..288584,
                     288588..288593,288675..288677,288681..288686,
                     288693..288722,288726..288737,288768..288770,
                     288783..288788,288795..288800))
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(288393..288410,288675..288719))
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(288390..288392,288606..288608,
                     288675..288677))
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(288462..288464,288474..288479,
                     288495..288533))
                     /locus_tag="TCCBUS3UF1_2590"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(289130..290095)
                     /locus_tag="TCCBUS3UF1_2600"
                     /db_xref="GeneID:12251614"
     CDS             complement(289130..290095)
                     /locus_tag="TCCBUS3UF1_2600"
                     /note="similar to Phosphate binding protein of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A8T5_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphate binding protein"
                     /protein_id="YP_005653383.1"
                     /db_xref="GI:384438659"
                     /db_xref="GeneID:12251614"
                     /translation="MRKAIGLALVALLGTALAQVRSDGSSTVYPITQAVAEEFVTRNP
                     QVKISVAFSGTGAGFQKFCRGETDVQNASRPIRKSEMEACQKAGIQYIEIPIAYDALS
                     ILVNKQNTWAQCLTTAQLKSIWEPNAKVNFWKDLNPAWPNRRIVLFGAGTDSGTFDYF
                     TEAIMGRAGSIRKDYFPSEDDNVIMRGVTGNPYAMAFVGFAYYEENKDKVRALAVDGG
                     KGCVAPSRESVLNGTYTPLARPLFIYVNLKSLERKEVRDFVDFYLSPAARRAIRATGY
                     VELPEEAYRIGQALVARKKTGSFFSDLPPGTPLSKFIEELRKEVQ"
     misc_feature    complement(289259..290038)
                     /locus_tag="TCCBUS3UF1_2600"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(290132..291247)
                     /locus_tag="TCCBUS3UF1_2610"
                     /db_xref="GeneID:12251615"
     CDS             complement(290132..291247)
                     /locus_tag="TCCBUS3UF1_2610"
                     /note="similar to tRNA-specific 2-thiouridylase MnmA
                     PRK00143;
                     similar to tRNA-specific 2-thiouridylase mnmA of
                     Deinococci UniRef RepID=MNMA_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-specific 2-thiouridylase mnmA"
                     /protein_id="YP_005653384.1"
                     /db_xref="GI:384438660"
                     /db_xref="GeneID:12251615"
                     /translation="MKRVLVAMSGGVDSSVAAYLLKEAGYEVVGAMMRFWPEEPPAPR
                     LEAGGGRAWESCCTPDAAYEARRVAELLGIPFYLLDYREVFAEEIIQPFLRDYAQGRT
                     PNPCARCNTQVKFGAFLKQARRLGLDYVATGHYVRREGEALLRGVDPAKDQTYFLWGT
                     PKEAIPHLLFPVGGFHKAEVRAMAARAGLPTARKPESQNLCFIAGDLRGFLAEKLQAR
                     PGPLVDVETGEVVGEHQGASLYTLGQRKGLGLHKTHLERYVVGLDPGANIVYVGPKEA
                     AFWGGLEGEEVNLLAELPEEVEVQVRYRTPPVRARVESLSPLRLRFQSPVFAVTPGQS
                     AVFYQGERLLGGAVIRKGLYNLAGFDPKLMEKALTFS"
     misc_feature    complement(290201..291244)
                     /locus_tag="TCCBUS3UF1_2610"
                     /note="tRNA methyl transferase; Region: tRNA_Me_trans;
                     pfam03054"
                     /db_xref="CDD:251696"
     misc_feature    complement(290201..291241)
                     /locus_tag="TCCBUS3UF1_2610"
                     /note="tRNA methyl transferase. This family represents
                     tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase
                     which is involved in the biosynthesis of the modified
                     nucleoside 5-methylaminomethyl-2-thiouridine present in
                     the wobble position of some tRNAs; Region: tRNA_Me_trans;
                     cd01998"
                     /db_xref="CDD:238956"
     misc_feature    complement(order(291146..291148,291152..291154,
                     291206..291217,291221..291229))
                     /locus_tag="TCCBUS3UF1_2610"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238956"
     gene            complement(291244..292125)
                     /locus_tag="TCCBUS3UF1_2620"
                     /db_xref="GeneID:12251616"
     CDS             complement(291244..292125)
                     /locus_tag="TCCBUS3UF1_2620"
                     /note="similar to Putative uncharacterized protein
                     TTHA0257 of Thermus thermophilus UniRef
                     RepID=Q5SLN6_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653385.1"
                     /db_xref="GI:384438661"
                     /db_xref="GeneID:12251616"
                     /translation="MRLPFLAQQATLGGSAALEGVMMKAPWAWALAVRLPNGQVHVER
                     HEEAALAQRYPWARLPLLRGVVALWDALSVSYRALARSAELQGEEEVPKGALWGTVAF
                     SLLLGIALFIVLPGFLSGLLLDPARHPVLYNLLAGLLKVGILVGYLLFIGRLPEIRRF
                     FMYHGAEHKAIHAYEKGLPLTVENVLAQPRFHPRCGTTFLAFVIVVSVLVYSLIPAPE
                     VLWWRLLARVLFLPVVAALAFELLYFSARHEDPLSRALRGLGFRFQALTVAEPTPDMV
                     EVAIRSTQAALGEKVVA"
     misc_feature    complement(291256..291951)
                     /locus_tag="TCCBUS3UF1_2620"
                     /note="Protein of unknown function (DUF1385); Region:
                     DUF1385; pfam07136"
                     /db_xref="CDD:254069"
     gene            292166..293557
                     /locus_tag="TCCBUS3UF1_2630"
                     /db_xref="GeneID:12251617"
     CDS             292166..293557
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="similar to leucyl aminopeptidase PRK00913;
                     similar to Aminopeptidase A/I of Thermaceae UniRef
                     RepID=Q72GW9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminopeptidase A/I"
                     /protein_id="YP_005653386.1"
                     /db_xref="GI:384438662"
                     /db_xref="GeneID:12251617"
                     /translation="MITLHAAEAPLWQAQVPLKVLWVRQGKLSPQGEALDIRLEGLLR
                     RAWEGAGLKGESGESLLLATPEGHFLLVAADGYARQAGGRLAQLLGRYAFLEALVEPL
                     EDGYALAEGLWLGAYRFLRYKGQPGERPLALHLLGVEEGVLERARKVAEGVYFARDLV
                     NEPPNVLTPEALAEAALALRPLGVEVEVLDEEAIAALGMGAFLAVAQGSANPPRFIQL
                     RYRPEGARGRLDLVGKGLTFDSGGYSLKPTEGMAAMKGDMAGAAAVLGAFKAAALLGL
                     PVELWGYIAACENLISGRAYRVGDVLKTLSGKTVEVMNTDAEGRLTLADALAYAERQG
                     AERILELSTLTGAAVVALGEEVAALFATEAAWGERVRQAAQRAGEKVWPMPLEAAYRE
                     KLKSPVADLKNVGDRSGGAITAALFLAEFVRVPLVHLDIAGPAFAKKAHALGPEGGTG
                     FGVRTILEVAQDL"
     misc_feature    292226..293539
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="Cytosol aminopeptidase family, N-terminal and
                     catalytic domains.  Family M17 contains zinc- and
                     manganese-dependent exopeptidases ( EC  3.4.11.1),
                     including leucine aminopeptidase. They catalyze removal of
                     amino acids from the N-terminus of a protein and...;
                     Region: Peptidase_M17; cd00433"
                     /db_xref="CDD:238247"
     misc_feature    292241..293551
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="multifunctional aminopeptidase A; Provisional;
                     Region: PRK00913"
                     /db_xref="CDD:234863"
     misc_feature    order(292310..292315,292352..292354,292376..292378,
                     292391..292393,292646..292648,292652..292660,
                     292787..292789,292793..292795,292877..292879,
                     292895..292897,292910..292912,292919..292921,
                     292928..292933,293027..293029,293033..293044,
                     293048..293050,293054..293068,293084..293086,
                     293090..293092,293102..293104,293210..293224,
                     293231..293233,293309..293314,293318..293320,
                     293333..293335,293339..293344,293357..293359,
                     293363..293365,293390..293395,293399..293401,
                     293501..293503)
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="interface (dimer of trimers) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238247"
     misc_feature    order(292865..292867,292880..292882,292901..292903,
                     292934..292936,293111..293113,293117..293119,
                     293123..293125,293195..293197)
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="Substrate-binding/catalytic site; other site"
                     /db_xref="CDD:238247"
     misc_feature    order(292865..292867,292880..292882,292934..292936,
                     293111..293113,293117..293119)
                     /locus_tag="TCCBUS3UF1_2630"
                     /note="Zn-binding sites [ion binding]; other site"
                     /db_xref="CDD:238247"
     gene            complement(293600..294043)
                     /locus_tag="TCCBUS3UF1_2640"
                     /db_xref="GeneID:12251618"
     CDS             complement(293600..294043)
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="similar to Fe2+/Zn2+ uptake regulation proteins
                     COG0735;
                     similar to Ferric uptake regulation protein of Thermaceae
                     UniRef RepID=Q5SLN8_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric uptake regulation protein"
                     /protein_id="YP_005653387.1"
                     /db_xref="GI:384438663"
                     /db_xref="GeneID:12251618"
                     /translation="MPRMKEKENYRARLKAVGLRHTLPRERILSYLDRKNVHPTPEEL
                     YNGLKKRGYDIGLSTVYLNLHVLREHGLIYEFKDPKGDTRYDGYNEPHVHLVCTACGK
                     VEDLLLKNLPELDLSGAQGAAAERTGWALEGFRLELRGKCPTCQG"
     misc_feature    complement(293618..293974)
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(293729..293731,293762..293764,
                     293768..293770,293786..293788,293930..293932))
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(293834..293878)
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(293642..293644,293708..293710,
                     293765..293767,293771..293773))
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(293621..293647,293651..293659,
                     293684..293686,293702..293704,293750..293758))
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(293618..293620,293744..293746,
                     293753..293755))
                     /locus_tag="TCCBUS3UF1_2640"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            294240..294503
                     /locus_tag="TCCBUS3UF1_2650"
                     /db_xref="GeneID:12251619"
     CDS             294240..294503
                     /locus_tag="TCCBUS3UF1_2650"
                     /note="similar to Septum formation initiator of Thermus
                     UniRef RepID=B7A892_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation initiator"
                     /protein_id="YP_005653388.1"
                     /db_xref="GI:384438664"
                     /db_xref="GeneID:12251619"
                     /translation="MERPVYRLLRLVFALGLAHALFLLGQEAVRAHQLAKERERLEEA
                     VHQAEARVARLRAEVEAAQDPAHLEALARRLGMVRPEEILKRR"
     misc_feature    294276..294488
                     /locus_tag="TCCBUS3UF1_2650"
                     /note="Septum formation initiator; Region: DivIC; cl17659"
                     /db_xref="CDD:266763"
     gene            294500..294757
                     /locus_tag="TCCBUS3UF1_2660"
                     /db_xref="GeneID:12251620"
     CDS             294500..294757
                     /locus_tag="TCCBUS3UF1_2660"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653389.1"
                     /db_xref="GI:384438665"
                     /db_xref="GeneID:12251620"
                     /translation="MREDPAQVLLEDEALTEGLTDEEAEVLLSWLLDLAREAGPAQLS
                     HLRRLGHEITRLSRDYGVPVEEAIGLVELAWGEDEPPSLRA"
     gene            complement(294754..295620)
                     /locus_tag="TCCBUS3UF1_2670"
                     /db_xref="GeneID:12251621"
     CDS             complement(294754..295620)
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="similar to Transcriptional regulatory protein, lysR
                     family of Thermus UniRef RepID=Q72GP8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional regulatory protein, lysR"
                     /protein_id="YP_005653390.1"
                     /db_xref="GI:384438666"
                     /db_xref="GeneID:12251621"
                     /translation="MEPINLRRLRLFLLLAEERNFHRAAERAYLSQPALSQQIRALER
                     ELGVRLVERKPFRLTPAGEILRAEGERLFQEALALRERVRRAGWGELRFGVPENLLPD
                     LMPLLDHLRRGLGQPVEILEMHTPEQVKALKEGRLDYGLAGLRVEDPALDQEPLLEVP
                     IVVVLPEGHPLASRERVPLKALKEAPFLLIPKEALPPLHEAFMEVFRRAGFTPKVVRE
                     VARFPQAVSLVAAGVGVHLTLAPYRVFPHPGTVLRPLEEAAALQVSLIYRKAPPPPRL
                     LEVRALLRSWAP"
     misc_feature    complement(294772..295575)
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="DNA-binding transcriptional activator XapR;
                     Provisional; Region: PRK09986"
                     /db_xref="CDD:182183"
     misc_feature    complement(295432..295575)
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(294772..295269)
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators involved in the
                     catabolism of aromatic compounds and that of other related
                     regulators, contains type 2 periplasmic binding fold;
                     Region: PBP2_LTTR_aromatics_like; cd08414"
                     /db_xref="CDD:176106"
     misc_feature    complement(order(294874..294876,294928..294933,
                     294937..294942,294958..294963,295018..295023,
                     295123..295125,295255..295257,295261..295263,
                     295267..295269))
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176106"
     misc_feature    complement(order(295027..295029,295048..295053,
                     295192..295194))
                     /locus_tag="TCCBUS3UF1_2670"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176106"
     gene            295733..298450
                     /locus_tag="TCCBUS3UF1_2680"
                     /db_xref="GeneID:12251622"
     CDS             295733..298450
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="similar to pyruvate dehydrogenase subunit E1
                     PRK09405;
                     similar to Pyruvate dehydrogenase E1 component of Bacteria
                     UniRef RepID=Q0AC13_ALHEH"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyruvate dehydrogenase E1 component"
                     /protein_id="YP_005653391.1"
                     /db_xref="GI:384438667"
                     /db_xref="GeneID:12251622"
                     /translation="MTESALKEALQALSAEERARLRQVENREWVESLEYVLRVEGWER
                     AEELLRLLDEYLYLQGYFPENRLSTPYLNTIPREKEPPYPGDLELERRIVNILRWNAA
                     MMVARANKRADGIGGHISTYASIAELYEVGFNHFFRGPEAGLDRDLVFFQGHSSPGIY
                     ARAFLEGRLSEADLENFRREVHPPVPGGRGLSSYPHPWLMPDFWEFPTVSMGLGPIQA
                     IYQARFMRYLEDRGLKPKSSAKVWAFLGDGEHDEPETVGALHLAAREGLDNLVFVVNA
                     NLQRLDGPVRGNSKVIQELERLYRGAGWRVIKIVWGAAWDRLIARDREGHLLRRFEAL
                     VDGESQRYAAFGGKELRERFFNTPELQALIQGMTDEELTELTRSRGGHDLKKIYAAYK
                     AAVEHRGSPVVILARTIKGYGMGPTAMAKNVAHQVKKLTEEDLKEARAFLGIPVPEER
                     LSELPYYHPGPDSPEVRYLQERRKALGGFVPERRVRFQGGLEVPGEDFFQEFYEGSGG
                     REISTTMAFVRILAKLLRHPTVGKLLVPIVPDEARTFGMEALIAQVGVYSPQGQLYIP
                     VDAGTLTAYKESKEGQILEEGITEAGAMADFIAAGTAYAHWGIPTIPFLITYSMFGLQ
                     RIGDLVWAAADQRTRGFLMGATAGRTTLEGEGLQHQDGQSPLYALAAPNLQVYDPGFA
                     YELAVILEDGLRRMYAQGEDVFYYLTIENENYPHPPIPEPRDRVKEGILKGLYLLRPG
                     EGKGPRVQLWASGPLLPQALRAQELLLDYGVVAEVWSATSYKALYLDAMEAERERRLL
                     GRARKPYVQAAMEGHEGPVVAATDYLKALPNLVRGYLDRPFCPLGTDGFGRSDTREAL
                     RDFFEVDARHMAYAALALLVEEGKLEAGVLGRARAHLGLKLEEVPPHRR"
     misc_feature    295802..298441
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="pyruvate dehydrogenase subunit E1; Reviewed;
                     Region: aceE; PRK09405"
                     /db_xref="CDD:236500"
     misc_feature    295991..297166
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of E. coli
                     PDC-like subfamily, TPP-binding module; composed of
                     proteins similar to the E1 component of the Escherichia
                     coli pyruvate dehydrogenase multienzyme complex (PDC). PDC
                     catalyzes the oxidative...; Region: TPP_E1_EcPDC_like;
                     cd02017"
                     /db_xref="CDD:238975"
     misc_feature    order(296069..296077,296264..296275,296309..296314,
                     296318..296320,296324..296326,296351..296353,
                     296357..296365,296483..296494,296501..296503,
                     296510..296512,296522..296524,296570..296578,
                     296588..296590,296612..296614,296621..296626,
                     296633..296635)
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    order(296093..296095,296186..296188,296192..296194,
                     296357..296359,296363..296365,296471..296479,
                     296486..296488,296561..296563,296567..296569,
                     296960..296962)
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    order(297455..297457,297485..297490,297497..297499,
                     297602..297607,297611..297613,297743..297745)
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    order(297455..297457,297485..297490,297497..297499,
                     297506..297508,297515..297517,297524..297526,
                     297530..297538,297545..297547,297614..297619)
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132915"
     misc_feature    297470..297817
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="Transketolase, pyrimidine binding domain; Region:
                     Transket_pyr; smart00861"
                     /db_xref="CDD:214865"
     misc_feature    order(297500..297502,297605..297607)
                     /locus_tag="TCCBUS3UF1_2680"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132915"
     gene            298462..299703
                     /locus_tag="TCCBUS3UF1_2690"
                     /db_xref="GeneID:12251623"
     CDS             298462..299703
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="similar to dihydrolipoamide acetyltransferase
                     PRK11855;
                     similar to Dihydrolipoamide acetyltransferase of Bacteria
                     UniRef RepID=Q1IX53_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydrolipoamide acetyltransferase"
                     /protein_id="YP_005653392.1"
                     /db_xref="GI:384438668"
                     /db_xref="GeneID:12251623"
                     /translation="MELKLPELGDNVAAATVVGVLVKEGDRVAPGQPLLELETDKAVM
                     EVPAEAGGVVRRVLVKVGDEVRPGQAFLELEGEGAPVSPVQALPQAPEPPKAEAAPPR
                     PAPPSGPSEEGRLIPAAPSIRRLARELGVDLKGVRGTGLAGRITEEDVRRAAGLAPAL
                     EAPAPALPPVPRLPDFTRWGPVRVEPMSGVRKATLRAMAQAWAQVPMVTHFDEADITE
                     LEALRKRYAKRAEERGYRLTLTAFLLKALALTLKAFPKFNASLDAERQEVIYKDYVHI
                     GVAVDTPHGLLVPVIRHVDQKGVLRLAKELQEVSERARERKLSPEEMQGGTFSLSNLG
                     GIGGTGFTPIVNWPEVAILGVSRSQVKPLWDAEKETFLPRLVMPYGLTYDHRLIDGAE
                     AARFCRHLAALLEDPLGLALE"
     misc_feature    298462..298683
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    298465..299700
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Reviewed; Region: PRK11856"
                     /db_xref="CDD:237001"
     misc_feature    order(298552..298554,298573..298590,298600..298602)
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    298582..298584
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    298807..298911
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    299053..299697
                     /locus_tag="TCCBUS3UF1_2690"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            299739..300650
                     /locus_tag="TCCBUS3UF1_2700"
                     /db_xref="GeneID:12251624"
     CDS             299739..300650
                     /locus_tag="TCCBUS3UF1_2700"
                     /note="similar to porphobilinogen deaminase PRK00072;
                     similar to Porphobilinogen deaminase of Deinococci UniRef
                     RepID=HEM3_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="YP_005653393.1"
                     /db_xref="GI:384438669"
                     /db_xref="GeneID:12251624"
                     /translation="MRVIVVGTRGSALALAQTRWVVERLKESWPEAEFKVKTVKTRGD
                     QGANPREQAIFVKELQEALLSREIDIAVHSLKDLPTEEPPGLKIAAIPRRQDPRDVFL
                     GRAYKRLEDLPQGAVVGTSSVRRKAQLLAYRPDLVVKDLRGNVDTRLAALGNGEYDGI
                     VLAAAGLIRLDLRNRIDQFLEPEVMLPAPGQGALALEVRQGDDLAEELCYALHHHASY
                     DRVRAERAFLRGLGAGCMAPVGALAQVAEDGTLLLEGTLLSPDGRSFIRAEIEGEASE
                     AEELGLELARDVLEQGGREILEQTRQV"
     misc_feature    299739..300608
                     /locus_tag="TCCBUS3UF1_2700"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    299748..300608
                     /locus_tag="TCCBUS3UF1_2700"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    order(299769..299771,299784..299786,299961..299978,
                     299982..299984,300009..300014,300018..300035,
                     300108..300110,300114..300119,300129..300131,
                     300168..300170,300231..300233,300240..300245,
                     300291..300314,300366..300368,300387..300389,
                     300396..300398,300408..300413,300420..300422,
                     300441..300443,300453..300455,300459..300461,
                     300498..300500,300513..300515,300522..300524,
                     300531..300533,300537..300539)
                     /locus_tag="TCCBUS3UF1_2700"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    order(299775..299777,299787..299789,299958..299960,
                     299964..299969,300096..300104,300108..300113,
                     300159..300161,300180..300182,300219..300227,
                     300234..300236,300243..300245,300300..300302,
                     300309..300314,300441..300443)
                     /locus_tag="TCCBUS3UF1_2700"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            300675..301070
                     /locus_tag="TCCBUS3UF1_2710"
                     /db_xref="GeneID:12251625"
     CDS             300675..301070
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="similar to zinc uptake transcriptional repressor
                     PRK11639;
                     similar to Ferric uptake regulatory protein of Thermaceae
                     UniRef RepID=Q5SLE9_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric uptake regulatory protein"
                     /protein_id="YP_005653394.1"
                     /db_xref="GI:384438670"
                     /db_xref="GeneID:12251625"
                     /translation="MALKRLTRQRKAVLEVVRRAHNHPDAAWIYQEVRKVVPKVSLGT
                     IYRTLEALVEEGYLVPITKAGEATRYDANLHPHLHLVCQGCGAIVDLEVDLPDLRGLA
                     QEAHPWVEVREVEVTYKGLCPTCKAALEG"
     misc_feature    300696..301040
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    order(300741..300743,300885..300887,300903..300905,
                     300909..300911,300942..300944)
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    300795..300839
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(300900..300902,300906..300908,300963..300965,
                     301014..301016)
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    order(300915..300923,300969..300974,300999..301007,
                     301011..301037)
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    order(300918..300920,300927..300929,301038..301040)
                     /locus_tag="TCCBUS3UF1_2710"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            301071..302309
                     /locus_tag="TCCBUS3UF1_2720"
                     /db_xref="GeneID:12251626"
     CDS             301071..302309
                     /locus_tag="TCCBUS3UF1_2720"
                     /note="similar to bifunctional folylpolyglutamate
                     synthase/ dihydrofolate synthase PRK10846;
                     similar to Folyl-polyglutamate synthetase of Deinococci
                     UniRef RepID=Q5SLF0_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Folyl-polyglutamate synthetase"
                     /protein_id="YP_005653395.1"
                     /db_xref="GI:384438671"
                     /db_xref="GeneID:12251626"
                     /translation="MHPLAWLYARQGVVTLGLERIRALLRRLGNPQEAYPVALVGGTN
                     GKGTVARVLAAILEEAGLKVGLYTSPHLVDFRERLAVGGEPVSQDQLHRLLEEVRPHA
                     EAVGASFFEATTALALLHFARQGVEFAVLEVGLGGRLDATNAAEPMLSIVTNIGHDHL
                     EVLGPTLRDVAREKAGIFRPGVPALTAARGEGLWELRAQAAALETPLWVLGEAFALGE
                     VAPSSRGLAFTLFLRGEERRFHTPLLGPHQAENLALAAVGGRLLGAGWEAVAGGLARA
                     THPGRLERIPLEGKELLLDGAHNPEGAWALREALGFHGLLPAALVLAFTRGKDLAAMA
                     EALRGLGPVVLTRYHSPRSEDPRALLPLFPGALVEEEPLRAVERALALEGRAVVAGSL
                     YLVGEVLRGLKGLPPEERWQ"
     misc_feature    301077..>301274
                     /locus_tag="TCCBUS3UF1_2720"
                     /note="Tetraacyldisaccharide-1-P 4'-kinase; Region: LpxK;
                     cl19279"
                     /db_xref="CDD:267632"
     misc_feature    301080..302294
                     /locus_tag="TCCBUS3UF1_2720"
                     /note="Folylpolyglutamate synthase [Coenzyme metabolism];
                     Region: FolC; COG0285"
                     /db_xref="CDD:223362"
     misc_feature    301188..301844
                     /locus_tag="TCCBUS3UF1_2720"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     gene            302426..303199
                     /locus_tag="TCCBUS3UF1_2730"
                     /db_xref="GeneID:12251627"
     CDS             302426..303199
                     /locus_tag="TCCBUS3UF1_2730"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653396.1"
                     /db_xref="GI:384438672"
                     /db_xref="GeneID:12251627"
                     /translation="MRRRNMVLALALAGGLGSLLAGCTPSAQCTTPICLVAHWPLNET
                     AGATSVADQVLNPILNTGVPMPGSVQGFPGSGGPLAVSGQVGGALYFPGNGASYVRVP
                     HTPDLNLGYGSLYLEAWVAPVQCGLGAYYPILDKWDASTNSGYALYLEGTGPGQVRVG
                     FRLGGSAFFSSTSFPANFTPPVGGTWTQVAVKVDGNSGSFTVNGAPAGTFAAPSGSTT
                     NSLDLWLGALHTPPSGKVHCEIALDEVKVGRVNPMFSGQ"
     misc_feature    302684..303166
                     /locus_tag="TCCBUS3UF1_2730"
                     /note="Concanavalin A-like lectin/glucanases superfamily;
                     Region: Laminin_G_3; pfam13385"
                     /db_xref="CDD:257711"
     gene            303208..304452
                     /locus_tag="TCCBUS3UF1_2740"
                     /db_xref="GeneID:12251628"
     CDS             303208..304452
                     /locus_tag="TCCBUS3UF1_2740"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653397.1"
                     /db_xref="GI:384438673"
                     /db_xref="GeneID:12251628"
                     /translation="MKRLWPLLPLAFLLPACGPGGPQALNVVLVDGLGEPLQPLAAAW
                     RLGPPPSTSGMPWNALPVAQSSWSLPIPPGARFQVAFRCPNAGLTQFYLSLDLNRAEL
                     GNKLMVRCPSVYASPTVTVTGSVSLPLQSGTAASARDQASFTGGGFSGLALPQGSGRE
                     VAVFGVDAGGTSYFGRTSPLSVGPGTTSVGPIPLASAPSLTATTPLGFFSSARLLLNS
                     FVPMPLASWSGGSQAVARPALLGGDLFEFWTCHGSSCAIRRLDQASPTVAAGATVSLS
                     VPPLSFSGTQTHTPTALPTLANLAFSGFSPTLGPLGYALFLGEPGVRYWRHYLSPGAL
                     GNATSYYLDVENAPGFSGVVPTPGQSVQLRATAFAGDQPLGVLLAARPIPEETLPAHT
                     LFLDWAWPVHLEAALLQASFTW"
     gene            complement(304442..305575)
                     /locus_tag="TCCBUS3UF1_2750"
                     /db_xref="GeneID:12251629"
     CDS             complement(304442..305575)
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="similar to succinyldiaminopimelate transaminase
                     PRK07366;
                     similar to Aspartate aminotransferase of Thermus
                     thermophilus UniRef RepID=Q72H54_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate aminotransferase"
                     /protein_id="YP_005653398.1"
                     /db_xref="GI:384438674"
                     /db_xref="GeneID:12251629"
                     /translation="MSRVPEPSVFLVVDEAKRKARERGVRLLDLSIGSTDLPPPPGPL
                     QALREALDDPSTYGYCLKSCTLPFLEAATRWYRERYGLFLDPRREALALIGSQEGLAH
                     LLLALTEPKDLLLLPEVAYPSYFGAARLASLETHPIPLREDGLADLSRVPEEVWRKAR
                     VLLLNYPNNPTGAVADWAYFEEALGLAKRYGLWLVHDNPYVDQVYEGEAPSPLALPGG
                     RERVVELFSLSKSYNLAGFRLGFALGNEEALSRLERVKGVVDFNAYAGILRLGVAALA
                     TPKETTRGFARVYRERALGMAKALEGSLDLLPPRATMYLWGRLPGGLDDLGFVLDLVA
                     RGVALAPGQGFGPGGRGWVRIALVRPLEELLRAAGIIREVLTR"
     misc_feature    complement(304457..305557)
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="LL-diaminopimelate aminotransferase; Provisional;
                     Region: PRK09276"
                     /db_xref="CDD:181749"
     misc_feature    complement(304457..305494)
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(304862..304864,304886..304891,
                     304895..304897,304976..304978,305069..305071,
                     305213..305215,305285..305293))
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(304766..304768,304775..304777,
                     304862..304870,304997..304999,305183..305185,
                     305282..305284))
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(304886..304888)
                     /locus_tag="TCCBUS3UF1_2750"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(305568..306062)
                     /locus_tag="TCCBUS3UF1_2760"
                     /db_xref="GeneID:12251630"
     CDS             complement(305568..306062)
                     /locus_tag="TCCBUS3UF1_2760"
                     /note="similar to molybdenum cofactor biosynthesis protein
                     MogA PRK09417;
                     similar to Molybdenum cofactor synthesis domain protein of
                     Meiothermus UniRef RepID=D3PL90_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdenum cofactor synthesis domain protein"
                     /protein_id="YP_005653399.1"
                     /db_xref="GI:384438675"
                     /db_xref="GeneID:12251630"
                     /translation="MFRVGILTVSDKGFRGEREDTTHLALRETLKGGPFAVAAYEIVP
                     DEPPMIKKVLRLWADREGLDLILTNGGTGLSPRDRTPEATREVLEREVPGLPELMRLK
                     GLERTPMAALSRGVAGVRGRTLILNLPGSPRGARESLEAVLPILPHALSLVTGKVWRE
                     GHHE"
     misc_feature    complement(305604..306059)
                     /locus_tag="TCCBUS3UF1_2760"
                     /note="MogA_MoaB family. Members of this family are
                     involved in biosynthesis of the molybdenum cofactor (MoCF)
                     an essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea; Region: MogA_MoaB;
                     cd00886"
                     /db_xref="CDD:238451"
     misc_feature    complement(order(305652..305654,305661..305663,
                     305673..305678,305754..305756,305844..305852))
                     /locus_tag="TCCBUS3UF1_2760"
                     /note="MPT binding site; other site"
                     /db_xref="CDD:238451"
     misc_feature    complement(order(305604..305606,305721..305723,
                     305730..305732,305760..305765,305772..305774,
                     305787..305795,305817..305819,305829..305831,
                     305835..305840,305844..305846))
                     /locus_tag="TCCBUS3UF1_2760"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238451"
     gene            complement(306077..307120)
                     /locus_tag="TCCBUS3UF1_2770"
                     /db_xref="GeneID:12251631"
     CDS             complement(306077..307120)
                     /locus_tag="TCCBUS3UF1_2770"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653400.1"
                     /db_xref="GI:384438676"
                     /db_xref="GeneID:12251631"
                     /translation="MATLEAVLDLLKPPHRGSATPQEEEAFRRLRAFLEAQGLRVQEI
                     PFRGVPSYGWELLGISLLLALSPLSPLPPLLGALGFFLYFQGRRPWGFLLDRHPSRNL
                     LCWKGEGEKAVLLLAHVDTAKTFFLYHPGRVRAFRSNFLLNALLAFLAPLLALTPWKW
                     AVGAYFLLQAGLLLHRELFAPYVEGGNDNASGVAVATALFLETEPRPGFRLGLALTGC
                     EEVGALGAKALLPHLPPDTLVLNLDNVGRGELFYVEGEGMLRYFPYHGALLEAARKTP
                     GAKPLRYRLAYLDTLPLAQRGFPSLGLIRLEGGVPPDWHWPTDTFARLDRKALEETFT
                     YAQRILGRVLQEA"
     misc_feature    complement(<306389..306808)
                     /locus_tag="TCCBUS3UF1_2770"
                     /note="Zinc peptidases M18, M20, M28, and M42; Region:
                     Zinc_peptidase_like; cl14876"
                     /db_xref="CDD:265470"
     misc_feature    complement(order(306392..306394,306461..306466,
                     306557..306559,306767..306769))
                     /locus_tag="TCCBUS3UF1_2770"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193495"
     misc_feature    complement(306083..>306571)
                     /locus_tag="TCCBUS3UF1_2770"
                     /note="Zinc peptidases M18, M20, M28, and M42; Region:
                     Zinc_peptidase_like; cl14876"
                     /db_xref="CDD:265470"
     misc_feature    complement(order(306176..306178,306392..306394,
                     306461..306466,306557..306559))
                     /locus_tag="TCCBUS3UF1_2770"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193495"
     gene            307141..307722
                     /locus_tag="TCCBUS3UF1_2780"
                     /db_xref="GeneID:12251632"
     CDS             307141..307722
                     /locus_tag="TCCBUS3UF1_2780"
                     /note="similar to putative acetyltransferase YhhY
                     PRK10140;
                     similar to Ribosomal-protein-alanine acetyltransferase of
                     Thermus thermophilus UniRef RepID=Q72HN8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosomal-protein-alanine acetyltransferase"
                     /protein_id="YP_005653401.1"
                     /db_xref="GI:384438677"
                     /db_xref="GeneID:12251632"
                     /translation="MWSFPQRLVGRYVRLEPLSLAHLSGFLAQFDPEVYRFLSRMPLE
                     PTEEALKAHLEGLLAEPGRVNWAVYLGEELAGRISVIAPDPEHRKLEMGTMIFKPFWG
                     SPANKEAKYLLLRHAFEVLGAERVQFKVNLKNERSQRALESLGAVREGVLRKNRRLPD
                     GTFRDDVVYSILREEWPGVRAGLEARLYGPGSP"
     misc_feature    307159..307680
                     /locus_tag="TCCBUS3UF1_2780"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    307342..307575
                     /locus_tag="TCCBUS3UF1_2780"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:266534"
     gene            307703..308887
                     /locus_tag="TCCBUS3UF1_2790"
                     /db_xref="GeneID:12251633"
     CDS             307703..308887
                     /locus_tag="TCCBUS3UF1_2790"
                     /note="similar to Transporter, arsenite-antimonite (ArsAB)
                     efflux family of Bacteria UniRef RepID=Q2JKD1_SYNJB"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter, arsenite-antimonite (ArsAB) efflux"
                     /protein_id="YP_005653402.1"
                     /db_xref="GI:384438678"
                     /db_xref="GeneID:12251633"
                     /translation="MAQEALSLLVLSLTYLGLALGGLPGYRMNRAGVALVGASFLLLL
                     GTLDLEAAWQALDAKTLVFLFGVMVLNAHLAYAGFFGLAAERLLGLARTPLALLVLLT
                     LGAGGLSALFLNDTMALLLTPLVLALTRGLGLNPVPYLLALMGAVNTGSLLTPTGNPQ
                     NILVASLSGLAYLDFVRALWLPALLGLLLQVVLLAFLYPEVRSRKPLPPLPPLRYRLH
                     RPLLRKGLGVAVGLLLAFLLGYPLAQGALVGAGLLLFTRRLRSERYFLRVDWELLVLF
                     GGLFVVTEGVRRLGLAEALLPLGESPLGLLLAATLLSLLISNVPAVLLLAPLVNDPRD
                     WLLLAGGSTLAGNLTLLASVANLIVAEGARKEGLGVGLGEHLRFGLPLTLLTLALLYG
                     LL"
     misc_feature    307778..308836
                     /locus_tag="TCCBUS3UF1_2790"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    order(307790..307831,307874..307927,307994..308044,
                     308048..308101,308111..308182,308246..308290,
                     308381..308419,308423..308467,308504..308560,
                     308603..308650,308705..308764)
                     /locus_tag="TCCBUS3UF1_2790"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            complement(308879..310183)
                     /locus_tag="TCCBUS3UF1_2800"
                     /db_xref="GeneID:12251634"
     CDS             complement(308879..310183)
                     /locus_tag="TCCBUS3UF1_2800"
                     /note="similar to Asp-tRNAAsn/Glu-tRNAGln amidotransferase
                     A subunit and related amidases COG0154;
                     similar to Amidase/amidotransferase of Thermus UniRef
                     RepID=Q72HP0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Amidase/amidotransferase"
                     /protein_id="YP_005653403.1"
                     /db_xref="GI:384438679"
                     /db_xref="GeneID:12251634"
                     /translation="MDLLEAKALLERGGTTPLALLEEALERARAFADRNALAYLDEEG
                     ARKEAARLAEEQRRGQVRGPLHGLPLTVKDLFPVKGMPTRAGTQAPLPPLPEEAQAVR
                     RLKEAGALIFAKTHMHEIALGITGENPWTGPVRNAIDPTRQAGGSSGGSAVAVALGIG
                     LASLGTDTGGSIRIPAAFNGVVGFKPSFGRISLEGALPLSRSTDHAGPLARTVRDAHF
                     LTEILAGESIPLEGPQNPTFGVPLDFLEGRLGQGVRKAFQRLLEDLPLLRAEVREVSL
                     PLPGAYEVYTRLVRYEAARIHEKALKEHPEGFSPSVREALLAGLALTEKDYRDAVAER
                     EALRLSLTKALRGVDALLLPVQPLPAPPLGTEEVELESGRKGHREAFLTLTLPFSLLG
                     VPALSLPFARVDGMPVGLQVVGPYAEDGKVLAIGGWLEARLK"
     misc_feature    complement(308882..310183)
                     /locus_tag="TCCBUS3UF1_2800"
                     /note="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit
                     and related amidases [Translation, ribosomal structure and
                     biogenesis]; Region: GatA; COG0154"
                     /db_xref="CDD:223232"
     gene            complement(310164..311393)
                     /locus_tag="TCCBUS3UF1_2810"
                     /db_xref="GeneID:12251635"
     CDS             complement(310164..311393)
                     /locus_tag="TCCBUS3UF1_2810"
                     /note="similar to thiamine biosynthesis protein ThiI
                     PRK01565;
                     similar to Probable tRNA sulfurtransferase of Thermus
                     UniRef RepID=THII_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA sulfurtransferase"
                     /protein_id="YP_005653404.1"
                     /db_xref="GI:384438680"
                     /db_xref="GeneID:12251635"
                     /translation="METLVLVNLFHELALKGGNRPLFLKRAKAHVQRALKGTEARLEA
                     LWPLALLFRLPQEAWPEARARLGETLGVESFARVLRTAPDLEALKAALAGILEDGGFA
                     SFRIRAQRSDKGFPLTSPEVERLLGAFVRERTGAQVRLKGAEREFRVRLLPGAALLEA
                     ERHLGPGGLPPGVSGKVVALLSGGIDSPVAAYRLMRRGAEVALVHFHPFPLLPGGSRE
                     KAKALAERLVRFQHRLRLHLVPFSEVQRQILLEAPKAYRVVLYRRFMLRIAEAIAREE
                     GALALATGDSLGQVASQTLENLHVMNGAATLPVFRPLIGMDKQEIKAEALRLGTYAIS
                     ILPDEECCTLFAPKHPVTRADLEVVLEVERRLPLKDLVALALREREVVAYAWPGRKPL
                     GEKAGQAFIMEHGPAGG"
     misc_feature    complement(310251..311393)
                     /locus_tag="TCCBUS3UF1_2810"
                     /note="thiamine biosynthesis protein ThiI; Provisional;
                     Region: PRK01565"
                     /db_xref="CDD:234960"
     misc_feature    complement(310893..311366)
                     /locus_tag="TCCBUS3UF1_2810"
                     /note="THUMP domain of thiamine biosynthesis protein ThiI;
                     Region: THUMP_ThiI; cd11716"
                     /db_xref="CDD:212585"
     misc_feature    complement(310338..310868)
                     /locus_tag="TCCBUS3UF1_2810"
                     /note="ThiI is required for thiazole synthesis in the
                     thiamine biosynthesis pathway. It belongs to the Adenosine
                     Nucleotide Hydrolysis suoerfamily and predicted to bind to
                     Adenosine nucleotide; Region: ThiI; cd01712"
                     /db_xref="CDD:238845"
     misc_feature    complement(order(310770..310772,310776..310778,
                     310833..310844,310848..310856))
                     /locus_tag="TCCBUS3UF1_2810"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238845"
     gene            complement(311510..313534)
                     /locus_tag="TCCBUS3UF1_2820"
                     /db_xref="GeneID:12251636"
     CDS             complement(311510..313534)
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="similar to Molybdopterin oxidoreductase containing
                     molydopterin dinucleotide binding domain of Deinococci
                     UniRef RepID=Q1J1C9_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdopterin oxidoreductase containing
                     molybdopterin dinucleotide binding domain protein"
                     /protein_id="YP_005653405.1"
                     /db_xref="GI:384438681"
                     /db_xref="GeneID:12251636"
                     /translation="MLKAMKARATCPLDCPDACSLLLTLEGGRLVRVEGDPRHPITQG
                     FACGKTYRYPERVRERLLYPLRRVGRKGEGRFERVSWEEALEGIAARLRAILDRYGGE
                     AVLPYHYAGTMGLVENQHPLAFFRAIGASELLETICASTGSAAWEMTYGPRMAPDPEE
                     IPENARYLLLWGVNSLATHSHLTPFLKEAKRRGAKVVHIDPYANLTSRFAHEHLKLRP
                     GTDAALAYALAHVLFREGLVDWAYLEEAATGVEAFQEAAEAWTPERAEALTGVPAPAI
                     RRLARELGEARRVFLRVGYGMTRHPGGGNSLRAVLLLPALLGAWRYPGCGAMLSTSGA
                     FPLNKRFLGGRHLLEGRHPHRGYFRPNPGVRAINMNQLGTALTGLKPPIRALFVFNTN
                     PLVVAPNTGKVRAGLEREDLFTVVLEQVMTETARYADYLLPATLFYEHPDLYTSYGHY
                     YLSWNEPLAEPQGEARPNTWVFRELAQRLGLEEPTLYWSAEEVARSLLDTDHPYLEGI
                     TLERLKAEGFLKLRLPKPFLPFARGPVRFSPPPQVLPTEPLPDYPLVLLTPPAPRFLN
                     STYGDVAALAEAEGGEPLLLIHPQDAEARGVTDGGLVYLRSPWGQVVRRARVTEAPIP
                     GTVVLEGIWWEKWAPDGKGINHLTSEGLTDLGGGSTFHATPVEVEPLRLA"
     misc_feature    complement(311522..313534)
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="Anaerobic dehydrogenases, typically
                     selenocysteine-containing [Energy production and
                     conversion]; Region: BisC; COG0243"
                     /db_xref="CDD:223321"
     misc_feature    complement(311882..313513)
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="The MopB_3 CD includes a group of related
                     uncharacterized bacterial and archaeal
                     molybdopterin-binding oxidoreductase-like domains with a
                     putative N-terminal iron-sulfur [4Fe-4S] cluster binding
                     site and molybdopterin cofactor binding site. These
                     members...; Region: MopB_3; cd02766"
                     /db_xref="CDD:239167"
     misc_feature    complement(order(313394..313396,313478..313480,
                     313490..313492,313502..313504))
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="putative [4Fe-4S] binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239167"
     misc_feature    complement(order(312215..312217,312230..312235,
                     312269..312271,312278..312286,312359..312367,
                     312536..312541,312644..312655,312872..312874,
                     312932..312940,313001..313006,313013..313015,
                     313019..313024,313118..313126,313130..313132,
                     313388..313390))
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239167"
     misc_feature    complement(311531..311881)
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="The MopB_CT_3 CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative N-terminal
                     iron-sulfur [4Fe-4S] cluster binding site and
                     molybdopterin cofactor binding site. This CD is of the...;
                     Region: MopB_CT_3; cd02786"
                     /db_xref="CDD:239187"
     misc_feature    complement(order(311549..311554,311600..311602,
                     311642..311644,311834..311845,311849..311863))
                     /locus_tag="TCCBUS3UF1_2820"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239187"
     gene            313541..314179
                     /locus_tag="TCCBUS3UF1_2830"
                     /db_xref="GeneID:12251637"
     CDS             313541..314179
                     /locus_tag="TCCBUS3UF1_2830"
                     /note="similar to ribonuclease HII PRK13926;
                     similar to Ribonuclease HII of Deinococci UniRef
                     RepID=RNH2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribonuclease HII"
                     /protein_id="YP_005653406.1"
                     /db_xref="GI:384438682"
                     /db_xref="GeneID:12251637"
                     /translation="MEREMEALEAPFWRQGLRVAGVDEAGRGAWAGPIVVGAVVLPPG
                     VYPFRDSKRLSPQVRRRLAAEVRRVALGFALGVAEVAEVDRLGVLKATLLAAERALAL
                     LRPPPEALVTDYLALSTPLPLLAPPKADEESPSVAAASILAKVHRDALMEELDRLYPG
                     YGFAQHKGYGTEEHREALFRLGPSPVHRRCFAPVAQAPLRFSEAEGEGEGLS"
     misc_feature    313598..314119
                     /locus_tag="TCCBUS3UF1_2830"
                     /note="Bacterial Ribonuclease HII-like; Region:
                     RNase_HII_bacteria_HII_like; cd07182"
                     /db_xref="CDD:260003"
     misc_feature    order(313607..313624,313694..313696,313799..313807,
                     313877..313885,313919..313924,313928..313930,
                     313970..313972,314033..314041,314045..314053,
                     314111..314119)
                     /locus_tag="TCCBUS3UF1_2830"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260003"
     misc_feature    order(313607..313612,313877..313879,313928..313930)
                     /locus_tag="TCCBUS3UF1_2830"
                     /note="active site"
                     /db_xref="CDD:260003"
     gene            314194..314664
                     /locus_tag="TCCBUS3UF1_2840"
                     /db_xref="GeneID:12251638"
     CDS             314194..314664
                     /locus_tag="TCCBUS3UF1_2840"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653407.1"
                     /db_xref="GI:384438683"
                     /db_xref="GeneID:12251638"
                     /translation="MRFFLVLVAGLLSACTVTLEGITLTYRLDLTPAILRFEPDRGAG
                     ATYFVGEEVRFLLTLESPGWVSLVAVDPDGRTYEFDRLYLGRGTHLLPPGAYRYTLTP
                     PRGLYRVRAVYTDHEPGSVRLEGMFTDWEARLRVYLEASRTRRHQVVETHFYLR"
     misc_feature    314326..314547
                     /locus_tag="TCCBUS3UF1_2840"
                     /note="Domain of unknown function (DUF4384); Region:
                     DUF4384; pfam14326"
                     /db_xref="CDD:258500"
     gene            314746..315825
                     /locus_tag="TCCBUS3UF1_2850"
                     /db_xref="GeneID:12251639"
     CDS             314746..315825
                     /locus_tag="TCCBUS3UF1_2850"
                     /note="similar to TRAP-type mannitol/chloroaromatic
                     compound transport system, periplasmic component COG4663;
                     similar to Twin-arginine translocation pathway signal of
                     cellular organisms UniRef RepID=Q46VT0_RALEJ"
                     /codon_start=1
                     /transl_table=11
                     /product="Twin-arginine translocation pathway signal"
                     /protein_id="YP_005653408.1"
                     /db_xref="GI:384438684"
                     /db_xref="GeneID:12251639"
                     /translation="MKRRDFLKKAGIGVAASAAFGPVFAQAQPTVRWRLASSFPKSLD
                     TIYGAAEVLAERVSELTGGRFQIRPYQAGELVPGLQVMDAVQQGTVEMGHTASYYYVG
                     KAQVLAFDTAVPFGLTARQQNAWMYHGGGIELFRPIFADFGIIQFPGGNTGVQMGGWF
                     RKEIKTVADLKGLKMRIPGPGGQVMSRLGVVPQVIAGGDIYPALERGVVDAAEWVGPY
                     DDEKLGFYKVAKYYYYPGWHEPGPMLSFYVNLREWQKLPKDYQQAIEVAAAEANLWMM
                     AKYDRLNAPALQRLIKAGVRLRKWPAEVMKAAQKAALDWYEEEAAKDATYRKVYTAWK
                     AFREEQYRWFGVAELGYEGFAFPAS"
     misc_feature    314746..315810
                     /locus_tag="TCCBUS3UF1_2850"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, periplasmic component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT1; COG4663"
                     /db_xref="CDD:227009"
     gene            complement(315878..317371)
                     /locus_tag="TCCBUS3UF1_2860"
                     /db_xref="GeneID:12251640"
     CDS             complement(315878..317371)
                     /locus_tag="TCCBUS3UF1_2860"
                     /note="similar to TRAP-type mannitol/chloroaromatic
                     compound transport system, large permease component
                     COG4664;
                     similar to C4 dicarboxylate tripartite ATP-independent
                     periplasmic transporter of Azospirillum sp. B510 UniRef
                     RepID=D3NU44_AZOS1"
                     /codon_start=1
                     /transl_table=11
                     /product="C4 dicarboxylate tripartite ATP-independent
                     periplasmic transporter"
                     /protein_id="YP_005653409.1"
                     /db_xref="GI:384438685"
                     /db_xref="GeneID:12251640"
                     /translation="MSLESLMPPLMFLALIVFLLSGYPVAFSLGAVGIVFGFLGIALD
                     IFPAPLLRAMPDRIFGIMSNQLLLAIPFFTFMGIILEKSGLAEDLLDTMGKLFGPLRG
                     GLALSVVFVGAILAATTGVVAASVMAMGLISLPIMLKYGYNPRFASGVILGSATLAQI
                     IPPSVVLIVLSDQLGVSVGDMYQAALIPAGLTVAFYFLYVVYVALFRPRWAPALPLEA
                     RPDAGKETGAAFALLSYLLVGVGAYAVGRFLPAWAEWLEILLALGLWTLILLPWIRKN
                     PLLRKALLSMVPPLVLIFLVLGTVLIGLATPTEAGAMGVVGALILAALNRRLSFPVLY
                     GAMEGTARLTAFVIFILIGSTLFSLVFRGVDGDLWVEGFLTGLPGGEVGFILFVMVLV
                     FLLGFFIDFFEIAFIALPLLAIGADALGIDKLWFGLLVGVNLQTSFLTPPFGFALFYL
                     RNVAPASVRTGDIYLGGVPFIGLQLLVLLLTYLLREPILRFVHGAGG"
     misc_feature    complement(315956..317362)
                     /locus_tag="TCCBUS3UF1_2860"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; cl17274"
                     /db_xref="CDD:266603"
     misc_feature    complement(315956..317338)
                     /locus_tag="TCCBUS3UF1_2860"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            complement(317368..317907)
                     /locus_tag="TCCBUS3UF1_2870"
                     /db_xref="GeneID:12251641"
     CDS             complement(317368..317907)
                     /locus_tag="TCCBUS3UF1_2870"
                     /note="similar to TRAP-type mannitol/chloroaromatic
                     compound transport system, small permease component
                     COG4665;
                     similar to Tripartite transporter, small subunit of
                     Bacteria UniRef RepID=Q72GQ6_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Tripartite transporter, small subunit"
                     /protein_id="YP_005653410.1"
                     /db_xref="GI:384438686"
                     /db_xref="GeneID:12251641"
                     /translation="MRFLLGLSRAIDTLTEGVGRAVVWLVLLVALLSAGNAIMRYGFS
                     YSSNAYLEAQWYMFSLIFLLGGAYALKHNAHVRIDLVFGRLSRRTQAWIDLVGTVLFL
                     LPMALGVIYLAWPWAMNSFWGKEMSPDVGGLPRWPIKLALPLGFALLALQGLSELIKR
                     IAFLTGHLQLKEEREEVVE"
     misc_feature    complement(317380..317907)
                     /locus_tag="TCCBUS3UF1_2870"
                     /note="TRAP-type mannitol/chloroaromatic compound
                     transport system, small permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: FcbT2; COG4665"
                     /db_xref="CDD:227011"
     gene            complement(317995..319203)
                     /locus_tag="TCCBUS3UF1_2880"
                     /db_xref="GeneID:12251642"
     CDS             complement(317995..319203)
                     /locus_tag="TCCBUS3UF1_2880"
                     /note="similar to hypothetical protein PRK12382;
                     similar to Permease of Thermus UniRef RepID=Q72GQ5_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Permease"
                     /protein_id="YP_005653411.1"
                     /db_xref="GI:384438687"
                     /db_xref="GeneID:12251642"
                     /translation="MRHGPGWFLSLSAYWFATSLKWFLVLLVLLPAKVAEVSPPEEKA
                     TRLGFLFGLGAVMAILGPPIMGYLSDRLGRRRPFLLLGSLLTALALLLLAHAPSYGVL
                     LLAYLLLQLADDLATGPYSALIPDLVPKGERGTASGYMGVLQVSGQVLGGVVGFLLPL
                     HPQAYLAALVNLLGAFWSLKLVPERLPTRSERPFLKAMAAPWRDRDFLLVYLTRFLVM
                     LGFYLAQTYLQYYLGDVVQTFQAWGRSLTEEPFQAVALLGLLISLGAGLSSVPAGRAS
                     DRMGRKPLIYLSGAGLGLLMPFLLLFPRYDLLLFLSLFFGLFYGVYLAVDWALVSDIL
                     KEPEAHATQMGLWQTSIVVPQVLAGAFGRPLDLLNAQAPGLGYLVLFGLAGGFFLLGA
                     FLVAPIRRAR"
     misc_feature    complement(318007..319074)
                     /locus_tag="TCCBUS3UF1_2880"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(<318334..319065)
                     /locus_tag="TCCBUS3UF1_2880"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(318139..318141,318148..318153,
                     318160..318165,318172..318177,318211..318213,
                     318220..318225,318235..318237,318244..318249,
                     318256..318258,318397..318399,318409..318411,
                     318418..318420,318430..318432,318442..318444,
                     318517..318519,318526..318531,318538..318543,
                     318550..318552,318760..318762,318778..318783,
                     318790..318795,318829..318831,318838..318843,
                     318850..318855,318862..318867,319006..319011,
                     319015..319020,319030..319032,319039..319044,
                     319051..319053))
                     /locus_tag="TCCBUS3UF1_2880"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(319214..320047)
                     /locus_tag="TCCBUS3UF1_2890"
                     /db_xref="GeneID:12251643"
     CDS             complement(319214..320047)
                     /locus_tag="TCCBUS3UF1_2890"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653412.1"
                     /db_xref="GI:384438688"
                     /db_xref="GeneID:12251643"
                     /translation="MRLLAAVDLGDTLEGVVASARFLQGGLGIPAEVVHVVPTPYLEA
                     LARRFPELGPSLEAALGQVEAKVEAVLRGTGLKARVLRGFPAQVVAGEALRSKAVLLG
                     HKGEGSLEVLARGGLARYLLHRGEVPVLLLPRALKGVRRIAVGLDESPASLAAFRVAE
                     AWGRALGAEVLGLHLVSGEGGCCFPTYLDPRGLALAEVLERARAHLEALLRATGVVEV
                     SKGEDELDLLRLAEARGADLLVLGSKAKSTWRHRLGRMVETLVARTPLPLLVVPEAAV
                     W"
     misc_feature    complement(319655..320044)
                     /locus_tag="TCCBUS3UF1_2890"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(319694..319705,319733..319738,
                     319742..319747,319940..319942,320024..320032))
                     /locus_tag="TCCBUS3UF1_2890"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     misc_feature    complement(319235..319627)
                     /locus_tag="TCCBUS3UF1_2890"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(319277..319288,319313..319318,
                     319322..319327,319523..319525,319607..319615))
                     /locus_tag="TCCBUS3UF1_2890"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            320079..320897
                     /locus_tag="TCCBUS3UF1_2900"
                     /db_xref="GeneID:12251644"
     CDS             320079..320897
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="similar to dihydropteroate synthase PRK13753;
                     similar to Dihydropteroate synthase of Thermus
                     thermophilus UniRef RepID=Q5SLV2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydropteroate synthase"
                     /protein_id="YP_005653413.1"
                     /db_xref="GI:384438689"
                     /db_xref="GeneID:12251644"
                     /translation="MLWLRDRALDLSRPRLMGILNLTPDSFSDGGLYLDPERALARAR
                     AMVAEGADLLDLGAESTRPGAEPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAE
                     EALRMGAHLLNDVTGLRDERMLALAARFGVAAVVMHMPVPDPKAMMAHARYGDVVAEV
                     RAFLKAQAERALRAGVPQVVLDPGFGFGKLLEHNLALLRRLEAIVELGHPVLVGLSRK
                     RTIGELTGVEAPGERVLGSVAAHLYAVLKGARILRVHDVGAHREALAVWNALWG"
     misc_feature    320115..320894
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="Dihydropteroate synthase and related enzymes
                     [Coenzyme metabolism]; Region: FolP; COG0294"
                     /db_xref="CDD:223371"
     misc_feature    320118..320882
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    order(320139..320141,320358..320360,320415..320417,
                     320421..320423,320487..320489,320622..320624,
                     320718..320720,320730..320732,320835..320837,
                     320841..320843)
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    order(320661..320663,320673..320678,320793..320795,
                     320805..320807,320817..320819,320862..320867)
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    320724..320732
                     /locus_tag="TCCBUS3UF1_2900"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            320900..321256
                     /locus_tag="TCCBUS3UF1_2910"
                     /db_xref="GeneID:12251645"
     CDS             320900..321256
                     /locus_tag="TCCBUS3UF1_2910"
                     /note="similar to bifunctional dihydroneopterin
                     aldolase/dihydroneopterin triphosphate 2'-epimerase
                     PRK11593;
                     similar to Dihydroneopterin aldolase of Truepera
                     radiovictrix DSM 17093 UniRef RepID=D7CXI4_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Dihydroneopterin aldolase"
                     /protein_id="YP_005653414.1"
                     /db_xref="GI:384438690"
                     /db_xref="GeneID:12251645"
                     /translation="MGVIALLGLEFYGRHGVMPEEGRLGARFVVDLWLSVPFEGKGDR
                     LEETVDYAAVYALVEEAVRHRRFYLIEALADHLAEALIQAFPRLEGVRVRVHKPHAPI
                     PGVFRDVYAETEKKRS"
     misc_feature    320921..321247
                     /locus_tag="TCCBUS3UF1_2910"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(320921..320935,320951..320977,321194..321199,
                     321212..321238)
                     /locus_tag="TCCBUS3UF1_2910"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(320945..320953,320960..320962,321101..321112,
                     321188..321190,321230..321232)
                     /locus_tag="TCCBUS3UF1_2910"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            complement(321324..321449)
                     /locus_tag="TCCBUS3UF1_2920"
                     /db_xref="GeneID:12251646"
     CDS             complement(321324..321449)
                     /locus_tag="TCCBUS3UF1_2920"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653415.1"
                     /db_xref="GI:384438691"
                     /db_xref="GeneID:12251646"
                     /translation="MATLSITGPPLSGHPQSSPKEVRNFIAHRSMSGGEGIQASA"
     gene            321484..321975
                     /locus_tag="TCCBUS3UF1_2930"
                     /db_xref="GeneID:12251647"
     CDS             321484..321975
                     /locus_tag="TCCBUS3UF1_2930"
                     /note="similar to inorganic polyphosphate/ATP-NAD kinase
                     PRK03378;
                     similar to Putative uncharacterized protein of Thermaceae
                     UniRef RepID=D7BBP8_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653416.1"
                     /db_xref="GI:384438692"
                     /db_xref="GeneID:12251647"
                     /translation="MQHLGSDYRLNFVEFITLLTAGRRLLRAYYYNAPLPPEDPAAKA
                     HQSFLNYLKRVPYVAVRLGRLERRADGFVEKGVDIQIAIDILRLAYADAYDVAVLVSG
                     DGDFAEVVRVVQDMGKQVENTTFHALSSHRLAQQADRFYPLDDFPWERLRAPSLPQAS
                     EGE"
     misc_feature    321505..321915
                     /locus_tag="TCCBUS3UF1_2930"
                     /note="LabA_like proteins; Region: LabA_like/DUF88;
                     cl10034"
                     /db_xref="CDD:263953"
     misc_feature    321511..321918
                     /locus_tag="TCCBUS3UF1_2930"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1432"
                     /db_xref="CDD:224349"
     misc_feature    order(321715..321717,321784..321786,321790..321792,
                     321796..321798)
                     /locus_tag="TCCBUS3UF1_2930"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:199895"
     gene            complement(321996..322409)
                     /locus_tag="TCCBUS3UF1_2940"
                     /db_xref="GeneID:12251648"
     CDS             complement(321996..322409)
                     /locus_tag="TCCBUS3UF1_2940"
                     /note="similar to nucleoside diphosphate kinase PRK00668;
                     similar to Nucleoside diphosphate kinase of cellular
                     organisms UniRef RepID=NDK_BREBN"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="YP_005653417.1"
                     /db_xref="GI:384438693"
                     /db_xref="GeneID:12251648"
                     /translation="MERTFVMVKPDGFRRGLVGEILARFERKGFRLVGLKALRIPQEL
                     AEKHYAEHREKPFFPSLVAFITSGPVVAMVLEGPGVVAEVRKMMGATHPKDALPGTIR
                     GDFATTIDENVIHGSASLEDAEREIALFFRPEELL"
     misc_feature    complement(322002..322406)
                     /locus_tag="TCCBUS3UF1_2940"
                     /note="Nucleoside diphosphate kinase; Region: NDK;
                     pfam00334"
                     /db_xref="CDD:249778"
     misc_feature    complement(322017..322406)
                     /locus_tag="TCCBUS3UF1_2940"
                     /note="Nucleoside diphosphate kinase Group I
                     (NDPk_I)-like: NDP kinase domains are present in a large
                     family of structurally and functionally conserved proteins
                     from bacteria to humans that generally catalyze the
                     transfer of gamma-phosphates of a nucleoside...; Region:
                     NDPk_I; cd04413"
                     /db_xref="CDD:239876"
     misc_feature    complement(order(322032..322034,322056..322061,
                     322065..322067,322074..322076,322104..322106,
                     322137..322139,322155..322157,322239..322241,
                     322263..322265,322383..322385))
                     /locus_tag="TCCBUS3UF1_2940"
                     /note="active site"
                     /db_xref="CDD:239876"
     misc_feature    complement(order(322299..322307,322332..322334,
                     322341..322343,322350..322358,322371..322373))
                     /locus_tag="TCCBUS3UF1_2940"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239876"
     gene            complement(322431..323363)
                     /locus_tag="TCCBUS3UF1_2950"
                     /db_xref="GeneID:12251649"
     CDS             complement(322431..323363)
                     /locus_tag="TCCBUS3UF1_2950"
                     /note="similar to Serine/threonine protein phosphatase
                     COG0631;
                     similar to Protein phosphatase 2C of Thermus UniRef
                     RepID=Q72GP9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein phosphatase 2C"
                     /protein_id="YP_005653418.1"
                     /db_xref="GI:384438694"
                     /db_xref="GeneID:12251649"
                     /translation="MPGLAFALETHPGLKRPKNEDALGYTLTPWGGVFVVADGMGGHR
                     TGEVAARLAVETILAHLKEGEPSPKALLQAFEEANARIHGEAQRPENRGMGTTATCLL
                     LDLPYALLAHVGDSRAYLLRQGELTLLTEDHSWVAERVRQGLLTPEEARTHRWRNVIT
                     NALGSFPQARVDLLGLKLEPGDVFLLCTDGLSGVLDERTLGEVLRHFPPQEAASRLVA
                     LANEWGGPDNISAIVVRVPEELPRNPRPYALPLEAAQGKPVGLKLGEEPDELPTQVLE
                     PERKGARLGWRDVLLIGLWILVVGYILLGYFRKP"
     misc_feature    complement(322656..323336)
                     /locus_tag="TCCBUS3UF1_2950"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    complement(order(322683..322685,322797..322799,
                     323244..323252,323301..323306,323316..323318))
                     /locus_tag="TCCBUS3UF1_2950"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            323497..324927
                     /locus_tag="TCCBUS3UF1_2960"
                     /db_xref="GeneID:12251650"
     CDS             323497..324927
                     /locus_tag="TCCBUS3UF1_2960"
                     /note="similar to UPF0027 protein AF_0862 of cellular
                     organisms UniRef RepID=Y862_ARCFU"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653419.1"
                     /db_xref="GI:384438695"
                     /db_xref="GeneID:12251650"
                     /translation="MRWEKIAPYTYRIPRQGKMRVDAVFFASEEILRDLEAENYASLA
                     QLANVATLPGIVEPALAMPDIHWGYGFPIGGVAAFDPEAGGVVSPGGVGFDINCGVRL
                     LVSALTLEDLLPRQRELADALFRLVPSGVGSERKDVRFSKKELKEILKEGAGWLVRKG
                     FGHPEDLRFIESEGRLPWANPDKVSERAFERGAPQIGTLGSGNHFLEVQYVDQVYDLE
                     AAEAYGLFPNQIAVLIHTGSRGLGHQVCQDYVERFLKVAPRYGIELVDKQLAAAPIRS
                     PEGEDYLQAMAAAANFAFANRQLIAHFVREAFEAVGFTPREHGLRVLYDLAHNNAKFE
                     EHGGRRVLVHRKGATRAFGPGYPEIPREYQRVGQPVLVPGDMGRYSYVLAGTEGAMAH
                     AFGSSCHGAGRKMSRHQAKRVARERNLVKELAERGILVRAATRATVDEEMPEAYKDVS
                     SVVEAVQGAGIGKKVARLRPLIVVKG"
     misc_feature    323545..324924
                     /locus_tag="TCCBUS3UF1_2960"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: RtcB; COG1690"
                     /db_xref="CDD:224604"
     misc_feature    323554..324924
                     /locus_tag="TCCBUS3UF1_2960"
                     /note="tRNA-splicing ligase RtcB; Region: RtcB; pfam01139"
                     /db_xref="CDD:250393"
     gene            324962..325882
                     /locus_tag="TCCBUS3UF1_2970"
                     /db_xref="GeneID:12251651"
     CDS             324962..325882
                     /locus_tag="TCCBUS3UF1_2970"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653420.1"
                     /db_xref="GI:384438696"
                     /db_xref="GeneID:12251651"
                     /translation="MRPLPFFPFLFLFLFLGLALGQTLLPAQVLGLSFREEAGAWVYE
                     GEGVRLAYVPGVGWAEPLGAHLPPPDRERLPLEALKALGYFQAPEAGVRFGVQGRAFR
                     AVLDLPMPHGGGAQEGRGGALDLPLPYLAPGLLQAPWPPGVRAEVRLQPGGTLLRLQA
                     PGRLLRYRLFPLQDPPRLVLDLYALEPEVEEALAPGVRYKEVWAFAPEPLRLYLVEAE
                     RGRLVPVGTPGRRAVARDLAPGALAVLNGGYFDPGSGTPIGLWVQDGVTVSYPFGRVT
                     LLWEGWGFFLGFPRFEAVVRGPGGSGCGWG"
     misc_feature    325679..>325816
                     /locus_tag="TCCBUS3UF1_2970"
                     /note="Predicted periplasmic protein (DUF2233); Region:
                     DUF2233; pfam09992"
                     /db_xref="CDD:255681"
     gene            complement(326436..326876)
                     /locus_tag="TCCBUS3UF1_2990"
                     /db_xref="GeneID:12251652"
     CDS             complement(326436..326876)
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="similar to hypothetical protein PRK10707;
                     similar to MutT/nudix family protein of Thermus UniRef
                     RepID=Q5SGY3_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="MutT/nudix"
                     /protein_id="YP_005653421.1"
                     /db_xref="GI:384438697"
                     /db_xref="GeneID:12251652"
                     /translation="MPLLGEVLLLTRRSPHLPTHAGQVSFPGGVVEPGESPVEAALRE
                     AEEEVGLGGLEPLGFLSPTLSPQGFLVQPVVVHREDLPPLRPNPLEVAEVLLAPLEEL
                     LRVEPWSEVRGGRTVWHFPWRGVDIWGVTGNILKEFLEVWQRAS"
     misc_feature    complement(326463..326855)
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="Coenzyme A pyrophosphatase (CoAse), a member of the
                     Nudix hydrolase superfamily, functions to catalyze the
                     elimination of oxidized inactive CoA, which can inhibit
                     CoA-utilizing enzymes. The need of CoAses mainly arises
                     under conditions of oxidative...; Region: CoAse; cd03426"
                     /db_xref="CDD:239518"
     misc_feature    complement(order(326670..326672,326745..326750,
                     326787..326789,326808..326810,326838..326840))
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="putative active site [active]"
                     /db_xref="CDD:239518"
     misc_feature    complement(order(326670..326672,326748..326750,
                     326787..326789,326808..326810,326838..326840))
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239518"
     misc_feature    complement(order(326724..326774,326775..326792))
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239518"
     misc_feature    complement(326745..326747)
                     /locus_tag="TCCBUS3UF1_2990"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239518"
     gene            complement(326912..327508)
                     /locus_tag="TCCBUS3UF1_3010"
                     /db_xref="GeneID:12251653"
     CDS             complement(326912..327508)
                     /locus_tag="TCCBUS3UF1_3010"
                     /note="similar to nucleoside triphosphate
                     pyrophosphohydrolase PRK12333;
                     similar to MazG family protein of Deinococci UniRef
                     RepID=D7CR56_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside triphosphate pyrophosphohydrolase
                     MazG"
                     /protein_id="YP_005653422.1"
                     /db_xref="GI:384438698"
                     /db_xref="GeneID:12251653"
                     /translation="MGGMERLLEVMRRLRGPGGCPWDRAQTHASLVPYLLEEASEAAD
                     ALLEGNPQAMAEELGDVLLQVAFHSVIAEEEGRFTYGDVERGIVEKLIRRHPHVFGEA
                     SAHTPEEVKARWEALKAEEGKEERPCGLPQHLPTLLRAYELQRRGVEPGSEEGLRAAL
                     ERGDLEEALWNLVGLFAKRGLDPESALRRRSLRACREA"
     misc_feature    complement(326921..327499)
                     /locus_tag="TCCBUS3UF1_3010"
                     /note="nucleoside triphosphate pyrophosphohydrolase;
                     Reviewed; Region: PRK12333"
                     /db_xref="CDD:237064"
     misc_feature    complement(327155..327496)
                     /locus_tag="TCCBUS3UF1_3010"
                     /note="Nucleoside Triphosphate Pyrophosphohydrolase (EC
                     3.6.1.8) N-terminal tandem-domain of MazG proteins from
                     Escherichia coli and bacterial homologs; Region:
                     NTP-PPase_MazG_Nterm; cd11528"
                     /db_xref="CDD:212135"
     misc_feature    complement(order(327236..327241,327245..327253,
                     327257..327271,327278..327280,327305..327307,
                     327314..327316,327320..327337,327344..327349,
                     327356..327358,327371..327373,327380..327382,
                     327389..327394,327401..327406,327413..327415,
                     327422..327427,327479..327481,327488..327493))
                     /locus_tag="TCCBUS3UF1_3010"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212135"
     misc_feature    complement(order(327329..327331,327338..327340,
                     327386..327388,327395..327397))
                     /locus_tag="TCCBUS3UF1_3010"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212135"
     gene            complement(327483..327932)
                     /locus_tag="TCCBUS3UF1_3000"
                     /db_xref="GeneID:12251654"
     CDS             complement(327483..327932)
                     /locus_tag="TCCBUS3UF1_3000"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653423.1"
                     /db_xref="GI:384438699"
                     /db_xref="GeneID:12251654"
                     /translation="MRSRLAGILLSLPFFLQLLGLGDTPLGGGLCGEVFRVGDPSLAL
                     QTPGFWYGLLFMLLLALELGFGLSLLLLPLLEVRLSPGWLRGGRYLVGLLLLLFLLTR
                     TAGLPFPGPSGWALEPAPLDPLSLLLVGLSLAGGVLLGENGRHGAAS"
     gene            complement(327942..328691)
                     /locus_tag="TCCBUS3UF1_3020"
                     /db_xref="GeneID:12251655"
     CDS             complement(327942..328691)
                     /locus_tag="TCCBUS3UF1_3020"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653424.1"
                     /db_xref="GI:384438700"
                     /db_xref="GeneID:12251655"
                     /translation="MTLLFLREVGRNPWGLGLLLLPALLALGFQGRGEGVGLVGLYSG
                     LLLLLPPLALALAVPLLASREEWAFLLGLPLPPGKAFAEGVLGVFLGLGLPLLPGLLL
                     GAGLLGLSPGSTLWLLLSGVGLLAFWVGVAALLSALLLEERRALGLGFGLFGLGNVLY
                     GPLVVALAVRLQDHPLEGLLSLALLLNPQEIHRVALLSGVKAPVLTGPLGYLVAERLG
                     AVAPLWGLAYLFAFGFLLTLLAALVFARRDR"
     gene            complement(328688..329200)
                     /locus_tag="TCCBUS3UF1_3030"
                     /db_xref="GeneID:12251656"
     CDS             complement(328688..329200)
                     /locus_tag="TCCBUS3UF1_3030"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653425.1"
                     /db_xref="GI:384438701"
                     /db_xref="GeneID:12251656"
                     /translation="MERRRFLWVLAGSLLPWARGAPRALRVGVEACPYCFMTLLDARH
                     AAQAVNPQGKAFFYDDPACLLDQLNGWGGPSLRAREVYLADYGESTRSEPRWVPAEGA
                     ILYHHPRIRTPMGSGLLAFARREALEGHLRERPERAGGRVLSWAQALKEGGKRPWVPA
                     AFFPPPPKAP"
     misc_feature    complement(328760..329113)
                     /locus_tag="TCCBUS3UF1_3030"
                     /note="NosL; Region: NosL; cl01769"
                     /db_xref="CDD:261061"
     gene            complement(329210..329872)
                     /locus_tag="TCCBUS3UF1_3040"
                     /db_xref="GeneID:12251657"
     CDS             complement(329210..329872)
                     /locus_tag="TCCBUS3UF1_3040"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653426.1"
                     /db_xref="GI:384438702"
                     /db_xref="GeneID:12251657"
                     /translation="MRNRREVLKALGGLVLGSPALAQMAPGEGTPGGVRVPAKPIPWE
                     GGSCAFCEMPIKTPEGAWRGRTFPKGFFEQTYSQIAFEKPRPAPHNPKETVEALHFES
                     IACMVNYAWVHGLRDGEGATFYVTDRGAYDPARPQETVRLVPARSATFYWGERMMVVM
                     NAKLLAFASAKAAQDFAEAHKAQHGRQRFYSFQTLLDLAPLPEMNLVALLARHAGLLQ
                     NR"
     misc_feature    complement(329324..329743)
                     /locus_tag="TCCBUS3UF1_3040"
                     /note="NosL; Region: NosL; cl01769"
                     /db_xref="CDD:261061"
     gene            complement(329856..330530)
                     /locus_tag="TCCBUS3UF1_3050"
                     /db_xref="GeneID:12251658"
     CDS             complement(329856..330530)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="similar to ABC-type multidrug transport system,
                     ATPase component COG1131;
                     similar to ABC transporter related of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A9A8_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653427.1"
                     /db_xref="GI:384438703"
                     /db_xref="GeneID:12251658"
                     /translation="MAVQDLRKDGRLRGVSLEARGGVVGLLGPNGAGKSTLLALLAGR
                     LKPSAGKARLLGLDPRDPRALALRAYLPQSPRLFPHLKGKEVLEGARRAKGLGLEALE
                     EAVARMGLEGVWGKPVGTLSGGERQRLALAASLMGNPPIWLLDEPTAALDPKGRERFW
                     AWVGEKGEGVALLALHHVEEAQRAQRLVLLKGGKVLEEGPPERLLGPRGERLPWLMEV
                     LYEEPA"
     misc_feature    complement(329925..330527)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(329946..330524)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(330426..330449)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(330003..330005,330093..330098,
                     330312..330314,330423..330431,330435..330440))
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(330312..330323)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(330141..330170)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(330093..330110)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(330075..330086)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(329997..330017)
                     /locus_tag="TCCBUS3UF1_3050"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            complement(330512..331732)
                     /locus_tag="TCCBUS3UF1_3060"
                     /db_xref="GeneID:12251659"
     CDS             complement(330512..331732)
                     /locus_tag="TCCBUS3UF1_3060"
                     /note="similar to Nitrous oxidase accessory protein
                     COG3420;
                     similar to Nitrous oxidase accessory protein-like protein
                     of Thermus aquaticus Y51MC23 UniRef RepID=B7A9A9_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrous oxidase accessory protein-like protein"
                     /protein_id="YP_005653428.1"
                     /db_xref="GI:384438704"
                     /db_xref="GeneID:12251659"
                     /translation="MSHLPPLPWGVMKRASLLLALAGVSLAAPVLRLEGEVEGPLVLT
                     TPGLEVEAEGAVLRGRKGHTLSLLAPGIRVRGLKVVGAGGGDDFFEPDAAVYLRGCEG
                     CLLEGLEVEGAPAAVRLEDSPRAKVQGLRARGLGASPGVLVYRSPGAQVVESHLAGFM
                     DGIYAEYSPGLVLRGNRLTGHGRYGFHVMFSWHVRVEGNESWGNGVGNAVMHGAENRV
                     RGNRLHGHRSPLAYGLLLQDERGSQVEANRFQENTLGLVLLDAAQVGVRGNRFQENGT
                     ALRITREKGGNSARVEGNLFLGNLYDLLVDDPEAKAQVVGNAYDRASGLPVPHLPSSS
                     FALLLARQPELSLLALSPGVLLWEGAEAQVPGLRLLSLADPQALALPPSRRAHAPLLL
                     LGLLGGVLWWRFRT"
     misc_feature    complement(330599..331654)
                     /locus_tag="TCCBUS3UF1_3060"
                     /note="nitrous oxide reductase family maturation protein
                     NosD; Region: NosD_copper_fam; TIGR04247"
                     /db_xref="CDD:234521"
     gene            331724..332206
                     /locus_tag="TCCBUS3UF1_3070"
                     /db_xref="GeneID:12251660"
     CDS             331724..332206
                     /locus_tag="TCCBUS3UF1_3070"
                     /note="similar to Putative uncharacterized protein of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A9B0_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653429.1"
                     /db_xref="GI:384438705"
                     /db_xref="GeneID:12251660"
                     /translation="MGHSYFQALKDICPGGSGTLKGVRHLAVLAFLGLALAQPLAVPG
                     WVRLVPPGVKDTAAYLTLENRGQVALRLVGAETPVAQRVSLHREHREHRGGHTVLGMR
                     PLPHLDLPPGARVAFRPGGYHFMLEGLKRPLKAGEKVELVLKFADGTRLRVVLPVEMR
                     "
     misc_feature    331853..332182
                     /locus_tag="TCCBUS3UF1_3070"
                     /note="Protein of unknown function (DUF461); Region:
                     DUF461; pfam04314"
                     /db_xref="CDD:252520"
     gene            332203..332790
                     /locus_tag="TCCBUS3UF1_3080"
                     /db_xref="GeneID:12251661"
     CDS             332203..332790
                     /locus_tag="TCCBUS3UF1_3080"
                     /note="similar to Hypothetical exported protein of Thermus
                     thermophilus UniRef RepID=Q72HB6_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653430.1"
                     /db_xref="GI:384438706"
                     /db_xref="GeneID:12251661"
                     /translation="MRRRIFPLLAVLLLVGLAYWLLPKGGHSFYGTRLLNPKPVDFTL
                     QGPSGPVRLGEMGGRLVLLFFGFVHCPDVCPTTLIALKRAYERLSPEEQARVRVVFVS
                     VDPDRDTPEVSDRYAKGFHPSFLGLSGSPEAVQEVARTFGVYYQKTQYRGPGEYLVDH
                     TATTFVVQDGKLVLLFSPEKVEATDKVVADLRALF"
     misc_feature    332323..332736
                     /locus_tag="TCCBUS3UF1_3080"
                     /note="SCO (an acronym for Synthesis of Cytochrome c
                     Oxidase) family; composed of proteins similar to Sco1, a
                     membrane-anchored protein possessing a soluble domain with
                     a TRX fold. Members of this family are required for the
                     proper assembly of cytochrome c...; Region: SCO; cd02968"
                     /db_xref="CDD:239266"
     misc_feature    order(332410..332412,332422..332424,332680..332682)
                     /locus_tag="TCCBUS3UF1_3080"
                     /note="Cu(I) binding site [ion binding]; other site"
                     /db_xref="CDD:239266"
     gene            complement(332797..333591)
                     /locus_tag="TCCBUS3UF1_3090"
                     /db_xref="GeneID:12251662"
     CDS             complement(332797..333591)
                     /locus_tag="TCCBUS3UF1_3090"
                     /note="similar to Predicted divalent heavy-metal cations
                     transporter COG0428;
                     similar to Zinc/iron permease of Methanohalobium
                     evestigatum Z-7303 UniRef RepID=D7EAZ8_9EURY"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc/iron permease"
                     /protein_id="YP_005653431.1"
                     /db_xref="GI:384438707"
                     /db_xref="GeneID:12251662"
                     /translation="MDSPLLYALLGGVFTWGLTAVGAASVFLWQEPSRKLLDGLLGFA
                     AGVMLAASVFSLLLPGMEIAQAQGMLPWVPAVVGFLLGGGLLRLLDRFLPHLHLGPGA
                     QEEGLHTAWRRTTLLILAITLHNFPEGLAVGVAFGAAGLDPSGAATLGGAVALAMGIG
                     LQNLPEGLAVAWPLRRAGIGAGRAWFYGQLSAIVEPLGAVLGALLVAEMQALLPYLMA
                     LAAGAMVFVIVEEVIPESQSEGNGDTSTFGVMVGFALMMALDVALG"
     misc_feature    complement(332800..333591)
                     /locus_tag="TCCBUS3UF1_3090"
                     /note="Predicted divalent heavy-metal cations transporter
                     [Inorganic ion transport and metabolism]; Region: COG0428"
                     /db_xref="CDD:223505"
     gene            333657..334721
                     /locus_tag="TCCBUS3UF1_3100"
                     /db_xref="GeneID:12251663"
     CDS             333657..334721
                     /locus_tag="TCCBUS3UF1_3100"
                     /note="similar to peptide chain release factor 1 PRK00591;
                     similar to Peptide chain release factor 1 of Bacteria
                     UniRef RepID=RF1_THEPX"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide chain release factor 1"
                     /protein_id="YP_005653432.1"
                     /db_xref="GI:384438708"
                     /db_xref="GeneID:12251663"
                     /translation="MLDKLARLEEEYRELEGLLADPEVLKDPRRYQALSRRYAEMGEI
                     IALIREYRKVLQDLDGLEDLLDDPELKEVAKGEREALLARKEELERDLERHLLPKDPM
                     DERDAIVEIRAGTGGEEAALFARDLLEMYLRFAEEMGFETEILDSNPTDLGGFSKVVF
                     EVRGPGGYGTFKYESGVHRVQRVPATETQGRIHTSTATVAVLPKAEEADFQLNMDEIR
                     IDVMRASGPGGQGVNTTDSAVRVVHLPTGIMVTCQDSRSQIKNREKALMILRSRLLEM
                     KRAEEAERLRQTRLAQIGTGERSEKIRTYNFPQSRVTDHRIGFTTHDLEGVLSGRLQP
                     LLEALKRADQERQLEAMTEA"
     misc_feature    333657..334715
                     /locus_tag="TCCBUS3UF1_3100"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     misc_feature    333858..334178
                     /locus_tag="TCCBUS3UF1_3100"
                     /note="PCRF domain; Region: PCRF; pfam03462"
                     /db_xref="CDD:251973"
     misc_feature    334263..334604
                     /locus_tag="TCCBUS3UF1_3100"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            334721..335188
                     /locus_tag="TCCBUS3UF1_3110"
                     /db_xref="GeneID:12251664"
     CDS             334721..335188
                     /locus_tag="TCCBUS3UF1_3110"
                     /note="similar to bifunctional nicotinamide mononucleotide
                     adenylyltransferase/ADP-ribose pyrophosphatase PRK05379;
                     similar to NUDIX hydrolase of Truepera radiovictrix DSM
                     17093 UniRef RepID=D7CTC3_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_005653433.1"
                     /db_xref="GI:384438709"
                     /db_xref="GeneID:12251664"
                     /translation="MRREILVVAAILLDRQGRVLLVGNDWGRRGQVRYTLPGGTVEPG
                     ETVLDALVREVREETGLRVRGIEHLAYVIQVEDRRKNERTLAMAFRASYEGLLNPRDP
                     DGHIVEARFFTPEEVAARLSGHRPLQEPLLDYLSGERGRFYAYPGWGQPGVRV"
     misc_feature    334736..335083
                     /locus_tag="TCCBUS3UF1_3110"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cd02883"
                     /db_xref="CDD:239217"
     misc_feature    order(334835..334843,334871..334897)
                     /locus_tag="TCCBUS3UF1_3110"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(335185..335850)
                     /locus_tag="TCCBUS3UF1_3120"
                     /db_xref="GeneID:12251665"
     CDS             complement(335185..335850)
                     /locus_tag="TCCBUS3UF1_3120"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653434.1"
                     /db_xref="GI:384438710"
                     /db_xref="GeneID:12251665"
                     /translation="MDPGLEAAFRYVERLLFGDMERPGLTLYDLERLVGYPAKGDGPL
                     SYTLPRTKSLSGVQGVRFFYYPKDPGLQLIVEVEDLEGRKHLRHFRWNGFTWEVPEGK
                     RGDLKSTEEALGMAQLGEDYFLGYPREEALELEEAVRKGEALGAKYLLCPRCKARVFY
                     APAVRPAGVACPRCGNPTLLFKTLSGGEGNKDPLEALAEEQRALRKALEELTAYLKRK
                     LGP"
     misc_feature    complement(<335218..335415)
                     /locus_tag="TCCBUS3UF1_3120"
                     /note="Hydrogenase maturation factor [Posttranslational
                     modification, protein turnover, chaperones]; Region: HypF;
                     COG0068"
                     /db_xref="CDD:223146"
     gene            complement(335904..338840)
                     /locus_tag="TCCBUS3UF1_3130"
                     /db_xref="GeneID:12251666"
     CDS             complement(335904..338840)
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="similar to Alpha-dextran endo-1,6-alpha-glucosidase
                     ((Amylo)pullulanase) of Thermus UniRef RepID=Q5SLY5_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Alpha-dextran endo-1,6-alpha-glucosidase
                     ((Amylo)pullulanase)"
                     /protein_id="YP_005653435.1"
                     /db_xref="GI:384438711"
                     /db_xref="GeneID:12251666"
                     /translation="MKLHGILIGLMMAPLALAQPLRVAILWHQHQPPYENPVTGQYEE
                     PWVRAHGVNDYPWMAEVLKEFPEIKVTFDYTSTLLKQIGDYLSGKAKDAYWRVSEKPL
                     SALSQEERAFIVARFFDLNPRFVEKSPRYRELQAKKARGEAFSDADLQDLRVLWNLYW
                     INIDYIERDPGLRALYRKDRGFTQEDVNYVLKKHLELMATILPLHRELWRKGQIDLIT
                     TPYYHPILPILLDKEAIRESNPALSLPKEPIAWPEDAAWQVRAGREYFKALFGQEPKG
                     MWPPEGAVSQKAAELYAQEGIGFLVTDEAILGKSGFPVNPATLTRIYHVEKDGKRVRL
                     FFRHRDLSDRIGFSYSGMPAERAVEDFIGTLLEIRRQVIGQNPNAVLTIALDGENAWE
                     NYPNNGNEFRRLLYRRLAEEERKGTLKTVLFSELLSEPSLPIARLGTGGWAGDFAMWA
                     GEPEENEAWDRLARARQAVLDFQAQGGDPKAVEKALGLIYQAQASDWFWWYGQDTGFP
                     NNPPFDEAFRAILQAVYGTIGQKPPEALFIAVRPPVQPQGTPGRVKPTLDGQAGPEEW
                     RGAAYLPDLEGTTMQTQDDLIRGVYLGFDEQHVYLRVDLKEGVRAKDLLGQGYRLHLY
                     ATTPKEEGGAAFPEGAEVPLGFPLQQRVTLDLDGVREGQATLVRFAYREGAWVLASSP
                     ADLAGRRAWVDQVVEMRIPYTTLRAEAGDTLRLALVLEKGGRVLDTAPNGSPLALSLP
                     QRLAGKEVLRLRDPEGDEHGPGTYTYPKEGAFAPYKGLFDLLEMRVLDSGATWTLVFT
                     FGEMTNPWGAPAGFSHQLLNVYLDFKEGGRTDTFAKGAKVAFDPAHPWDLFLKAAGWP
                     QYGQRVGFPDGTDTADGVVVGSNPADKQVILQLDKKYFNPTPGQRVCLYVLVGSQDGY
                     GPDHFRPVGKEAGPWNLGGAQNEDAPLVVDYLWPEKGTQEAMLSPYGGGKLAVLKPYC
                     LNWPAP"
     misc_feature    complement(337212..338789)
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="Alpha-amylase/alpha-mannosidase [Carbohydrate
                     transport and metabolism]; Region: COG1449"
                     /db_xref="CDD:224366"
     misc_feature    complement(337488..338774)
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="N-terminal catalytic domain of thermoactive
                     amylopullulanases; glycoside hydrolase family 57 (GH57);
                     Region: GH57N_APU; cd10796"
                     /db_xref="CDD:212108"
     misc_feature    complement(order(337494..337496,337515..337517,
                     337683..337685,337998..338000,338751..338753,
                     338757..338759))
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="putative active site [active]"
                     /db_xref="CDD:212108"
     misc_feature    complement(order(337683..337685,337998..338000))
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212108"
     misc_feature    complement(335934..336599)
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="DOMON-like domain of various glycoside hydrolases;
                     Region: DOMON_glucodextranase_like; cd09626"
                     /db_xref="CDD:187684"
     misc_feature    complement(order(336120..336122,336288..336290,
                     336294..336296,336387..336389))
                     /locus_tag="TCCBUS3UF1_3130"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187684"
     gene            338927..339976
                     /locus_tag="TCCBUS3UF1_3140"
                     /db_xref="GeneID:12251667"
     CDS             338927..339976
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="similar to NADPH dehydrogenase NamA PRK13523;
                     similar to NADPH dehydrogenase of Roseomonas cervicalis
                     ATCC 49957 UniRef RepID=D5RTJ6_9PROT"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH dehydrogenase"
                     /protein_id="YP_005653436.1"
                     /db_xref="GI:384438712"
                     /db_xref="GeneID:12251667"
                     /translation="MSLLFSPLTLRGLRLKNRLAMSPMCQYSATAEGQVTDWHLLHYP
                     TRALGGVGLVLVEATAVLPEGRISPLDLGIWSEDHLPGLKELARRIREAGAVPGIQLA
                     HAGRKAGTTPPWEGGKPLGWRVVGPSPLPFAEGYPVPEALDEAGMERVLEAFVQGARR
                     ALRAGFQVVELHMAHGYLLSSFLSPLSNGRTDAYGGSLENRMRFPLRVAQAVREALPP
                     ELPLLVRVSATDWAEGGWGLPDTLAFAERLKALGVDLLDCSSGGVVPGVRVPAAPGFQ
                     VPFADAVRKRVGLATGAVGLITEAFQAETLLQAGSADLVLLGRVLLRDPYFPLRAAKA
                     LGVPAEVPPQYQRGF"
     misc_feature    338936..339928
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="Old yellow enzyme (OYE) YqjM-like FMN binding
                     domain. YqjM is involved in the oxidative stress response
                     of Bacillus subtilis.  Like the other OYE members, each
                     monomer of YqjM contains FMN as a non-covalently bound
                     cofactor and uses NADPH as a reducing...; Region:
                     OYE_YqiM_FMN; cd02932"
                     /db_xref="CDD:239242"
     misc_feature    order(338990..338995,338999..339001,339005..339007,
                     339098..339100,339224..339226,339440..339442,
                     339449..339451,339455..339457,339599..339601,
                     339701..339703,339752..339754,339809..339814,
                     339872..339874,339878..339886,339893..339895)
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="active site"
                     /db_xref="CDD:239242"
     misc_feature    order(338990..338995,338999..339001,339098..339100,
                     339224..339226,339440..339442,339449..339451,
                     339599..339601,339701..339703,339752..339754,
                     339809..339814,339872..339874,339878..339886,
                     339893..339895)
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239242"
     misc_feature    order(338999..339001,339005..339007,339440..339442,
                     339449..339451,339455..339457)
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239242"
     misc_feature    order(339002..339004,339035..339040,339044..339049,
                     339056..339058,339068..339070,339749..339751,
                     339755..339757,339812..339814,339830..339832,
                     339899..339904)
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239242"
     misc_feature    339455..339457
                     /locus_tag="TCCBUS3UF1_3140"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239242"
     gene            339997..341406
                     /locus_tag="TCCBUS3UF1_3150"
                     /db_xref="GeneID:12251668"
     CDS             339997..341406
                     /locus_tag="TCCBUS3UF1_3150"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653437.1"
                     /db_xref="GI:384438713"
                     /db_xref="GeneID:12251668"
                     /translation="MRAFPPEREEDFAPLLPEEVVRRGLAYFQEGRVRRVFRLGERLW
                     GEVQGSGPEAYRVEVGPGLVGRCTCPHPRFPCKHAVALLYAHLERKAQDLAPLLAALA
                     PEEAKALLLRLAHLPQVAFLLAEALAPERAFREGVRRMRQAFRLGGGEEEARGLLLRL
                     EGAGREEVEAFLEALLQAPFDPEPYLEAALERYRALGPRLSFLLGLYLRHPSEALKEA
                     WLRLGEGRPEEALALLGGRDPEGRRRGLRAELLLRLGREEEALAALKEGLEGVEDYLH
                     LVGRLLALGRVAEALRYAEEARDWFGKDPRLLPLLDLLVAHRGLPEDHRARFALRPNL
                     EDYLALKAKLGRAFAQERPALLRPVEDPVLLARIYLLEEDWKALDRLLRRLPPKAYPR
                     LAEALEERLPQEALRLYREAAQARVAEGGRPAYREAAQILKRMARLDPEATRRTIREI
                     LQAHPRRRALREELAFLLA"
     misc_feature    340159..340251
                     /locus_tag="TCCBUS3UF1_3150"
                     /note="SWIM zinc finger; Region: SWIM; pfam04434"
                     /db_xref="CDD:252595"
     misc_feature    <341044..341355
                     /locus_tag="TCCBUS3UF1_3150"
                     /note="7TM-HD extracellular; Region: 7TMR-HDED; pfam07697"
                     /db_xref="CDD:254367"
     gene            341474..341564
                     /locus_tag="TCCBUS3UF1_t40"
                     /db_xref="GeneID:12251669"
     tRNA            341474..341564
                     /locus_tag="TCCBUS3UF1_t40"
                     /product="tRNA-Ser"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="Anticodon is TGA"
                     /db_xref="GeneID:12251669"
     gene            341574..341666
                     /locus_tag="TCCBUS3UF1_t50"
                     /db_xref="GeneID:12251670"
     tRNA            341574..341666
                     /locus_tag="TCCBUS3UF1_t50"
                     /product="tRNA-Ser"
                     /inference="profile:tRNAscan-SE:1.23"
                     /note="Anticodon is GCT"
                     /db_xref="GeneID:12251670"
     gene            341698..342372
                     /locus_tag="TCCBUS3UF1_3160"
                     /db_xref="GeneID:12251671"
     CDS             341698..342372
                     /locus_tag="TCCBUS3UF1_3160"
                     /note="similar to sugar fermentation stimulation protein A
                     PRK00347;
                     similar to Sugar fermentation stimulation protein of
                     Thermus UniRef RepID=Q72HY9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar fermentation stimulation protein"
                     /protein_id="YP_005653438.1"
                     /db_xref="GI:384438714"
                     /db_xref="GeneID:12251671"
                     /translation="MLALPLPPLKPCRFLGRKNRFLVEADVGPLHLPNSGRMAELLLP
                     HAPCFYWPKPTPKTRGRMVLVEREGVLVGVDATQANRLLELLLGQGVLGPLEALEREV
                     RLGGERLDFRARLGGREALLEAKNCNRVEGPLALFPDAPTARGARHLRLLAGWAREGG
                     LAYALWFVQHPQAQAFALDPADGALLEAAREAWEAGVRLRAYRVRPSLKALHLEGELP
                     WVWLPT"
     misc_feature    341731..342357
                     /locus_tag="TCCBUS3UF1_3160"
                     /note="Sugar fermentation stimulation protein; Region:
                     SfsA; cl00647"
                     /db_xref="CDD:242002"
     gene            complement(342361..343086)
                     /locus_tag="TCCBUS3UF1_3170"
                     /db_xref="GeneID:12251672"
     CDS             complement(342361..343086)
                     /locus_tag="TCCBUS3UF1_3170"
                     /note="similar to Predicted divalent heavy-metal cations
                     transporter COG0428;
                     similar to Blr7228 protein of Bradyrhizobiaceae UniRef
                     RepID=Q89E59_BRAJA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653439.1"
                     /db_xref="GI:384438715"
                     /db_xref="GeneID:12251672"
                     /translation="MGAVFLYALFTAIATGLGALPFLFTRNIVARHLGLANAAAAGLM
                     LSASFGLIYEGVQASLGRTLLGVLLGLFFILLSHRYLEGREVSFGHMSALDARKALMM
                     VGIMTLHSFAEGVGVGVAFGGGEALGVFITLAIAVHNIPEGLAISLVLIPRGVSVLGA
                     SLWSIFSSLPQPLMAVPAFLFVEAFKPALPVGLGFAAGAMIWMAVAEILPEALKEAEA
                     EGVATVLTLAVALMVAFQILLGG"
     misc_feature    complement(342382..343074)
                     /locus_tag="TCCBUS3UF1_3170"
                     /note="ZIP Zinc transporter; Region: Zip; cl00437"
                     /db_xref="CDD:260422"
     gene            complement(343118..343810)
                     /locus_tag="TCCBUS3UF1_3180"
                     /db_xref="GeneID:12251673"
     CDS             complement(343118..343810)
                     /locus_tag="TCCBUS3UF1_3180"
                     /note="similar to Esterase/lipase COG1647;
                     similar to Carboxylesterase of Thermaceae UniRef
                     RepID=Q72HZ1_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Carboxylesterase"
                     /protein_id="YP_005653440.1"
                     /db_xref="GI:384438716"
                     /db_xref="GeneID:12251673"
                     /translation="MNLLLLHGFTSHPLLTLGPLPQALREAGFSVRQPTLPGHGTRPE
                     DLLQVRWRDWLETARAAYRDLPEPRGVVGLSMGALLAAHLAAETPTALLVALAPALAL
                     KSPLAPLAPVLAPLIPRFPGPDSICDPECQRQNPNYPYFPTRAVLQLLALMGQTPRVL
                     PRVEAPALVVEAGKDKVVKGVRRYHRLLGSARKDYLVFPESGHDLLLDRDREAVARAV
                     QDWIIATSNHSQ"
     misc_feature    complement(343145..343801)
                     /locus_tag="TCCBUS3UF1_3180"
                     /note="Esterase/lipase [General function prediction only];
                     Region: COG1647"
                     /db_xref="CDD:224561"
     gene            343866..344648
                     /locus_tag="TCCBUS3UF1_3190"
                     /db_xref="GeneID:12251674"
     CDS             343866..344648
                     /locus_tag="TCCBUS3UF1_3190"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653441.1"
                     /db_xref="GI:384438717"
                     /db_xref="GeneID:12251674"
                     /translation="MLEGNLAEFPFPSLVGALMSAGRTGRLHIRPPFLEGQVYLRAGQ
                     VVHAQVQAGDKALEGEEALDLLVGLKRAPFAFEPETLPPHTTLMGGLAVPARLAEAQA
                     AWKSLALPADWGYVLRLPAGGGEVELSAEALKVLAQVEGKRIAEVLVAPGVLRLARIL
                     HTLLQMGALEAVPLVAVPPASLLVLPIYGPGSGVAYVDEALYAEWARTIRHGFRLRLH
                     PLGAVMEVRPRPNIQGRLGLLEEDLKRLRLRRGDKVEVVPEV"
     misc_feature    343872..344138
                     /locus_tag="TCCBUS3UF1_3190"
                     /note="Domain of unknown function (DUF4388); Region:
                     DUF4388; pfam14332"
                     /db_xref="CDD:258505"
     gene            344652..346007
                     /locus_tag="TCCBUS3UF1_3200"
                     /db_xref="GeneID:12251675"
     CDS             344652..346007
                     /locus_tag="TCCBUS3UF1_3200"
                     /note="similar to Na+/alanine symporter COG1115;
                     similar to Sodium-alanine symporter family protein of
                     Thermus UniRef RepID=Q5SHM7_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium-alanine symporter"
                     /protein_id="YP_005653442.1"
                     /db_xref="GI:384438718"
                     /db_xref="GeneID:12251675"
                     /translation="MDVLAWNDYLNRIVYGFPMKLVFLLVGAYLVIFQIRWFSAPLRM
                     MRVSFSETFGAIRERTYGFGGQITPFQATMVALSATVGTGHLLGMLAAVLVGGPGAVF
                     WMWLGYFFGTGTKFAEATLAVHFRRRYADGSVSGGPMHYLLRGLPRLRFLGYLFAFFA
                     AVAAFGIGNLSQAGAVGGALAPLGAPPALVGLFLALLVGVILGGGIVRVARFAQVVVP
                     LKLLLFLVAILPLFILYAGQIPQALALVFQAAFSPEAALGGAAGYSLFAAINAGLGRG
                     IFANEAGLGSAPIAHAQAQVDHPVRQGFWGVTEMFVSFLVTSLTALTFIASGLWRQGG
                     SAAEAATALFQAHPLGGVVLALTVAVFALGTMVSWGFYGEEAAAFLFGEGVRWPYRLT
                     FAVLAFVGPLGGLEAFLAISDTLNGLMAIPNLLGLILLGPVVARLTYGFFRGEPWVPP
                     R"
     misc_feature    344652..345980
                     /locus_tag="TCCBUS3UF1_3200"
                     /note="Na+/alanine symporter [Amino acid transport and
                     metabolism]; Region: AlsT; COG1115"
                     /db_xref="CDD:224040"
     gene            complement(346014..346412)
                     /locus_tag="TCCBUS3UF1_3210"
                     /db_xref="GeneID:12251676"
     CDS             complement(346014..346412)
                     /locus_tag="TCCBUS3UF1_3210"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653443.1"
                     /db_xref="GI:384438719"
                     /db_xref="GeneID:12251676"
                     /translation="MVFRRNPTPPVADWKPTPEEWRVYTLCDGRRSEEEVVRESGLGE
                     EAYRVLADLLKQGLILPVEGPKELCARLVELLRRRLGPKAEPLVARLEGCASRESLEE
                     EALRVALKVKLTLDKKAGEELEKAIREMFR"
     misc_feature    complement(346221..>346364)
                     /locus_tag="TCCBUS3UF1_3210"
                     /note="bacteriocin maturation radical SAM protein 1;
                     Region: rSAM_ocin_1; TIGR03975"
                     /db_xref="CDD:234426"
     gene            complement(346415..346699)
                     /locus_tag="TCCBUS3UF1_3220"
                     /db_xref="GeneID:12251677"
     CDS             complement(346415..346699)
                     /locus_tag="TCCBUS3UF1_3220"
                     /note="similar to Putative uncharacterized protein
                     TTHA1701 of Thermus UniRef RepID=Q5SHM9_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653444.1"
                     /db_xref="GI:384438720"
                     /db_xref="GeneID:12251677"
                     /translation="MEKVLLLLGFLVMVYNVLYGLRLKRAIPGGVMGERGGQMLFLIF
                     FFAASYLGVLLLTWGEPSSLLLLLLSLILLLGSVFVHLVLRLLDAIVASL"
     gene            complement(346709..346984)
                     /locus_tag="TCCBUS3UF1_3230"
                     /db_xref="GeneID:12251678"
     CDS             complement(346709..346984)
                     /locus_tag="TCCBUS3UF1_3230"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653445.1"
                     /db_xref="GI:384438721"
                     /db_xref="GeneID:12251678"
                     /translation="MWFRKDPHVKPEGPMAFRVRVRTRSGEVVELRLSKSMEISPIEG
                     GYYVRKEIVAPRSLDRAVLEIWFDRGYRPVRKAVEGGELIPIREWNG"
     gene            complement(346986..347462)
                     /locus_tag="TCCBUS3UF1_3240"
                     /db_xref="GeneID:12251679"
     CDS             complement(346986..347462)
                     /locus_tag="TCCBUS3UF1_3240"
                     /note="similar to YbaK/prolyl-tRNA synthetase associated
                     region of Bacteria UniRef RepID=B8DKC0_DESVM"
                     /codon_start=1
                     /transl_table=11
                     /product="YbaK/prolyl-tRNA synthetase associated
                     domain-containing protein"
                     /protein_id="YP_005653446.1"
                     /db_xref="GI:384438722"
                     /db_xref="GeneID:12251679"
                     /translation="MSLSPAATRVQRALEEGGFGHLRVEELPVSTRTAAEAAQAVGAE
                     VGQIVKSLVFVGEKGGYLFLVSGKNRLDPGKAAALAGEPLRRASPEEVRALTGFAIGG
                     VPPLGHPTPLPTFLDQELLGYGVVWAAAGTPRALFRTRPEELLALTGAKVADLKEG"
     misc_feature    complement(347001..347444)
                     /locus_tag="TCCBUS3UF1_3240"
                     /note="This CD, composed mainly of bacterial single-domain
                     proteins, includes the Thermus thermophilus (Tt) YbaK-like
                     protein, a homolog of the trans-acting Escherichia coli
                     YbaK Cys-tRNA(Pro) deacylase and the Agrobacterium
                     tumefaciens  ProX Ala-tRNA(Pro)...; Region:
                     ProX_deacylase; cd04333"
                     /db_xref="CDD:239825"
     misc_feature    complement(order(347076..347078,347157..347162,
                     347313..347315))
                     /locus_tag="TCCBUS3UF1_3240"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239825"
     gene            complement(347459..348574)
                     /locus_tag="TCCBUS3UF1_3250"
                     /db_xref="GeneID:12251680"
     CDS             complement(347459..348574)
                     /locus_tag="TCCBUS3UF1_3250"
                     /note="similar to hypothetical protein PRK07338;
                     similar to Carboxypeptidase G2 of Thermaceae UniRef
                     RepID=Q72HZ8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Carboxypeptidase G2"
                     /protein_id="YP_005653447.1"
                     /db_xref="GI:384438723"
                     /db_xref="GeneID:12251680"
                     /translation="METLEWMKARLPEFLRDLEAFVRRESPSGDLKGLEEAAAFLEKA
                     FAPLKGRLSRKDTPAGPILLLKREGEGEPVLVLCHYDTVHPKGSFPEPFRLERDRAVG
                     PGVYDMKGGILALLYALRHAEATGRRLPPLEILFTPDEETGSRESRPLIEAAAKKARA
                     ALVLEPPTLEGDLKVARKGVGLYRLKALGKAAHQGVEPEKGVNAILELAHQIPKVAAL
                     EDRDKGTTLGPNVLRGGTVSNVVAEEAWVEIDLRAWTLEEARRVEEALRALSPALPGA
                     RLELTGGLNRPPMEPTPESLSLFHKAQAIGEALGLALRPGRVGGGSDGNFTAALGVPT
                     LDGLGLLGGDAHQRTEYVVVSEIPRRVALLAELLYAL"
     misc_feature    complement(347492..348574)
                     /locus_tag="TCCBUS3UF1_3250"
                     /note="Acetylornithine
                     deacetylase/Succinyl-diaminopimelate desuccinylase and
                     related deacylases [Amino acid transport and metabolism];
                     Region: ArgE; COG0624"
                     /db_xref="CDD:223697"
     misc_feature    complement(347492..348535)
                     /locus_tag="TCCBUS3UF1_3250"
                     /note="M20 Peptidase Glutamate carboxypeptidase, a
                     periplasmic enzyme; Region: M20_CPDG2; cd03885"
                     /db_xref="CDD:193506"
     misc_feature    complement(order(347537..347539,348080..348082,
                     348152..348157,348254..348256,348338..348340))
                     /locus_tag="TCCBUS3UF1_3250"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193506"
     misc_feature    complement(order(347819..347821,347825..347827,
                     347849..347851,347855..347863,347870..347893,
                     347936..347941,347945..347950,347960..347962,
                     347966..347968,347987..347995))
                     /locus_tag="TCCBUS3UF1_3250"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193506"
     gene            348686..350371
                     /locus_tag="TCCBUS3UF1_3260"
                     /db_xref="GeneID:12251681"
     CDS             348686..350371
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="similar to 30S ribosomal protein S1 PRK06299;
                     similar to RNA binding S1 domain protein of Deinococci
                     UniRef RepID=D7BGQ8_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA binding S1 domain-containing protein"
                     /protein_id="YP_005653448.1"
                     /db_xref="GI:384438724"
                     /db_xref="GeneID:12251681"
                     /translation="MRVLPLLFVWTRAKSARLPQGEARKEERGGMEEKATQTPEKTFS
                     MEEALQETEARLEKRVRPGQVLTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTEKVLPE
                     EELKGLLKPGDEVRVQVLRVDPETGQILLSRKKVEATEHWDHIQALYERGEPVTVTVK
                     EKVKGGVVAELDGVQAFIPASQLDLRRTPNLDEYVGQQILAKIIEFHRKKGRVLLSRR
                     AVLEEEQKRAKEAFFQSLKPGQVVEGAVVDVTDFGAFVNLGPVDGLVHRSEITWGRFG
                     HPKEVIHKGQRVRAQVVSVDPAKERVNLSIKALIPDPWTTVAEKYPVGTRVKGKVVGL
                     TPFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVLRLDPGERRLSLG
                     LKQTQPDPWQLLVEKYPPGTVVKGRVTGVTDFGVFVELEPGMEGLVHVSELDHQRVDN
                     PAAHFKKGEEMEVVVLNIDPVEQRISLSRKRLLPPPPPKAEEERPRRAKGKEARSKRK
                     PTPRREERREYEYGAVAEYNLYDASAVPTASTSVKLGDLYGDLLASLGLEEEK"
     misc_feature    348776..350119
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="30S ribosomal protein S1; Provisional; Region:
                     rpsA; PRK13806"
                     /db_xref="CDD:237516"
     misc_feature    348872..349087
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec1_hs1;
                     cd05687"
                     /db_xref="CDD:240192"
     misc_feature    order(348896..348898,348920..348922,348950..348952,
                     348956..348958)
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240192"
     misc_feature    349139..349339
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture...; Region: S1_RPS1_repeat_ec2_hs2;
                     cd04465"
                     /db_xref="CDD:239911"
     misc_feature    order(349163..349165,349187..349189,349214..349216,
                     349220..349222)
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239911"
     misc_feature    349397..349600
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1)
                     domain. RPS1 is a component of the small ribosomal subunit
                     thought to be involved in the recognition and binding of
                     mRNA's during translation initiation. The bacterial RPS1
                     domain architecture consists...; Region:
                     S1_RPS1_repeat_ec3; cd05688"
                     /db_xref="CDD:240193"
     misc_feature    order(349424..349426,349448..349450,349475..349477,
                     349481..349483)
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240193"
     misc_feature    349655..349861
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(349679..349681,349703..349705,349733..349735,
                     349739..349741)
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    349916..350116
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    order(349940..349942,349964..349966,349994..349996,
                     350000..350002)
                     /locus_tag="TCCBUS3UF1_3260"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            complement(350415..351677)
                     /locus_tag="TCCBUS3UF1_3270"
                     /db_xref="GeneID:12251682"
     CDS             complement(350415..351677)
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="similar to Cytochrome b subunit of the bc complex
                     COG1290;
                     similar to Quinol-cytochrome c reductase, cytochrome b
                     subunit of Thermus UniRef RepID=Q5SH00_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Quinol-cytochrome c reductase, cytochrome b
                     subunit"
                     /protein_id="YP_005653449.1"
                     /db_xref="GI:384438725"
                     /db_xref="GeneID:12251682"
                     /translation="MYKWLDERLDLTGLYHKVLRKAFPVHHSFFLGEITLFAFIVLVL
                     TGVFLTLNFEPSIREVKLPDGRTVPAAYASVLYIDSLPFGAVIRSLHHWSAHVMIAAA
                     FLHMLRILLSGAYKKPRELNYLVGLALLGLAVVTAFTGYALPYDNYAVTATRIGYGIA
                     TSIPWIGTTLAQVMFGGEFPGSAQSIPRLYSLHVLWLPLLLLALIGGHLAIMMKQKHT
                     QPRYAEKVAPGKILGVPMYPQQLVMMGILFALYVGIMAIIAGAFLAHPIEAFGPPTPN
                     TPAVKPDWYFLWIYGILQIIPSSWEFHLFGAIIGPEFIGGVVVPGILALIALLLPFVD
                     TQKDKMRYLELPSEHPVRTSVILALLVFFLMSTLAGYKIDFQQQGSLLGNNAVLWTLV
                     LGGPLLTFLVSYTLMRIFYGKRAEKALE"
     misc_feature    complement(350562..351677)
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="Cytochrome b subunit of the bc complex [Energy
                     production and conversion]; Region: QcrB; COG1290"
                     /db_xref="CDD:224209"
     misc_feature    complement(351105..351677)
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     misc_feature    complement(order(351288..351293,351297..351302,
                     351309..351314,351354..351356,351360..351365,
                     351372..351374,351384..351386,351570..351575,
                     351579..351584))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(351186..351188,351210..351215,
                     351225..351245,351255..351257,351285..351290,
                     351297..351299,351306..351311,351318..351323,
                     351333..351350,351369..351371,351378..351383,
                     351387..351392,351396..351401,351408..351413,
                     351420..351422,351462..351464,351567..351569,
                     351576..351581))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(351246..351251,351255..351260,
                     351267..351272,351393..351395,351402..351407,
                     351414..351416,351453..351455,351519..351521,
                     351528..351533,351537..351542,351549..351554,
                     351561..351563))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(351324..351326,351408..351410,
                     351417..351425,351429..351443,351447..351452,
                     351459..351464,351522..351527,351534..351536,
                     351546..351548))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(order(351111..351113,351198..351200,
                     351210..351215,351222..351224,351261..351266,
                     351273..351278,351285..351287))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    complement(<350784..350939)
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="Cytochrome b(C-terminus)/b6/petD:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: cytochrome_b_C;
                     cl00193"
                     /db_xref="CDD:260248"
     misc_feature    complement(order(350823..350834,350838..350840,
                     350844..350852,350853..350867,350871..350876,
                     350883..350885,350898..350900,350907..350915,
                     350919..350924,350934..350936))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    complement(order(350808..350813,350820..350822,
                     350829..350834,350838..350840))
                     /locus_tag="TCCBUS3UF1_3270"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     gene            complement(351687..352316)
                     /locus_tag="TCCBUS3UF1_3280"
                     /db_xref="GeneID:12251683"
     CDS             complement(351687..352316)
                     /locus_tag="TCCBUS3UF1_3280"
                     /note="similar to Rieske Fe-S protein COG0723;
                     similar to Quinol-cytochrome c reductase, Rieske
                     iron-sulfur subunit of Thermus UniRef RepID=Q5SGZ9_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Quinol-cytochrome c reductase, Rieske
                     iron-sulfur subunit"
                     /protein_id="YP_005653450.1"
                     /db_xref="GI:384438726"
                     /db_xref="GeneID:12251683"
                     /translation="MDEREIRLRTSRRRLFLKTAIGTGIGLSLVSAFYVGASLRPKAE
                     VTPEKEPLKPGDLLVYAQGGGEPKPIRLEDLKPGDPFVLAYPMDPKTKVVKSGEAKNT
                     VLVVRYAPEALSPEVAQHAVEGIVAFSAVCTHLGCIVSQWVADKQAGLCPCHGGTFDF
                     AHGAKVVAGPPPRPVPQLPLKVENGVLVAAGEFLGEIGVKASAGQCRQV"
     misc_feature    complement(351810..352313)
                     /locus_tag="TCCBUS3UF1_3280"
                     /note="Rieske Fe-S protein [Energy production and
                     conversion]; Region: QcrA; COG0723"
                     /db_xref="CDD:223795"
     misc_feature    complement(<351810..352052)
                     /locus_tag="TCCBUS3UF1_3280"
                     /note="Rieske domain; a [2Fe-2S] cluster binding domain
                     commonly found in Rieske non-heme iron oxygenase (RO)
                     systems such as naphthalene and biphenyl dioxygenases, as
                     well as in plant/cyanobacterial chloroplast b6f and
                     mitochondrial cytochrome bc(1) complexes; Region: Rieske;
                     cl00938"
                     /db_xref="CDD:260709"
     misc_feature    complement(order(351843..351845,351849..351851,
                     351855..351860,351864..351866,351912..351917,
                     351921..351923))
                     /locus_tag="TCCBUS3UF1_3280"
                     /note="iron-sulfur cluster [ion binding]; other site"
                     /db_xref="CDD:239550"
     misc_feature    complement(order(351849..351851,351855..351857,
                     351864..351866,351912..351917,351921..351923))
                     /locus_tag="TCCBUS3UF1_3280"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239550"
     gene            complement(352328..352810)
                     /locus_tag="TCCBUS3UF1_3290"
                     /db_xref="GeneID:12251684"
     CDS             complement(352328..352810)
                     /locus_tag="TCCBUS3UF1_3290"
                     /note="similar to Probable c-type cytochrome of Thermus
                     UniRef RepID=Q5SGZ8_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="c-type cytochrome"
                     /protein_id="YP_005653451.1"
                     /db_xref="GI:384438727"
                     /db_xref="GeneID:12251684"
                     /translation="MYRNDPIIPTFALILALGLFYTAYLDGLHIARLLGHTPEELSVG
                     QIGLMAFGAVLLLYGLIGLVSYWLEGIELRPGRHFPTPSTAPVAAGVILVLLLTALSG
                     FFVRLLVYSAQSGHNPTWLQGLIFGAISLVVAALLGVYKKFFGRDEAITEEEKSQFPW
                     "
     gene            complement(352820..353548)
                     /locus_tag="TCCBUS3UF1_3300"
                     /db_xref="GeneID:12251685"
     CDS             complement(352820..353548)
                     /locus_tag="TCCBUS3UF1_3300"
                     /note="similar to Cytochrome c of Thermus UniRef
                     RepID=Q72HC5_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="YP_005653452.1"
                     /db_xref="GI:384438728"
                     /db_xref="GeneID:12251685"
                     /translation="MVVDRIEVYLDGAAEPLAVLKEPPYRLNLDTKKLPDGEHTLRVV
                     THFRGGGQEIREIPFTVNNYPDILVLGLDEGGEVAGQVELRLAVGEPELPVEPIRFNP
                     LWYVVASVVVLGGIWSYFALSPAAEKIVAEVAPPAQESQAHGATGAQPAANVDPALLE
                     KGKAVYEAHCAACHQANGQGMPPAMPALAGNANLKDAQMILNIVKNGRGAMPPVGAAF
                     SEEEVKAVATYIRNSFGNSFGPVE"
     misc_feature    complement(352826..353212)
                     /locus_tag="TCCBUS3UF1_3300"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    complement(352859..353080)
                     /locus_tag="TCCBUS3UF1_3300"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            complement(353632..354399)
                     /locus_tag="TCCBUS3UF1_3310"
                     /db_xref="GeneID:12251686"
     CDS             complement(353632..354399)
                     /locus_tag="TCCBUS3UF1_3310"
                     /note="similar to L-xylulose 5-phosphate 3-epimerase
                     PRK13209;
                     similar to Xylose isomerase domain protein TIM barrel of
                     Meiothermus silvanus DSM 9946 UniRef RepID=D7B9X5_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_005653453.1"
                     /db_xref="GI:384438729"
                     /db_xref="GeneID:12251686"
                     /translation="MRLGFSPFNAELGYEEAFRLAAQLGMDLEVAYDLHEALPLPDPR
                     ALRATGEALGVGFTLHLPFVEMNPASLIPAVRQLSEDRLKRALEFGEALGAKVGVLHT
                     GQVPVRHPMALDLAREALEKTLAALLPLPFPIALENLALAEEDLIRGPEELQALLDRF
                     PQYGFCLDVGHALVELGPRGPFLYLEALSPRLLHLHLHDNHGRKDDHLPVGAGALPWE
                     KLAPHLQGFAGTAALEVGGGMEGVGRSRERLLRLLAP"
     misc_feature    complement(353740..354399)
                     /locus_tag="TCCBUS3UF1_3310"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    complement(353761..354348)
                     /locus_tag="TCCBUS3UF1_3310"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            complement(354412..355608)
                     /locus_tag="TCCBUS3UF1_3320"
                     /db_xref="GeneID:12251687"
     CDS             complement(354412..355608)
                     /locus_tag="TCCBUS3UF1_3320"
                     /note="similar to ABC-type sugar transport system,
                     periplasmic component COG1653;
                     similar to Glycerol-3-phosphate-binding protein of
                     Thermaceae UniRef RepID=Q72HC2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653454.1"
                     /db_xref="GI:384438730"
                     /db_xref="GeneID:12251687"
                     /translation="MKKLLALALLLLPVLAQTEVSFWHSMDGPAGRLLSAFAQEFNAR
                     QGLYRVLPQYVGDYRDAETKLVAALRTGAQPVLFQAEISFFPRLVGEGRALALDPYLN
                     LDRAFLEDLFEPAWNYGLMEGRRYGLPLNTSTPVLFYNLDALRAKGLKAPRNWKEFEE
                     VAKALTSRQAKGFIFVTDPQAWLFEAMATSRGGSLVREGRPNFLSKEVVEALEMLWRM
                     NRAGLLSVRSMAESTFAQLDFVRTKGMMVMASIANWPAAENFSFAFTLGVAPVPRETG
                     GKVPLGGAQLVVLRGASEAQVRGALDFWRYLMEPSNVARWVEASYYVPVRKSAAPLLE
                     GFYRENPFRKVAFEQIAVAQERPRLPQFSAWASLLAEALEKSLKGGMAPQRALEEAQR
                     KAEAIR"
     misc_feature    complement(354415..355557)
                     /locus_tag="TCCBUS3UF1_3320"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     misc_feature    complement(354418..355557)
                     /locus_tag="TCCBUS3UF1_3320"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     gene            complement(355654..356844)
                     /locus_tag="TCCBUS3UF1_3330"
                     /db_xref="GeneID:12251688"
     CDS             complement(355654..356844)
                     /locus_tag="TCCBUS3UF1_3330"
                     /note="similar to ABC-type sugar transport system,
                     periplasmic component COG1653;
                     similar to Sugar-binding protein of Thermus UniRef
                     RepID=Q72HH3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653455.1"
                     /db_xref="GI:384438731"
                     /db_xref="GeneID:12251688"
                     /translation="MRRPFLAALPFFLLAQAQVTLPFWHTAGPPGNTVLEEAIRTFNE
                     GQRAYRIEARYVGDYREAGVKLLAALRSGGAPVLFHGELSFLPRLAQEGAALSLDPYL
                     NGLPRDLYPEMLRTVQVKGKTFGLPLGLSVPVLYYNKDAFRARGLRPPSTWAEVEEAA
                     AKLTSRTSKGLVVSTDIWSFNALVMSLGGSLVKDGLPAFTSKEVVEALEMLHRMVQRG
                     HAQPRNLAEAQFAVADFLRTKAFMGLGPTTALPVVLSQTSLPFAVGMAPVPRREGGAV
                     PLSGAALAVLKGASPEQARGAVAFWLHFLDPKRQAAWVRTTWYLPLRREAERELGEFL
                     KDPERQGVFAQAEIGRPWSQDPEMVVWYGFLEEALERSLKQGVKPQVALEEAQRKALA
                     VERR"
     misc_feature    complement(355657..356829)
                     /locus_tag="TCCBUS3UF1_3330"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    complement(355834..356823)
                     /locus_tag="TCCBUS3UF1_3330"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            complement(356855..357631)
                     /locus_tag="TCCBUS3UF1_3340"
                     /db_xref="GeneID:12251689"
     CDS             complement(356855..357631)
                     /locus_tag="TCCBUS3UF1_3340"
                     /note="similar to PhaN of Thermus UniRef
                     RepID=Q72HH2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653456.1"
                     /db_xref="GI:384438732"
                     /db_xref="GeneID:12251689"
                     /translation="MRARSTIFTLFLEYAYPERRAPVRDLVAMMEALGFSEAAVRAAL
                     SRSAKRGWVVAERRGRTAYYALSDRVYWQVRQVRRRLYEPVAPWDGRFLLVLPEGPKE
                     RGERERFRREMALLGYGSLQSGIYLGAGVDLEATKELLGFYGLTATLFRAEHLGSPEE
                     VRKAFPLAQAEAHYRTLFPQEVPENPLLAFQALTRLVHGMRKVLFLDPLLPPELLPPG
                     YPGLAARERFFALRQALYARAEPFLKGFHLPLAALSPGAR"
     misc_feature    complement(356861..357628)
                     /locus_tag="TCCBUS3UF1_3340"
                     /note="Phenylacetic acid-responsive transcriptional
                     repressor [Transcription]; Region: PaaX; COG3327"
                     /db_xref="CDD:225864"
     misc_feature    complement(357422..357628)
                     /locus_tag="TCCBUS3UF1_3340"
                     /note="PaaX-like protein; Region: PaaX; pfam07848"
                     /db_xref="CDD:191871"
     misc_feature    complement(356918..357376)
                     /locus_tag="TCCBUS3UF1_3340"
                     /note="PaaX-like protein C-terminal domain; Region:
                     PaaX_C; pfam08223"
                     /db_xref="CDD:254671"
     gene            complement(357631..359619)
                     /locus_tag="TCCBUS3UF1_3350"
                     /db_xref="GeneID:12251690"
     CDS             complement(357631..359619)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="similar to threonyl-tRNA synthetase PRK14801;
                     similar to Threonyl-tRNA synthetase of Meiothermus UniRef
                     RepID=D3PR72_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Threonyl-tRNA synthetase"
                     /protein_id="YP_005653457.1"
                     /db_xref="GI:384438733"
                     /db_xref="GeneID:12251690"
                     /translation="MKGMTVYLPDGKALEVQEGATARDVAQALGPRLAQKAVGAIVNG
                     ELYDLLKPLPPGASVRILTEEDPEYQTLFRHTLAHVLAQAVKEHFQEKGYDPESVKLG
                     VGPVIEKGFYYDIDAPEPLSDEDLPALEARMRAILAKDLPLRRYTLSREAALARYQGK
                     DPYKAELIQELPEGEEISFYQQGDEAYGFTDLCRGPHVPSTGRIPPHFRLTHVAGAYW
                     RGDERRPMLQRVYGVAFRTAEELKAYLWQLEEAKRRDHRRLGRELELFLIDPMVGKGL
                     VLWLPKGNTIREELIAFMREEQLRRGYQLVTTPHIGGLELYKTSGHYPYYAESQFPPM
                     RLEDREGSEEYLLKPMNCPHHIRIYAHKKRSYRELPLRIAEFGTVYRYEKAGELLGLT
                     RVRGFTQDDAHLFCTPEQVKEEFLGVLDLVLKVFATLGLKGFRARIGVRDPQSSKYVG
                     EEAKWALAERQIEEAAQEAGLDYTLEEGDAAFYGPKLDFVVKDALGREWQLGTIQVDY
                     NLPERFQLTYVGKDGEEHRPVMIHRAPFGSLERFIGILIEHFAGDFPLWLSPVQAVVV
                     PVSEKQEDYAKEVVERLKEAGLRAEGDLRPERMQARIRDAEVQKVPYILVVGERERAE
                     GTVSVRRRHRGNLGTMPLATFLEGALREYRERKLEPVF"
     misc_feature    complement(357643..359610)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK00413"
                     /db_xref="CDD:234752"
     misc_feature    complement(359431..359610)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="TGS _ThrRS_N:  ThrRS (threonyl-tRNA Synthetase)  is
                     a class II tRNA synthetase that couples threonine to its
                     cognate tRNA.  In addition to its catalytic and
                     anticodon-binding domains, ThrRS has an N-terminal TGS
                     domain, named after the ThrRS, GTPase, and...; Region:
                     TGS_ThrRS_N; cd01667"
                     /db_xref="CDD:133437"
     misc_feature    complement(358930..359091)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; smart00863"
                     /db_xref="CDD:197931"
     misc_feature    complement(357940..358857)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    complement(order(357997..357999,358006..358011,
                     358105..358107,358117..358122,358129..358131,
                     358423..358425,358429..358431,358438..358446,
                     358459..358467,358471..358473,358477..358479,
                     358573..358575,358630..358635,358642..358644,
                     358654..358656,358807..358809,358846..358848))
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    complement(order(358057..358059,358063..358065,
                     358210..358218,358351..358353,358432..358437,
                     358465..358467,358474..358476,358480..358482,
                     358519..358527,358531..358539,358546..358551,
                     358585..358587,358591..358602,358621..358629,
                     358681..358683,358687..358695,358699..358701,
                     358705..358710,358720..358725,358768..358770,
                     358777..358779,358783..358788,358792..358794,
                     358798..358800,358804..358812,358816..358818,
                     358834..358836))
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(358687..358710)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(358471..358482)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(357997..358011)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(357679..357942)
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    complement(order(357730..357732,357736..357738,
                     357766..357768,357790..357792,357808..357810,
                     357913..357918))
                     /locus_tag="TCCBUS3UF1_3350"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            complement(359629..360852)
                     /locus_tag="TCCBUS3UF1_3360"
                     /db_xref="GeneID:12251691"
     CDS             complement(359629..360852)
                     /locus_tag="TCCBUS3UF1_3360"
                     /note="similar to hypothetical protein PRK12382;
                     similar to Major facilitator superfamily MFS_1 of Thermus
                     UniRef RepID=B7A9D2_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator superfamily MFS_1"
                     /protein_id="YP_005653458.1"
                     /db_xref="GI:384438734"
                     /db_xref="GeneID:12251691"
                     /translation="MWKGPREGRRSILPILDLRERNYRLAVVNGWLVWLGDTFLNPNI
                     VLSGFAAKLGAPGALIGLLPALLQAGGMIPQAFLAPYVARFPRKIVLYRQVAALRLLG
                     VVLMALSAFLLGAWPHLLLMGFLTGLLLNALFTGVSSLPFWEVVAKTTPKERRAALFS
                     ARNLVGGLLAFLAGFLVRGILALPLPFPLPYALLFALGALAFGTGWYLFGLTAEPAEA
                     PKEERIDLLLPLRSPGFRRFLRVRILLGLAGMAEPFYAVYAVRALGHGEELGLYLSLY
                     ALAFTLSNLLWARLAERGSKGVLLRGAGLACMAPLLALLLPPGLYGAVFLLQGTYLAA
                     LNLATTTYLLNLAPPEERSAFIGLGNTVAGVFAFATVLGGWVADALGFSALFLLAAAL
                     YALALWAGRKLPREG"
     misc_feature    complement(359758..360765)
                     /locus_tag="TCCBUS3UF1_3360"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(359704..360726)
                     /locus_tag="TCCBUS3UF1_3360"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(359752..359754,359761..359766,
                     359773..359778,359785..359790,359821..359823,
                     359830..359835,359845..359847,359854..359859,
                     359866..359868,360001..360003,360013..360015,
                     360022..360024,360034..360036,360046..360048,
                     360073..360075,360082..360087,360094..360099,
                     360106..360108,360343..360345,360361..360366,
                     360373..360378,360412..360414,360421..360426,
                     360433..360438,360445..360450,360616..360621,
                     360625..360630,360640..360642,360649..360654,
                     360661..360663,360712..360717,360721..360726))
                     /locus_tag="TCCBUS3UF1_3360"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            360818..361780
                     /locus_tag="TCCBUS3UF1_3370"
                     /db_xref="GeneID:12251692"
     CDS             360818..361780
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653459.1"
                     /db_xref="GI:384438735"
                     /db_xref="GeneID:12251692"
                     /translation="MLLLPSLGPFHILHPRYNAATVLALLDEARPPVLYLASLSEEAL
                     REGVWREEDPLLFHLLPWAEARGVPVVALDAEAHLKGEAEAFREALVQHPLGAPYLER
                     MQALDQELLGLLRTPLTPEVLGGEAFLARLQALYRAFAAAFGEGPATGFRQRRMAQVA
                     EALRGKEGAVVADLLDYALLAEAFPQALPQAHTPTEGERERALLDRAWQLREEDDWAG
                     LLEGLFAIGSPEALYLAAQVYLAAGEWREALALMEEVLRMDFHHPGYLPGYVLARFGQ
                     LLDLAGERERALRAYRGALALSWIPEEARAIALAGLRTPFRLGG"
     misc_feature    361082..>361351
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    361499..361711
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    <361499..361708
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(361514..361519,361523..361528,361535..361540,
                     361631..361636,361643..361648,361655..361660)
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(361523..361525,361559..361561,361571..361573,
                     361580..361582,361640..361642,361676..361678,
                     361688..361690,361697..361699)
                     /locus_tag="TCCBUS3UF1_3370"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            361828..362301
                     /locus_tag="TCCBUS3UF1_3380"
                     /db_xref="GeneID:12251693"
     CDS             361828..362301
                     /locus_tag="TCCBUS3UF1_3380"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653460.1"
                     /db_xref="GI:384438736"
                     /db_xref="GeneID:12251693"
                     /translation="MEVEVRRARHALYLRLAAVHAGPLGPALLGHPELAPLYPKAYAA
                     CGGAEGLACAGVGGEPRVCVVRRLAHLAKSALRGGRRRREQEKAMVEGLLLCMAHLQR
                     EFPPEFSPVLQATQEALRKDLRYLRGELSPEEALKQMVHPPQDQHQGHGSRGQND"
     gene            complement(362446..363066)
                     /locus_tag="TCCBUS3UF1_3390"
                     /db_xref="GeneID:12251694"
     CDS             complement(362446..363066)
                     /locus_tag="TCCBUS3UF1_3390"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653461.1"
                     /db_xref="GI:384438737"
                     /db_xref="GeneID:12251694"
                     /translation="MPALLERLSQDLEVLSGHLRAGLDEFGTLLCYLEGGRGGRTTLL
                     HAPYEEALPVLQALNGLSFRGRLLLALDPSPLSPTREEVPLSGPTRAPLEHLLERTRP
                     DRLLLAFPGEGLGLTYPGGKETQAGWGSLEAPGAALVLHVEAPTGLTYREVRAYGPWE
                     SPPLPLDLPQGEGPYLGGVGRALGIPTYGVGLVNLRASLEALLRLW"
     gene            363090..363812
                     /locus_tag="TCCBUS3UF1_3400"
                     /db_xref="GeneID:12251695"
     CDS             363090..363812
                     /locus_tag="TCCBUS3UF1_3400"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653462.1"
                     /db_xref="GI:384438738"
                     /db_xref="GeneID:12251695"
                     /translation="MRYLVLSDIHGNWPALEAVLQAAPPVDRVLFLGDAVGYYPDGDR
                     VLDWLMEVGAECVLGNHDAWLLALDRLPVEGAVLEILAWQRDRLSPEHLAFLGSWPWQ
                     KEVEGALLVHGSPCDPLEYLDDLEPARQAFACTEARLAFHGHTHLAGAFLQLSGPRPW
                     VRYQAFRQGGELLLPPKVRALINPGSVGQPRDGVPGAAFALWEGERVEFFRVAYPLEE
                     VEARLREEGFPPWLWERLRVGE"
     misc_feature    363090..363698
                     /locus_tag="TCCBUS3UF1_3400"
                     /note="Calcineurin-like phosphoesterase superfamily
                     domain; Region: Metallophos_2; pfam12850"
                     /db_xref="CDD:257348"
     misc_feature    order(363111..363113,363117..363119,363189..363191,
                     363267..363272,363423..363425,363519..363521)
                     /locus_tag="TCCBUS3UF1_3400"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    order(363111..363113,363117..363119,363189..363191,
                     363267..363269,363423..363425,363519..363521)
                     /locus_tag="TCCBUS3UF1_3400"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            363812..364588
                     /locus_tag="TCCBUS3UF1_3410"
                     /db_xref="GeneID:12251696"
     CDS             363812..364588
                     /locus_tag="TCCBUS3UF1_3410"
                     /note="similar to DNA polymerase III subunit delta'
                     PRK07399;
                     similar to DNA polymerase III delta prime subunit of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A9D8_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="YP_005653463.1"
                     /db_xref="GI:384438739"
                     /db_xref="GeneID:12251696"
                     /translation="MGHEAILELLPRIRASTLLFSGPEGVGRRLVARWYALGLNRGFP
                     PPPLPEHPDLWEVAPKEGGLRGRAEVRLEEVEPLMDWFASHPRERVKVAILDAAHLLT
                     EPAANALLKLLEEPPSYGRIVLIAPSRDTLLPTLASRALEVPFGPVPEAALRSLTQDP
                     GLLAYAAGAPGRLKRALAEPERFRERLDKAAALGKAAPLARLSLLKELLAEEEGFFAL
                     YAAWRHRPEALLALEAAREALEAYVNPELVLARLALDLET"
     misc_feature    363863..364327
                     /locus_tag="TCCBUS3UF1_3410"
                     /note="DNA polymerase III, delta' subunit; Region: holB;
                     TIGR00678"
                     /db_xref="CDD:233087"
     misc_feature    <364085..>364228
                     /locus_tag="TCCBUS3UF1_3410"
                     /note="DNA polymerase III subunit delta'; Validated;
                     Region: PRK08485"
                     /db_xref="CDD:236274"
     misc_feature    364145..>364531
                     /locus_tag="TCCBUS3UF1_3410"
                     /note="ATPase involved in DNA replication [DNA
                     replication, recombination, and repair]; Region: HolB;
                     COG0470"
                     /db_xref="CDD:223546"
     gene            364585..365352
                     /locus_tag="TCCBUS3UF1_3420"
                     /db_xref="GeneID:12251697"
     CDS             364585..365352
                     /locus_tag="TCCBUS3UF1_3420"
                     /note="similar to Uncharacterized homolog of PSP1 COG1774;
                     similar to PSP1-related protein of Thermus UniRef
                     RepID=Q5SH71_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653464.1"
                     /db_xref="GI:384438740"
                     /db_xref="GeneID:12251697"
                     /translation="MTVGVRFRTPVLRYFRFQGEPPPLEAFVVVRTSRGLEVGKVRTP
                     PRAEKEVGEVVRLATKEDLDKAARLRVRAEEALFYLRARLREEGVEAKILGCDFTLDG
                     RHLSVHYRAEERVNLRRFTRELSQRFDARVEFLAEGPREEAQYLGTLGACGMESCCST
                     WLQGFAQVSIKLARDQQLPLNPEKISGPCGRLLCCLAYEHPVYQELLAELPRKNARVC
                     TKEGVCGKVQKLNPLKGTVELLLEEGKVLEVSKEELA"
     misc_feature    364585..365349
                     /locus_tag="TCCBUS3UF1_3420"
                     /note="PSP1 C-terminal conserved region; Region: PSP1;
                     cl00770"
                     /db_xref="CDD:260612"
     gene            365349..365885
                     /locus_tag="TCCBUS3UF1_3430"
                     /db_xref="GeneID:12251698"
     CDS             365349..365885
                     /locus_tag="TCCBUS3UF1_3430"
                     /note="similar to Flavoredoxin of Thermus UniRef
                     RepID=Q72HI0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Flavoredoxin"
                     /protein_id="YP_005653465.1"
                     /db_xref="GI:384438741"
                     /db_xref="GeneID:12251698"
                     /translation="MRRYAPQGPLPAFYHFYPGVPAVVGVRLGERVNFCPAVWNTGLS
                     ADPPLFGVALSPKRYTHGLLLQARRFAASFHPHTQMALVHRLGSLSGREVDKGQAPHF
                     LGETGVPILEGAYAAYELELLEVHTFGDHDLFVGRVVGVWEEEALLDERGRPKPGLSL
                     LYYGRGLYGRPAEEAFAP"
     misc_feature    365397..365855
                     /locus_tag="TCCBUS3UF1_3430"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; pfam01613"
                     /db_xref="CDD:250745"
     gene            365882..366148
                     /locus_tag="TCCBUS3UF1_3440"
                     /db_xref="GeneID:12251699"
     CDS             365882..366148
                     /locus_tag="TCCBUS3UF1_3440"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653466.1"
                     /db_xref="GI:384438742"
                     /db_xref="GeneID:12251699"
                     /translation="MTQAEAFAQRVRRLALNRQGTEAQVFLPEGFLYLRADGFARFAQ
                     GPGAEVLSGFALARGELVLCFSDGSALTLRHRLGRLQRRVGYFS"
     gene            complement(366136..367059)
                     /locus_tag="TCCBUS3UF1_3450"
                     /db_xref="GeneID:12251700"
     CDS             complement(366136..367059)
                     /locus_tag="TCCBUS3UF1_3450"
                     /note="similar to Uncharacterized ABC-type transport
                     system, permease component COG1079;
                     similar to ABC transporter permease protein of Bacteria
                     UniRef RepID=Q5SH74_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005653467.1"
                     /db_xref="GI:384438743"
                     /db_xref="GeneID:12251700"
                     /translation="MNLDAAFLVALFLSTLRQTTPLLFTALGGMFSERSGVVNIALEG
                     IILFGALTAAVVVERLEAALGPGPHPWLPWVGVLAAMAVGGLVAWVHAVVSIRYRADQ
                     IISATAINLLALGAPSLVLTYFYGNATNSKEVTNRLPLWGPEGFALSPLVYLAFLLVP
                     LSWWVLFKTPFGLRLRAVGEHPEAADTLGVNVYRMRYIGVVLSGVLAGLAGAYLAIGF
                     LNQFVRGMSAGMGFIALAAMIFGKWHPLGILFSTLLFGLASALAIQLQGTEILPAVLV
                     QAFPYVVTVLVLAGFIGRSRPPSAVGKPYEK"
     misc_feature    complement(366196..367005)
                     /locus_tag="TCCBUS3UF1_3450"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(366457..366513)
                     /locus_tag="TCCBUS3UF1_3450"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(367056..368873)
                     /locus_tag="TCCBUS3UF1_3460"
                     /db_xref="GeneID:12251701"
     CDS             complement(367056..368873)
                     /locus_tag="TCCBUS3UF1_3460"
                     /note="similar to ABC-type uncharacterized transport
                     system, permease component COG4603;
                     similar to Transporter of Thermus UniRef
                     RepID=Q72HI3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="YP_005653468.1"
                     /db_xref="GI:384438744"
                     /db_xref="GeneID:12251701"
                     /translation="MGVLTDPRRLGVLVLLGGGVLLLLWYLAPWAVPHRSFGGEGLLL
                     SPFGHHLPQGNLPQGYRDGWLYPLFYASLAWLLLTLAVAWSKAGPKGLFWMGLLGLLL
                     FLLTYALFQGSVAQANALGERPILRRHSLGLGSYATLAYGLYLLLLARLFSPGGLAFL
                     VRRRGVVVPLFSLLLAALLGGVIVAVLKEPSGEVGSLREAVMLRLDLITYTYQLLFSP
                     LVNPSGFLQSLLLATPLVFTGLAVALGFRGGLFNIGAPGQLILGAIAAMLVGVYLPGP
                     RWLVLPLALLAAALAGGLWGALPGWLKARFGAHEVINTIMLNYIAASLFLFLISANEY
                     KFFGQTLHLPFKYPGYEARSYEVRPEARLPHWTELVAPGGELSFALPLAFLLGLLGYV
                     GVRRSPGHRVLSALLLGVAGYLVGGLLPGPAVAFGPDLTSVRLNGAFLLALLALFFFH
                     FYVFRTVGGYELRALGLAPKAAEYGGVLAGRKVVWVMFLAGALAGLAATHYVLGGGID
                     EYRLKQSLPYSVGFDGIAVALMGQNTPLGVGLAAWLFGILLTGGLQVNLQLGISRELV
                     AVLQALIVLFIAAGGFLPRYFTDPLRAAEVELKAEEVKR"
     misc_feature    complement(367140..368180)
                     /locus_tag="TCCBUS3UF1_3460"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(367410..367466)
                     /locus_tag="TCCBUS3UF1_3460"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            368927..369631
                     /locus_tag="TCCBUS3UF1_3470"
                     /db_xref="GeneID:12251702"
     CDS             368927..369631
                     /locus_tag="TCCBUS3UF1_3470"
                     /note="similar to ubiquinone/menaquinone biosynthesis
                     methyltransferase PRK00216;
                     similar to Menaquinone biosynthesis methyltransferase ubiE
                     of Deinococci UniRef RepID=UBIE_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Menaquinone biosynthesis methyltransferase ubiE"
                     /protein_id="YP_005653469.1"
                     /db_xref="GI:384438745"
                     /db_xref="GeneID:12251702"
                     /translation="MAALPEEKARRVQRMFSEIAPRYDLLNRLLSFGADQRWRARAVA
                     LALEGRPRRVLDLATGTGDLALLLKAKAPEAEVVGADFAPPMLEIARRKAQQRGLGVR
                     FLEADALALPFPEGHFDAVTIAFGFRNFADYPRALAELHRVLAPGGRLVLLEFPPPPK
                     GVFGLVYRVYFQRVLPFVGGLISGSFGAYRYLPESVEAFPSPEALKALMEKAGFAVRY
                     ELLTFGVAAIHLGVKP"
     misc_feature    368945..369628
                     /locus_tag="TCCBUS3UF1_3470"
                     /note="Methylase involved in ubiquinone/menaquinone
                     biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226"
                     /db_xref="CDD:225136"
     misc_feature    369083..369382
                     /locus_tag="TCCBUS3UF1_3470"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(369095..369115,369167..369172,369242..369250,
                     369293..369295)
                     /locus_tag="TCCBUS3UF1_3470"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(369628..370080)
                     /locus_tag="TCCBUS3UF1_3480"
                     /db_xref="GeneID:12251703"
     CDS             complement(369628..370080)
                     /locus_tag="TCCBUS3UF1_3480"
                     /note="similar to Protein-tyrosine-phosphatase COG0394;
                     similar to Protein-tyrosine phosphatase, low molecular
                     weight of Truepera radiovictrix DSM 17093 UniRef
                     RepID=D7CRU1_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-tyrosine phosphatase"
                     /protein_id="YP_005653470.1"
                     /db_xref="GI:384438746"
                     /db_xref="GeneID:12251703"
                     /translation="MRLLVLCTHNSARSQMAEAWLKHFARELGVALEVHSAGTEKSFV
                     KEEAQQVMAEVGLSLEGHTSKTLEEVPDPWNFDLVLTLCHEAEAACPAYPAKTARRHV
                     PFPDPTGKPLAAWREVREGLRRLARFLVERLREGDLPSEAELREAARP"
     misc_feature    complement(369688..370080)
                     /locus_tag="TCCBUS3UF1_3480"
                     /note="Low molecular weight phosphatase family; Region:
                     LMWPc; cd00115"
                     /db_xref="CDD:238063"
     misc_feature    complement(order(370039..370047,370051..370056,
                     370060..370062))
                     /locus_tag="TCCBUS3UF1_3480"
                     /note="active site"
                     /db_xref="CDD:238063"
     gene            complement(370126..371811)
                     /locus_tag="TCCBUS3UF1_3490"
                     /db_xref="GeneID:12251704"
     CDS             complement(370126..371811)
                     /locus_tag="TCCBUS3UF1_3490"
                     /note="similar to Oligoendopeptidase, pepF/M3 family of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A9E7_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Oligoendopeptidase, pepF/M3"
                     /protein_id="YP_005653471.1"
                     /db_xref="GI:384438747"
                     /db_xref="GeneID:12251704"
                     /translation="METTWDLTPLFPSLESPEFQGAWEDLRRQIAHLKGLLEGETPLD
                     EVLAALDALAEKTTPLSAYLYARFSANTEDEAALAKLSELEMLLLDYERLRPRLTRYL
                     ALQEPEEAGPYRILVEEARWEALHLMPEGEEVLSAELSLSGRQAWAKLHENLTSQITA
                     TVDGEELPITQVRNLYFRPEEAVRKKAYEAELRAWERHEVPLAYALNGVKGEAGVLNR
                     RRGYRDDLEPTLAQNRITRKALWAMQEAVRESLPLFRRYYLLKARALGKERLDWWDLF
                     APLGKGRRWTLEEARGFLREKLAALAPNAAKVAEAAFAERWMDLLPRKGKVGGAYCMP
                     RGGGKSLILANYEESFEAVSTLAHELGHAYHNFALARVPASLRHVPMTLAETASIMNE
                     TLVVEAALQEASAEEGLEILDAYLQGAAQVVVDIHSRFLFESWVFAKRKERELSPREF
                     KALMLKAQEEAYGEALATRHPYMWAVKGHYYGADFYNYPYTFGLLFGLAVYGQAKEDP
                     AFATRYEDLLAASGLYPAKELAARFGFDLESVDFWRKGLKVLGEKVEALEARL"
     misc_feature    complement(370138..371802)
                     /locus_tag="TCCBUS3UF1_3490"
                     /note="oligoendopeptidase, pepF/M3 family; Region:
                     M3_fam_3; TIGR02290"
                     /db_xref="CDD:233812"
     misc_feature    complement(370147..371799)
                     /locus_tag="TCCBUS3UF1_3490"
                     /note="Peptidase Gluzincin family (thermolysin-like
                     proteinases, TLPs) includes peptidases M1, M2, M3, M4,
                     M13, M32 and M36 (fungalysins); Region: GluZincin;
                     cl14813"
                     /db_xref="CDD:265459"
     misc_feature    complement(order(370657..370659,370729..370731,
                     370741..370743))
                     /locus_tag="TCCBUS3UF1_3490"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189001"
     gene            371844..372269
                     /locus_tag="TCCBUS3UF1_3500"
                     /db_xref="GeneID:12251705"
     CDS             371844..372269
                     /locus_tag="TCCBUS3UF1_3500"
                     /note="similar to Predicted thioesterase COG0824;
                     similar to Esterase of Thermus thermophilus UniRef
                     RepID=Q72HJ3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Esterase"
                     /protein_id="YP_005653472.1"
                     /db_xref="GI:384438748"
                     /db_xref="GeneID:12251705"
                     /translation="MVSLEAMEGFPVSLPVQVRFCDLDALGHVNNAVYLTYFELARTA
                     YFARLERDWIARGHFILARAEVDFKRPIHLEDPVEVGVRVVRLGRSSFEMEYQVVAGG
                     EVAATGRTVQVWLEEGRPAPLPEAIRARIQALEGRPLAP"
     misc_feature    371880..372188
                     /locus_tag="TCCBUS3UF1_3500"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    order(371958..371960,372018..372020,372024..372026,
                     372105..372116)
                     /locus_tag="TCCBUS3UF1_3500"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(372258..374489)
                     /locus_tag="TCCBUS3UF1_3510"
                     /db_xref="GeneID:12251706"
     CDS             complement(372258..374489)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="similar to recombination and DNA strand exchange
                     inhibitor protein PRK00409;
                     similar to MutS2 protein of Thermus thermophilus UniRef
                     RepID=Q5SHT5_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653473.1"
                     /db_xref="GI:384438749"
                     /db_xref="GeneID:12251706"
                     /translation="MRDVLEVLEFPRVRALLAERAQTPLGRELALGLGPLSREEAETR
                     HQLTQEAQSYPYALPPAGELREAYRKALAGGRLSGPELLRAAQALEGAMALKAELLPL
                     ENALSRVAEGIGDHAPFLGRVRKALDEEGAVKDEASPRLLAIRRELKPLRQEILDRLY
                     ALMDRQREAFQDRFVAFKRERYCVPVKAGMAHKVPGILLDESESGATLFVEPLSVVKL
                     NNRLQALRLQEEEEVGRILRELSERLAQDPGVPGTLEALGLLDLVQAQAALAKDLSLT
                     RPRFGEAYRLQGAFHPLIPHPVRNTFTLDEKTRLILISGPNMGGKTALLKTLGLAVLM
                     AQSGLFVGAERALLAWPDRVFADIGDEQSLQENLSTFAGHLQRLKAMLLEATAQSLVL
                     IDELGSGTDPEEGAALSQAILEALLERGVKGMVTTHLSPLKAFAQGGEGIQNASMRFD
                     LERLRPTYELVLGVPGRSYALAIARRLSLPEEVLRRAEALQGGNRLEDLLERLEGERL
                     AMEEERRRLAAELAQAEALRARLEAREARYQEERAERLRALEEEVRGRLLQVEAELKA
                     LKEKARSEGKRDALRELMALKEKYAKKAPPPPPPPGLSPGALVEVPSLGKRGRVVELR
                     GEEALVQVGPVKLNLKAKELKPLPGEEAPKPLLAKPRREAKEVDLRGLTVEEALLEVD
                     DALEEAKALGLSTLRLLHGKGTGALRQAIREFLRRDKRVEGFADAPPHEGGHGVTVVA
                     LRG"
     misc_feature    complement(372264..374489)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="recombination and DNA strand exchange inhibitor
                     protein; Reviewed; Region: PRK00409"
                     /db_xref="CDD:234750"
     misc_feature    complement(373695..374432)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="MutS domain III; Region: MutS_III; pfam05192"
                     /db_xref="CDD:253074"
     misc_feature    complement(373053..373637)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(373524..373547)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(373206..373208,373305..373310,
                     373413..373415,373521..373529,373533..373538))
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(373413..373424)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(373359..373400)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(373305..373322)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(373287..373298)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(373200..373220)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(372264..372491)
                     /locus_tag="TCCBUS3UF1_3510"
                     /note="Smr domain; Region: Smr; pfam01713"
                     /db_xref="CDD:250812"
     gene            complement(374515..374850)
                     /locus_tag="TCCBUS3UF1_3520"
                     /db_xref="GeneID:12251707"
     CDS             complement(374515..374850)
                     /locus_tag="TCCBUS3UF1_3520"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653474.1"
                     /db_xref="GI:384438750"
                     /db_xref="GeneID:12251707"
                     /translation="MRLKRFSGRVRRVVKGTGQQATEKLWQLAEDLRGEDPKAPRFRE
                     RLLTLAQLAKERWENLSPEERQRLFHLLKGLVLLLPLGRLGRLGSLLKRAASLGDPDL
                     LALLLRLKR"
     gene            complement(374858..376570)
                     /locus_tag="TCCBUS3UF1_3530"
                     /db_xref="GeneID:12251708"
     CDS             complement(374858..376570)
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="similar to maltodextrin glucosidase PRK10785;
                     similar to Maltodextrin glucosidase of Thermus UniRef
                     RepID=Q72I49_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="maltodextrin glucosidase"
                     /protein_id="YP_005653475.1"
                     /db_xref="GI:384438751"
                     /db_xref="GeneID:12251708"
                     /translation="MNRHDLEHVHPPFPELGEVVELFLETRAREGVLLYEKDGELHQE
                     PLTRVPGGLRARVAVHASPFRYAFRLPQGYLGSHGLEKTLPRYDRFFHLLAGPLPPPW
                     ALGAVYYQIFPDRFRRGRPGLAPKEGAWRLGGKPIRTKAWHEPPGPEGAHEFYGGDLW
                     GILEALPYLEALGVEVLYLTPIFQSPSSHRYDTEHYLRVDPHLGGEEALQALYAALEA
                     RGMRLVLDGVFNHVGATHPWFQKALQDPESPERGMFTFYPDGTYASFWGVKSMPKLDY
                     ASPLVQERFVFGKEAPIRRWLRLAHGWRLDVAHSLGEGGTNRKNAHWLRALARAAKEA
                     REEALVLGELSYDPTPTLRAHTLDGAMHYAGFAHPVMEWLSGRDVQGRAVALGAEEAW
                     QALWDHYQALPLQLRPAMYTFVSSHDIPRALWRLRGDEARFKLAYALLFAFPGSPAIY
                     YGDEVGLSQANPHSLWRGDPYCRAPFPWDEGAWKREILSFVKRLVALKKRHPALRLGG
                     LWPLKAPKGVLAFRRRYGGEEVWAFFAPQGARLRLPRGVDLLAGEEVGGEVEASHLLF
                     QPLS"
     misc_feature    complement(375044..376258)
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="Alpha amylase catalytic domain found in
                     cyclomaltodextrinases and related proteins; Region:
                     AmyAc_CMD; cd11338"
                     /db_xref="CDD:200477"
     misc_feature    complement(374939..376255)
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="Glycosidases [Carbohydrate transport and
                     metabolism]; Region: AmyA; COG0366"
                     /db_xref="CDD:223443"
     misc_feature    complement(order(375152..375154,375164..375166,
                     375317..375322,375536..375538,375542..375544,
                     375650..375655,375758..375760,375878..375880,
                     375998..376000,376004..376006))
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="active site"
                     /db_xref="CDD:200477"
     misc_feature    complement(order(375368..375370,375467..375469,
                     375533..375538,375596..375598,375605..375613,
                     375638..375646,375752..375754))
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:200477"
     misc_feature    complement(order(375317..375319,375542..375544,
                     375653..375655))
                     /locus_tag="TCCBUS3UF1_3530"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200477"
     gene            complement(376567..377886)
                     /locus_tag="TCCBUS3UF1_3540"
                     /db_xref="GeneID:12251709"
     CDS             complement(376567..377886)
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="similar to ABC-type maltose transport systems,
                     permease component COG3833;
                     similar to Binding-protein-dependent transport systems
                     inner membrane component of Meiothermus ruber DSM 1279
                     UniRef RepID=D3PQZ4_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Binding-protein-dependent transport system inner
                     membrane component"
                     /protein_id="YP_005653476.1"
                     /db_xref="GI:384438752"
                     /db_xref="GeneID:12251709"
                     /translation="MRRLAGFLLLGLLLYGVYWFAAHRLFDAASYRKQVAFGSVFVPY
                     GWAYALGLLLGLVLLVLLYSLVYTALANRLQGRKRSPWPLFGQGLTHLFLWVLILLVY
                     YPVVQVVAASFDPTNNLFSFRRPDTGFLLLDAKVIPYLPEPSLENYAKLVEGVVLYPY
                     QVALLLLAGLSLLGVGVMGLLRRLLAEEGWVNLWQGRFLLLLTLSVFALALLLSPRQF
                     TGQGTEAKFLLWVRNTFLISGLTGLLAVLLTATAGYAFARFRHLPGRYPMLLFFIFVQ
                     MFPGFLALVAIYYLLSRLDLLNTFTGLVLAYSGGIISFGTWVYKGYLESISPSLEEAA
                     MVDGASKWQVFTQILLPLSAPMFVFIFLLQFVGTYSEFVLANLVLTGVESWNVGVGLR
                     SFTTGQFQTKWGVFAAASVLGSLPILFLFYGFQQYFVSGYTAGAVKE"
     misc_feature    complement(376573..>377208)
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(376633..377193)
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(376633..376638,376645..376650,
                     376657..376662,376666..376671,376678..376683,
                     376711..376716,376753..376758,376768..376779,
                     376798..376800,376807..376812,376852..376854,
                     376903..376905,376912..376917,376927..376929,
                     376933..376938,376945..376947,376951..376953,
                     376957..376962,377023..377025,377029..377034,
                     377041..377070,377074..377085,377116..377118,
                     377131..377136,377143..377148))
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(376762..376779,377023..377067))
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(376681..376683,376711..376713,
                     376720..376722,376756..376758,376975..376977,
                     377023..377025))
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(376831..376833,376843..376848,
                     376864..376902))
                     /locus_tag="TCCBUS3UF1_3540"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(377887..379215)
                     /locus_tag="TCCBUS3UF1_3550"
                     /db_xref="GeneID:12251710"
     CDS             complement(377887..379215)
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="similar to maltose transporter membrane protein
                     PRK10999;
                     similar to Fructose-bisphosphate aldolase of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A9F4_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Fructose-bisphosphate aldolase"
                     /protein_id="YP_005653477.1"
                     /db_xref="GI:384438753"
                     /db_xref="GeneID:12251710"
                     /translation="MRHPPGLKGFLLALALLLGLLVLATGVGILGYLALEARYALPGW
                     TILGLALLVLVPGAILLTRLFPWLSDWYYFLPALSFLLVFTLYPIGLTVYLAFTDYSG
                     ARNGFPDRSTETRVLKQEGAELVLEAPVEEALRCQPCQGEPVEVYAEGHRMRARILEA
                     EGPTLLLDRTPPFPAAFVAKVNAFHFVGLRNFAFILSQAGQALLPVFLWNVVFAGSTV
                     LLNALLGLVLGLILHNKALKLRNFYRTVLIVSWALPGVITVQVWVALLNYNFGAINRL
                     LGVLGVYPIPWLNDPDWAKVAILLVNLWLGFPYMMTATLGALSTIPDELYEAARVDGA
                     TPWQALWGITLPLLEKPMVPILLSSFAFNFNNFYIIYLLTGGGPAQEGRLATAQATDI
                     LISWAYKTAFSAEGQSAYGLGAAISLIIFAITVAISLVNFRATGALREVR"
     misc_feature    complement(377941..378504)
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(377941..377946,377953..377958,
                     377965..377970,377974..377979,377986..377991,
                     378019..378024,378100..378105,378112..378123,
                     378142..378144,378151..378156,378196..378198,
                     378247..378249,378256..378261,378271..378273,
                     378277..378282,378289..378291,378295..378297,
                     378304..378309,378427..378429,378433..378438,
                     378445..378474,378478..378489))
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378106..378123,378427..378471))
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(377989..377991,378019..378021,
                     378028..378030,378103..378105,378322..378324,
                     378427..378429))
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(378175..378177,378187..378192,
                     378208..378246))
                     /locus_tag="TCCBUS3UF1_3550"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(379274..380470)
                     /locus_tag="TCCBUS3UF1_3560"
                     /db_xref="GeneID:12251711"
     CDS             complement(379274..380470)
                     /locus_tag="TCCBUS3UF1_3560"
                     /note="similar to Maltose-binding periplasmic
                     proteins/domains COG2182;
                     similar to Maltose/maltodextrin-binding protein of
                     Deinococci UniRef RepID=Q72I44_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653478.1"
                     /db_xref="GI:384438754"
                     /db_xref="GeneID:12251711"
                     /translation="MKKALAALALGLSLALAQGKITVWTHFGGPELEWLKAQAQAFEK
                     AAGTKVEVVEVPFGDIKQKFILGAPQGQAADLVVTIPHDWLGEMAQAGVLEPMGKYVT
                     QGYLADLQGVAVEAFTFGGRLFGLPAFAESVALIYNKKYVKEAPKTWEEFLALARQHT
                     TGATFGFLYNIGDPYFNFGFFRAFGADNVFAKDAKGNLDPSKLLLGGEVGERALSFIK
                     DLRFRHNLVPEGVDYGVADGAFKDGALAMIINGPWALGDYKKAKIDFGIAPFPTPPGA
                     KNPWGPFLGVQGVVVNAYSKNKTAAVNFAKTLITGRNLVSFNQAGGRIPVSKSAAKTL
                     EKDPVVAGFSRVFALGTPMPNIPEMGKVWGPWGNAINLAIQRPDANVKKIVEDMVAEI
                     RKAIGR"
     misc_feature    complement(379289..380419)
                     /locus_tag="TCCBUS3UF1_3560"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     misc_feature    complement(379277..380413)
                     /locus_tag="TCCBUS3UF1_3560"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     gene            complement(380563..381594)
                     /locus_tag="TCCBUS3UF1_3570"
                     /db_xref="GeneID:12251712"
     CDS             complement(380563..381594)
                     /locus_tag="TCCBUS3UF1_3570"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653479.1"
                     /db_xref="GI:384438755"
                     /db_xref="GeneID:12251712"
                     /translation="MNLLSPHIALYRLYDLADEIDLSRLSTPRLRLSRPRLGAVRFQS
                     PPAQLELGARSVEGLSGLLTARLYEFGVAALSFRIHLGERLPWEAFVERALALPELPF
                     WEGFFLAELAALEPYLEGALLRPEEKRLSEEFTVYHALGLEGEKAHAPSVDLTPLWMG
                     AKEEFAPEVRREMERYRYSYSTEDLALLGFDRVLILDSEGIWDVADLVEFVHAQLLEL
                     SYYDRVLTEELEAVPEVLRHRGLWGYGRLQRLRRRLMARHAEIADVRARMEGALRITE
                     DLFYAKIYRAALELYGAHELERSVEEKLRVLEATYEMVTEEVAHLRTQAVEMAILALI
                     AFEVVRALH"
     gene            complement(381591..382202)
                     /locus_tag="TCCBUS3UF1_3580"
                     /db_xref="GeneID:12251713"
     CDS             complement(381591..382202)
                     /locus_tag="TCCBUS3UF1_3580"
                     /note="similar to putative deoxyribonucleotide
                     triphosphate pyrophosphatase PRK00120;
                     similar to Nucleoside-triphosphatase of Bacteria UniRef
                     RepID=NTPA_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-triphosphatase"
                     /protein_id="YP_005653480.1"
                     /db_xref="GI:384438756"
                     /db_xref="GeneID:12251713"
                     /translation="MRLVLATSNPGKVRELKEGLAPLGWTLLSLADFPLRMPKEEGAT
                     FLDNALLKAAHVAKATGLPALADDSGLEVYALGGEPGVYSARYGGRETDRERNVYLLE
                     RMRHLKGEERKARFVAVLVLAYPDGHVERYEGSVEGYILEAPRGEGGFGYDPLFLVPE
                     AGKTFAEMSLEEKARYSHRGKALQALLKAYEHGPPPREVSKLE"
     misc_feature    complement(381636..382196)
                     /locus_tag="TCCBUS3UF1_3580"
                     /note="NTPase/HAM1.  This family consists of the HAM1
                     protein and pyrophosphate-releasing xanthosine/ inosine
                     triphosphatase. HAM1 protects the cell against mutagenesis
                     by the base analog 6-N-hydroxylaminopurine (HAP) in E.
                     Coli and S. cerevisiae. A...; Region: HAM1; cd00515"
                     /db_xref="CDD:238285"
     misc_feature    complement(order(381666..381671,381744..381749,
                     381753..381755,381855..381857,381948..381953,
                     381990..381998,382158..382160,382167..382172,
                     382176..382178))
                     /locus_tag="TCCBUS3UF1_3580"
                     /note="active site"
                     /db_xref="CDD:238285"
     misc_feature    complement(order(381945..381947,381954..381956,
                     381963..381965,381972..381977,382077..382085))
                     /locus_tag="TCCBUS3UF1_3580"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238285"
     gene            complement(382208..382852)
                     /locus_tag="TCCBUS3UF1_3590"
                     /db_xref="GeneID:12251714"
     CDS             complement(382208..382852)
                     /locus_tag="TCCBUS3UF1_3590"
                     /note="similar to Predicted Rossmann fold
                     nucleotide-binding protein COG1611;
                     similar to Putative uncharacterized protein of Truepera
                     radiovictrix DSM 17093 UniRef RepID=D7CTR8_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653481.1"
                     /db_xref="GI:384438757"
                     /db_xref="GeneID:12251714"
                     /translation="MARKPLIDQLHHEDAWRLFRILAEFVEGFEALAGIGVPLVSVFG
                     SARFGEGHPAYALGYRLGRALAEAGYGVVTGGGGGVMEAANRGAFEAGGVSVGLNIEL
                     PHEQKPNPYQTHALSFRYFFVRKVLFVRYAHAFVFLPGGLGTLDELSEVLVLIQTEKV
                     HPFPVFVLDRAYWQGLLGWMEFLKAQGAIDPQDLSLLTPMETPEEVVAALKGVS"
     misc_feature    complement(382220..382774)
                     /locus_tag="TCCBUS3UF1_3590"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     [General function prediction only]; Region: COG1611"
                     /db_xref="CDD:224527"
     gene            complement(382889..383662)
                     /locus_tag="TCCBUS3UF1_3600"
                     /db_xref="GeneID:12251715"
     CDS             complement(382889..383662)
                     /locus_tag="TCCBUS3UF1_3600"
                     /note="similar to glutamate racemase PRK00865;
                     similar to Glutamate racemase of Thermus aquaticus Y51MC23
                     UniRef RepID=B7A9G0_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_005653482.1"
                     /db_xref="GI:384438758"
                     /db_xref="GeneID:12251715"
                     /translation="MKDPRRPIGVFDSGVGGLTVLEALRQALPQEDFLYFGDTARVPY
                     GGKPLPMVRRFAWEIAGFLLRQGVKAIVVACNTASSAALPDLAEDLSVPVFGVLEPAA
                     EVARGFARVGLIGTEATVESRAYERHLPLAWAKACPLFVPLVEEGLWDDPVALLVARH
                     YLEEAPQDLEALILGCTHYPFLKGTLKKVLPGVKLIDSAEATARKVAETLAREGLLNP
                     EGRGRVAHFVTGDPESYRNLAERLGVKVERLRRVSLEEL"
     misc_feature    complement(382937..383662)
                     /locus_tag="TCCBUS3UF1_3600"
                     /note="glutamate racemase; Provisional; Region: PRK00865"
                     /db_xref="CDD:234851"
     gene            383753..384931
                     /locus_tag="TCCBUS3UF1_3610"
                     /db_xref="GeneID:12251716"
     CDS             383753..384931
                     /locus_tag="TCCBUS3UF1_3610"
                     /note="similar to S-adenosylmethionine synthetase
                     PRK05250;
                     similar to S-adenosylmethionine synthase of cellular
                     organisms UniRef RepID=METK_ROSCS"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase"
                     /protein_id="YP_005653483.1"
                     /db_xref="GI:384438759"
                     /db_xref="GeneID:12251716"
                     /translation="MRLVTSESVTEGHPDKLADRISDAILDALIAQDKKARVAAETLV
                     TTGLVFVAGEISTEGYVDIPGLVRKTVREVGYTRAKYGFDADTCAVLTAIDEQSPDIA
                     GGVNLSYEWRVLKSTDPLDRTGAGDQGLMFGYATDETPEFMPLPITLAHRLTMRLAEV
                     RKTGLLPYLRPDGKAQVTVVYDGDKPLYVKTVVVSAQHSPEVDQDQLREDLIREVVRQ
                     AIPAEYLKEGETEYLINPSGRFILGGPHADTGLTGRKIIVDTYGGAVPHGGGAFSGKD
                     PTKVDRSASYYARYMAKNLVAAGLARRALVELAYAIGKARPVSLRVETFGTGLLPDEK
                     LTEIAKRVFDPRPLAIIEELDLLRPIYTPTSAYGHFGRHGFPWEETDRAEALRREAGL
                     "
     misc_feature    383753..384928
                     /locus_tag="TCCBUS3UF1_3610"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    383756..384049
                     /locus_tag="TCCBUS3UF1_3610"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    384113..384472
                     /locus_tag="TCCBUS3UF1_3610"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    384476..384889
                     /locus_tag="TCCBUS3UF1_3610"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            complement(384979..386037)
                     /locus_tag="TCCBUS3UF1_3620"
                     /db_xref="GeneID:12251717"
     CDS             complement(384979..386037)
                     /locus_tag="TCCBUS3UF1_3620"
                     /note="similar to putative phosphodiesterase PRK13561;
                     similar to GGDEF domain protein of Thermus thermophilus
                     UniRef RepID=Q5SHT9_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_005653484.1"
                     /db_xref="GI:384438760"
                     /db_xref="GeneID:12251717"
                     /translation="MYPGDSLRPTLELLDPLHPLRRRTALWLLPLGGVLALVALGTSL
                     ATGLDPVDRVLLPLLAVGFFGLALVLWRLPRAASWVLPAAHALVALYLLSTLAYQLLF
                     RPNPMGLSPAAFWVPFVYFSGFLFFQSQRAVRLALLYLGLLLFLSLLGGLRGHFQPAH
                     LNALAQFFGANLAYVGLLYMLVRIKEGYMEAQLDAYTDFLTGLRNRRYLELALERELF
                     RVQRYGRPLSLVVLDLDGFKAVNDTHGHEAGDRVLKALATCLEGHIRQSDRAVRLGGE
                     EFAVLLPETDLAHALALSERLRQAVARLKVPPAGPLTASFGVAQASPTDSPLSLLKRA
                     DEALYRAKRQGKNRVEVG"
     misc_feature    complement(384991..385452)
                     /locus_tag="TCCBUS3UF1_3620"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(385210..385212,385339..385341))
                     /locus_tag="TCCBUS3UF1_3620"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(385207..385218,385222..385224,
                     385288..385290,385300..385302,385312..385317,
                     385324..385326))
                     /locus_tag="TCCBUS3UF1_3620"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(385150..385152,385234..385236))
                     /locus_tag="TCCBUS3UF1_3620"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(386093..387985)
                     /locus_tag="TCCBUS3UF1_3630"
                     /db_xref="GeneID:12251718"
     CDS             complement(386093..387985)
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="similar to arginine decarboxylase PRK05354;
                     similar to Biosynthetic arginine decarboxylase of
                     Deinococci UniRef RepID=SPEA_DEIRA"
                     /codon_start=1
                     /transl_table=11
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="YP_005653485.1"
                     /db_xref="GI:384438761"
                     /db_xref="GeneID:12251718"
                     /translation="MKTARRFSPKEAEEIYLVPYWGAGFFRVGRNGELEVTPLGPEGP
                     AASLLEIVEALRDEGRPLPLVLRFPQILEARVRELNEAFQRAMEKYGYTGGYRGVYPV
                     KVNQRRLVLETVARAGRPYHYGLEAGSKAELALILAQNLSPEALITTNGFKDDDFIRL
                     ALMGRKLGRNVVITLEKFAELPRVVRLSRELGVRPQIGIRYKLKAKGAGQWEASGGEN
                     AKFGLTTPEIVRAVEILKEEGLLDTLVMVHAHIGSQVTDIRKIKAAVREAAQTYVQLR
                     KLGAPLTYLNLGGGLAVDYDGSKTNFYASANYTLPEYAEDLVYVTKEVVEAQGEPHPT
                     LVTESGRAVTAYHEVLVLEVIDVITPPGEERPQAPSEGAHPLVKELWEGLQGLSPKNF
                     REVYHDAFADKETLQTLYDLGLVSLKDRALGEEIFYHIARRVYAIVRELPYAPDEFED
                     LEKLLADKLICNFSIFQSLPDAWAIHQLFPIVPLSRLHEPPTRQATLVDISCDSDGKI
                     DRFIDLHDVRQSLPVHAVRPGEPYYLGVFLVGAYQDVLGSSHNLFGQVGEAHVAVDEE
                     GFAIERFVPGETAEKVIEKMGFTARELFQGVERLVRQSRLSPAEKGAFLERYVRELQG
                     YTYLED"
     misc_feature    complement(386096..387985)
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="arginine decarboxylase; Provisional; Region:
                     PRK05354"
                     /db_xref="CDD:235427"
     misc_feature    complement(386303..387802)
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Arginine Decarboxylase; Region: PLPDE_III_ADC;
                     cd06830"
                     /db_xref="CDD:143503"
     misc_feature    complement(order(386330..386338,386345..386353,
                     386471..386473,386477..386485,386489..386491,
                     386591..386593,386600..386602,386606..386608,
                     386612..386614,386627..386629,386915..386923,
                     387320..387331,387437..387439,387449..387451,
                     387461..387463,387521..387523,387590..387595,
                     387599..387604,387677..387679,387800..387802))
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143503"
     misc_feature    complement(order(386336..386338,386348..386350,
                     386360..386362,386477..386482,386963..386974,
                     387116..387121,387227..387229,387236..387238,
                     387386..387388,387536..387538,387608..387610,
                     387677..387679,387683..387685))
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="active site"
                     /db_xref="CDD:143503"
     misc_feature    complement(order(386360..386362,386480..386482,
                     386963..386974,387116..387121,387227..387229,
                     387236..387238,387386..387388,387536..387538,
                     387608..387610,387677..387679,387683..387685))
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143503"
     misc_feature    complement(order(386480..386482,387677..387679))
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143503"
     misc_feature    complement(order(386336..386338,386348..386350,
                     386360..386362,386477..386482,386963..386965,
                     387227..387229))
                     /locus_tag="TCCBUS3UF1_3630"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143503"
     gene            complement(387982..388548)
                     /locus_tag="TCCBUS3UF1_3640"
                     /db_xref="GeneID:12251719"
     CDS             complement(387982..388548)
                     /locus_tag="TCCBUS3UF1_3640"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653486.1"
                     /db_xref="GI:384438762"
                     /db_xref="GeneID:12251719"
                     /translation="MLLEGLRGYRGYPGGFRAYRRAFPTVELSWWHRVGDPRTIGRLK
                     ALAPTGFRFSVHGHKHLSYRPSGEERRVLRRFLRRFRLFGPKAGAVRLEVPEGVEPEA
                     FASWLDLLEEVLKEVGPVALAFQVAEALKPLVRGRGYALVNEAGGPFLYLVDPEGPLP
                     EGEGYLYRRHPSQAAPSALHSRAEVDPG"
     gene            complement(388529..389257)
                     /locus_tag="TCCBUS3UF1_3650"
                     /db_xref="GeneID:12251720"
     CDS             complement(388529..389257)
                     /locus_tag="TCCBUS3UF1_3650"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653487.1"
                     /db_xref="GI:384438763"
                     /db_xref="GeneID:12251720"
                     /translation="MGTERLELAGLPVLAEIPARPKALLLALHGLQGSKEHILSLLPG
                     YLEAGFLLLASDAPRHGERPGPPPSAKDPFYVESVYQVALGFAEEALGVAEEAQRRFG
                     LPLFLAGGSLGAFVVHLLLAQGFRPRAALAFIGSGFPMKLPQGQRVRDPRVQALYQHP
                     PALRGEAYGGVPLLHLHGTEDLIVPLARMEETLKALRPHYPEGRLARFVEEGAGHTIT
                     PLMARMGRAFLEGWLEGGLAPGGA"
     misc_feature    complement(388574..389257)
                     /locus_tag="TCCBUS3UF1_3650"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(388613..389188)
                     /locus_tag="TCCBUS3UF1_3650"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            complement(389260..390192)
                     /locus_tag="TCCBUS3UF1_3660"
                     /db_xref="GeneID:12251721"
     CDS             complement(389260..390192)
                     /locus_tag="TCCBUS3UF1_3660"
                     /note="similar to phosphoribosylpyrophosphate synthetase
                     PRK07199;
                     similar to Probable ribose-phosphate pyrophosphokinase of
                     Bacteria UniRef RepID=KPRS_DEIRA"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="YP_005653488.1"
                     /db_xref="GI:384438764"
                     /db_xref="GeneID:12251721"
                     /translation="MDRPLLIFSGQSNRPLAQAIAEALGLPLGRSTTVRFANDNLFVR
                     FEESLREGDVFLVQSLTPPVQDHLMELLMMIDAAKGASAARVTAVIPYFSYARSDKKD
                     APRISIAARLIADLLQTAGADRVLTMTLHSPQVHGFFKIPVDHLSAEPVIANHFATRV
                     DLENAVVVAPDAGDIKRASSLARRLGLPLAFIDKERVSDTEVRVRMLVGEVEGKTALI
                     VDDEISTAGSLVEAVEALLQAGAKEVYAAATHGVYVGPALERIAKSPVREVAATDTCL
                     PKEGPKLKTLTVAPLFAEAIWRIHRGESVSSLFT"
     misc_feature    complement(389263..390192)
                     /locus_tag="TCCBUS3UF1_3660"
                     /note="Phosphoribosylpyrophosphate synthetase [Nucleotide
                     transport and metabolism / Amino acid transport and
                     metabolism]; Region: PrsA; COG0462"
                     /db_xref="CDD:223538"
     misc_feature    complement(389830..390180)
                     /locus_tag="TCCBUS3UF1_3660"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:258077"
     misc_feature    complement(389371..389751)
                     /locus_tag="TCCBUS3UF1_3660"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(389431..389433,389509..389523,
                     389527..389535,389674..389676,389680..389682))
                     /locus_tag="TCCBUS3UF1_3660"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(390228..391358)
                     /locus_tag="TCCBUS3UF1_3670"
                     /db_xref="GeneID:12251722"
     CDS             complement(390228..391358)
                     /locus_tag="TCCBUS3UF1_3670"
                     /note="similar to Xaa-Pro aminopeptidase COG0006;
                     similar to Xaa-Pro aminopeptidase of Thermaceae UniRef
                     RepID=Q72I59_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="YP_005653489.1"
                     /db_xref="GI:384438765"
                     /db_xref="GeneID:12251722"
                     /translation="MDLPRVQEALREEGVDGWLLFSFGRGNPLALEVLSLGHLHLTRR
                     FAYLLPKEGEPLLLCHAIEESLFPPLPGRRRTYHSWQGLLEGLSQALRGLRRIALEYV
                     PGGQIPYLSRVDGGTLDLLRGMGLELVSSWPLLLLFQTWGEEKLQRHRRAAKGLVAAK
                     EEALAFLKAHPRATEREVQAVLVSSLRASSLVFDHPPMVAFGPNAANPHHEPGEKRLE
                     EGEVVLLDLWAKEPGGVYADLTWMAGLGPLEAAHRAFQAVAKARDEALRFVAERYREG
                     RFPLGFEVDRVARGVLEAEGYGAYVRHRTGHNLGEEVHGSGPHLDDLETHDFRPLVPG
                     LAFTVEPGVYLPGFGVRTEVDVYLHREGPEVTTPLQREITPL"
     misc_feature    complement(390240..391355)
                     /locus_tag="TCCBUS3UF1_3670"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    complement(390270..390923)
                     /locus_tag="TCCBUS3UF1_3670"
                     /note="A family including aminopeptidase P, aminopeptidase
                     M, and prolidase. Also known as metallopeptidase family
                     M24. This family of enzymes is able to cleave amido-,
                     imido- and amidino-containing bonds. Members exibit
                     relatively narrow substrate specificity...; Region:
                     APP_MetAP; cl00279"
                     /db_xref="CDD:260321"
     misc_feature    complement(order(390300..390302,390339..390341,
                     390438..390440,390645..390647,390681..390683,
                     390732..390734))
                     /locus_tag="TCCBUS3UF1_3670"
                     /note="active site"
                     /db_xref="CDD:238514"
     gene            391440..391817
                     /locus_tag="TCCBUS3UF1_3680"
                     /db_xref="GeneID:12251723"
     CDS             391440..391817
                     /locus_tag="TCCBUS3UF1_3680"
                     /note="similar to iron-sulfur cluster insertion protein
                     ErpA PRK13623;
                     similar to HesB/YadR/YfhF of Deinococci UniRef
                     RepID=Q1J1K8_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="HesB/YadR/YfhF"
                     /protein_id="YP_005653490.1"
                     /db_xref="GI:384438766"
                     /db_xref="GeneID:12251723"
                     /translation="MVETQEVIRITPLAAEKAKEILARYGKEHAAIRVYIKSGGCSGF
                     QYGMAVDERELEGDTFVEMHGVRLVVDPMSLPYLVGSEIDWVESLMGGGFTVHNPNAA
                     STCGCGHSFRTKDQEGEARTCGH"
     misc_feature    391449..391778
                     /locus_tag="TCCBUS3UF1_3680"
                     /note="Fe-S cluster assembly scaffold protein
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: sufA; COG0316"
                     /db_xref="CDD:223393"
     gene            complement(391824..391943)
                     /locus_tag="TCCBUS3UF1_3690"
                     /db_xref="GeneID:12251724"
     CDS             complement(391824..391943)
                     /locus_tag="TCCBUS3UF1_3690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653491.1"
                     /db_xref="GI:384438767"
                     /db_xref="GeneID:12251724"
                     /translation="MASFRVRHSLSGRGYYTLALLKVNGKRLRGLVSGPLGSP"
     gene            391944..393812
                     /locus_tag="TCCBUS3UF1_3700"
                     /db_xref="GeneID:12251725"
     CDS             391944..393812
                     /locus_tag="TCCBUS3UF1_3700"
                     /note="similar to Peptide ABC transporter, peptide-binding
                     protein of Thermaceae UniRef RepID=Q5SHU6_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide ABC transporter, peptide-binding
                     protein"
                     /protein_id="YP_005653492.1"
                     /db_xref="GI:384438768"
                     /db_xref="GeneID:12251725"
                     /translation="MRKLGKLAVLGLTALGLALAGPQDNSLVIGASQEPRVLAGDFLN
                     VISNQAIKSEIQQYLFAPLIGFNADSQNFPVLATEVPTQQNGRLRVRDIGGGKKRLEM
                     DLTIRPDARWSDGRPITTEDVAFYYEVGKAKGMPVLNPDYWDRVQLQVRDVRNFTVIF
                     EPAYYYDTYGSPIGYAPKHVMGPEWEKVKAAARNLDPDKDAQRLNELYRNFFLKFSTP
                     AELNKGAMVYSGAFTLKRWVPGNSIEMERNPNFPIKPEGGESRYVQKVVYRFIQNTNS
                     LLVAVIGGSIDATSSVALTFDQGRSRQLTSRAPGRFDIWFVPGAIWEHIDINKFENCQ
                     AVRDLGLNDVRTRRALLHAMNREGLVKAFFDGLQPVAHTWIAPVNPLFNPNVRKYEFD
                     LQKAEALLAEMGWRKGPDGILQRTVGGRTVRFEIEFVTTAGNAIRERTQQFFAEDLKK
                     IGIAVKINNAPSAVVFADDYIQRASECKWTGMFEFAWVSNLQEDGGLFQYKNLNTGAI
                     MVPTKENNYQGQNIGGWRNDEFDRLTSQAVLEFDEAKRKALFARAQEIWAEELPALPL
                     YFRANPYVVRKGLVNYVASAYSGGYGYPGWNAWEIGWESRGAVKKWDQAKYALSVK"
     misc_feature    392019..393743
                     /locus_tag="TCCBUS3UF1_3700"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    392019..393689
                     /locus_tag="TCCBUS3UF1_3700"
                     /note="The substrate-binding component of ABC-type
                     thermophilic oligopeptide-binding protein Hb8-like import
                     systems, contains the type 2 periplasmic binding fold;
                     Region: PBP2_thermophilic_Hb8_like; cd08513"
                     /db_xref="CDD:173878"
     misc_feature    order(392109..392111,393252..393254,393339..393341,
                     393396..393404,393426..393428)
                     /locus_tag="TCCBUS3UF1_3700"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173878"
     misc_feature    order(392766..392768,392778..392780,392790..392792,
                     393024..393029,393258..393260,393267..393272,
                     393279..393281)
                     /locus_tag="TCCBUS3UF1_3700"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173878"
     gene            393888..394898
                     /locus_tag="TCCBUS3UF1_3710"
                     /db_xref="GeneID:12251726"
     CDS             393888..394898
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="similar to ABC-type dipeptide/oligopeptide/nickel
                     transport systems, permease components COG0601;
                     similar to Peptide ABC transporter permease protein of
                     Bacteria UniRef RepID=Q5SHU7_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide ABC transporter permease protein"
                     /protein_id="YP_005653493.1"
                     /db_xref="GI:384438769"
                     /db_xref="GeneID:12251726"
                     /translation="MFAYTVRRLLQMVPLLLAASVVIYALLALQPGDPLDELRRQNPR
                     MTAEQFEALKRAYGLDQPIHIRYFKWLSRAVQGDLGYSRTYGIPAAEYIFVQRLPKTL
                     LLSGLALTLALLVAIPVGVFSAVRQYSLADYAITFLSFVGFSMPVFFLGILLLYLFAI
                     WLPDHIPGFPRFPTGGVPGILWEDVRSGNIGLGQFLGQWAWHLILPVLALSSLQMAEW
                     TRFMRASLLEVLSQDYIRTARAKGLAERVVLYKHALRNALIPIVTLVGLAIPGVLGGA
                     TITETIFSYPGMGRAIFDALVEKDYNVAMAALAFLALMTALFNLLADLAYAVVDPRIR
                     YS"
     misc_feature    393888..394895
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    394230..394754
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(394230..394232,394239..394244,394257..394259,
                     394290..394301,394305..394334,394341..394346,
                     394350..394352,394524..394529,394533..394535,
                     394539..394541,394548..394553,394557..394559,
                     394569..394574,394581..394583,394632..394634,
                     394674..394679,394686..394688,394707..394718,
                     394725..394730)
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394308..394352,394707..394724)
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394350..394352,394509..394511,394725..394727)
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394584..394622,394638..394643,394653..394655)
                     /locus_tag="TCCBUS3UF1_3710"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            394908..396095
                     /locus_tag="TCCBUS3UF1_3720"
                     /db_xref="GeneID:12251727"
     CDS             394908..396095
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="similar to ABC-type dipeptide/oligopeptide/nickel
                     transport systems, permease components COG1173;
                     similar to Peptide ABC transporter, permease protein of
                     Bacteria UniRef RepID=Q5SHU8_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="YP_005653494.1"
                     /db_xref="GI:384438770"
                     /db_xref="GeneID:12251727"
                     /translation="MATATASPKPRTFLGLFWRRLRRHKMAMAGLVVIVLLILMALLA
                     PWIAPYDPTAQPTGEDVGQYYFNPPSREHLLGTDDLGRDVLSRIIYGSRISLLVGFAV
                     ALSSVILGTIMGTLAGYFSGRPLRFYLGPLRREREGFYPWGFALWRVVSWFLYYGVLY
                     LVVSIAWALARDGIQAGSLGSYLGFGLTLALALWAAWYGLWGQIRLDLDILISRLIDF
                     MLTIPTLPLLLVLSALLRDPGVKVGQWAQGVFGDAASVFIIITILVLFGWLGTARLVR
                     GNILSLREQDYATAAQALGATDGRIMFRHLVPNTIAPLVVQATLQVGGAILTEAALSF
                     LGFGIQPPVATWGNMLTNAQEYIFTAPWLALPPGFMIFITVLAFNYLGDGLRDALDPR
                     SRL"
     misc_feature    394920..396089
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    394935..395072
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    <395646..396032
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(395688..395690,395904..395906,395943..395945,
                     395952..395954,395982..395984)
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(395703..395708,395712..395714,395718..395720,
                     395727..395732,395736..395738,395748..395753,
                     395760..395762,395811..395813,395853..395858,
                     395865..395867,395886..395897,395904..395909,
                     395949..395954,395982..395987,395994..395999,
                     396003..396008,396015..396020,396027..396032)
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(395763..395801,395817..395822,395832..395834)
                     /locus_tag="TCCBUS3UF1_3720"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(396140..396901)
                     /locus_tag="TCCBUS3UF1_3730"
                     /db_xref="GeneID:12251728"
     CDS             complement(396140..396901)
                     /locus_tag="TCCBUS3UF1_3730"
                     /note="similar to tRNA pseudouridine synthase A PRK00021;
                     similar to tRNA pseudouridine synthase A of Thermus
                     thermophilus UniRef RepID=TRUA_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="YP_005653495.1"
                     /db_xref="GI:384438771"
                     /db_xref="GeneID:12251728"
                     /translation="MRRILILAEYDGTGFAGLQRQRPGLRTVQGELEGALARIGAIPK
                     AVAAGRTDAGVHALAMPFHVDLPGRIPTERIPEALNRLLPEDLKVLRAQEVAQDFHAR
                     KDALWRAYRYRVLLRPHPSPLLRHRALWLRHPLDLEAMEEALPLLLGRHNFLGFAKEE
                     VREGTRELLEARLERVEGEAGPELRFYFRGTSFLRGQVRGMVGTLLEVGLGKRPPESL
                     KAILETADRRLAGPSAPAQGLYFLEAAYPREKLLP"
     misc_feature    complement(396164..396901)
                     /locus_tag="TCCBUS3UF1_3730"
                     /note="tRNA pseudouridine synthase A; Validated; Region:
                     truA; PRK00021"
                     /db_xref="CDD:234577"
     misc_feature    complement(396164..396877)
                     /locus_tag="TCCBUS3UF1_3730"
                     /note="Eukaryotic and bacterial pseudouridine synthases
                     similar to E.  coli TruA; Region: PseudoU_synth_EcTruA;
                     cd02570"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(396632..396655,396662..396664,
                     396875..396877))
                     /locus_tag="TCCBUS3UF1_3730"
                     /note="dimerization interface 3.5A [polypeptide binding];
                     other site"
                     /db_xref="CDD:211337"
     misc_feature    complement(order(396305..396307,396746..396757))
                     /locus_tag="TCCBUS3UF1_3730"
                     /note="active site"
                     /db_xref="CDD:211337"
     gene            complement(396911..397909)
                     /locus_tag="TCCBUS3UF1_3740"
                     /db_xref="GeneID:12251729"
     CDS             complement(396911..397909)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="similar to ABC-type spermidine/putrescine transport
                     systems, ATPase components COG3842;
                     similar to ABC transporter related protein of Bacteria
                     UniRef RepID=D3PL01_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005653496.1"
                     /db_xref="GI:384438772"
                     /db_xref="GeneID:12251729"
                     /translation="MLKGIDLEVYPGEILALLGPSGCGKTTLLRVVAGLESPEEGRVV
                     LEGREITPLPPERRGIGFVFQDYALFPHLTALGNVAFGLKGKDRWERARKALERVGMT
                     LFQDRRPGELSGGQQQRIALARALAPGPKLVLLDEPFSSLDASLRAATREEVRKILKE
                     TGTTALLVTHDQEEALSFADRLGVMRGGRLEQVGTPEAVYLRPRTPFVAQFLGRTNLL
                     PGEGKGRQAETCLGPVPLAEPAFGPLLLSLRPEALRLFPPGAGPGPGALGVVVAREFK
                     GHDLTYRVRLLAPERELLVQEGPESPFRPGDQVWVGVAGTGVALEGPPPRTPVGTD"
     misc_feature    complement(396950..397906)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(397271..397906)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(397832..397855)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(397400..397402,397499..397504,
                     397715..397717,397829..397837,397841..397846))
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(397715..397726)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(397547..397576)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(397499..397516)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(397481..397492)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(397394..397414)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(396974..397174)
                     /locus_tag="TCCBUS3UF1_3740"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(397948..399498)
                     /locus_tag="TCCBUS3UF1_3750"
                     /db_xref="GeneID:12251730"
     CDS             complement(397948..399498)
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="similar to putrescine transporter subunit: membrane
                     component of ABC superfamily PRK10592;
                     similar to Iron(III)-transport system permease protein
                     sfuB of Thermus UniRef RepID=Q72I67_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron(III)-transport system permease protein
                     sfuB"
                     /protein_id="YP_005653497.1"
                     /db_xref="GI:384438773"
                     /db_xref="GeneID:12251730"
                     /translation="MLQRRLSHFPGLLPFLVPALLTGGGVALPLLYLLLRALEAEGAA
                     LGEILFRPKNLELLGNTLGLLLGVLLLTTLLALPLAFLTTRTDLRGKRLLSVLLTLPL
                     ALPGYVGAYVLLAATGPGGLLPLPRPEGYWGALLVLSLLTYPYLFLSLRAAFLGLDPS
                     LEEAARTLGLGPWRAFFQATFPQLLPALLSGYLVVGLHVLGDFGTVSLLRYETFSYAI
                     YLQYNAAFDRVYAAWLALFLLGLTGGLLLLEGWLLRRPSLARTGKGAGRRARAIPLGP
                     WAPLAYLLVLLPLLLALVLPFSALFHLASRFPREGFLGLGEAFLHSALAAGPAAFLAV
                     GMALPLAYLAVRHPSPASRALERLAYLGYAIPPLAFALAWIFFSLRSLPFLYGTLPLL
                     VLVLGFHFLAESLGPIRGALHQVPRRLEEAARTLGETPTGAFFRVTFPLLWRGAVAGG
                     ALAFIGAVKELPLTLLLAPMGYATLSTRVFSYTQEAMFAEAAPFALLIALLSAAFVGV
                     LLWSERRF"
     misc_feature    complement(397954..399261)
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="ABC-type Fe3+ transport system, permease component
                     [Inorganic ion transport and metabolism]; Region: ThiP;
                     COG1178"
                     /db_xref="CDD:224099"
     misc_feature    complement(398803..399261)
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398809..398814,398842..398847,
                     398875..398880,398887..398898,398917..398919,
                     398926..398931,398971..398973,399022..399024,
                     399031..399036,399046..399048,399052..399057,
                     399064..399066,399070..399072,399076..399081,
                     399157..399159,399163..399168,399175..399204,
                     399208..399219,399247..399249))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398881..398898,399157..399201))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398812..398814,398842..398844,
                     398851..398853,398878..398880,399094..399096,
                     399157..399159))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398950..398952,398962..398967,
                     398983..399021))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(398023..398544)
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398026..398031,398059..398064,
                     398101..398106,398113..398124,398143..398145,
                     398152..398157,398197..398199,398248..398250,
                     398257..398262,398272..398274,398278..398283,
                     398290..398292,398296..398298,398302..398307,
                     398380..398385,398392..398421,398425..398436,
                     398464..398466,398479..398484,398491..398496))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398107..398124,398377..398418))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398029..398031,398059..398061,
                     398068..398070,398104..398106,398320..398322))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(398176..398178,398188..398193,
                     398209..398247))
                     /locus_tag="TCCBUS3UF1_3750"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(399500..400495)
                     /locus_tag="TCCBUS3UF1_3760"
                     /db_xref="GeneID:12251731"
     CDS             complement(399500..400495)
                     /locus_tag="TCCBUS3UF1_3760"
                     /note="similar to ABC-type Fe3+ transport system,
                     periplasmic component COG1840;
                     similar to Iron ABC transporter, periplasmic iron-binding
                     protein of Thermus thermophilus UniRef RepID=Q5SHV2_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron ABC transporter, periplasmic iron-binding
                     protein"
                     /protein_id="YP_005653498.1"
                     /db_xref="GI:384438774"
                     /db_xref="GeneID:12251731"
                     /translation="MRRRQLLTLIGTAALGLSLAQQPTLVIYSGRGQSLVEPLVRQFQ
                     EETGIRVQVRYGTDAQILATLQEEGSRSPADLFWANTAGALGQAAAKGLLRPLGATLL
                     KQPLAFVPTSQAWVPVTVRLRVLAYNPQRFKPEELPQSLLDLPRFAQEKGLLGRVGWT
                     PTYSSFQDMVAGIIALHGEAKAREWLLAMKALNPKAYASNPAMLEAIRAGEIDLGSTN
                     HYYVVRFRRAGYSLGLHHFKEGDVGNLALVTGAGILKTSKNLVAANRFLTHLLSAKGQ
                     QYFVGNVGEYPLVKGVVADANLLPLEEALKKSPRLDFEKLPLEQALKLLRELGIL"
     misc_feature    complement(399503..400381)
                     /locus_tag="TCCBUS3UF1_3760"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            complement(400571..401347)
                     /locus_tag="TCCBUS3UF1_3780"
                     /db_xref="GeneID:12251732"
     CDS             complement(400571..401347)
                     /locus_tag="TCCBUS3UF1_3780"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653499.1"
                     /db_xref="GI:384438775"
                     /db_xref="GeneID:12251732"
                     /translation="MLFLFVDGLGLGETLESLFPLLLELDPKPLDATLGVEGLPQSGT
                     GQTALLTGANAPRLLGYHQGPFPSPRLRPLLRQSLYAWARAQGLKVLHANAYRPEYLR
                     RATEGRRLLLSAFAQAARLAGLPLLPLGHPLALPPAFWEDPYGMGARAAALARAFPLV
                     VLEYWALDLAAHRFPETLPQRFQELSLFLKGFLAEGGTLLLTSDHGNAEEPWHPQHTR
                     NPVPLVYTGQGPEGPQDLTGVLPWLQTIITSKLRKSDRNT"
     misc_feature    complement(400643..>400879)
                     /locus_tag="TCCBUS3UF1_3780"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            401450..401878
                     /locus_tag="TCCBUS3UF1_3770"
                     /db_xref="GeneID:12251733"
     CDS             401450..401878
                     /locus_tag="TCCBUS3UF1_3770"
                     /note="similar to Osmotically inducible protein C of
                     cellular organisms UniRef RepID=Q2S302_SALRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Osmotically inducible protein C"
                     /protein_id="YP_005653500.1"
                     /db_xref="GI:384438776"
                     /db_xref="GeneID:12251733"
                     /translation="MPVRKAQAVWEGGLRSGKGVMRLQSQAFEGPYSFPSRFEEGPGT
                     NPEELIAAAHAGCFSMALSAALEREGFPPKRVATEARVHLEMVEGRPTLARIELVTEA
                     EVPGISPEKFQEIAQAAKEGCPVSRALAGVGEIALEARLL"
     misc_feature    401459..401863
                     /locus_tag="TCCBUS3UF1_3770"
                     /note="peroxiredoxin, OsmC subfamily; Region:
                     osmo_induc_OsmC; TIGR03562"
                     /db_xref="CDD:234260"
     gene            complement(401883..402617)
                     /locus_tag="TCCBUS3UF1_3790"
                     /db_xref="GeneID:12251734"
     CDS             complement(401883..402617)
                     /locus_tag="TCCBUS3UF1_3790"
                     /note="similar to Zn-ribbon protein, possibly nucleic
                     acid-binding COG1579;
                     similar to Putative uncharacterized protein TTHA1624 of
                     Thermus thermophilus UniRef RepID=Q5SHV6_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653501.1"
                     /db_xref="GI:384438777"
                     /db_xref="GeneID:12251734"
                     /translation="MGGVNGAGHEALKALYGLQEKDLEIDRLQKEVESLPEELLAVKA
                     QVEALEEELEDLLERQAELRKEYNRHSLDIEDLTAKEKQAEAEQRQAQSAREQTQYEN
                     RIQQIKDRIRELLELSTPLMEAMENLEAEIARVEEELSALRPRLEELLAANRDRVEAL
                     KAEVERRLAERAALAQGVPAAVLKEYEAIRRARKGMGIVRMTRQGQAFRCEGCNVVLP
                     THVAQKVVQGQLTRCPSCGRLLWKGE"
     misc_feature    complement(401886..402599)
                     /locus_tag="TCCBUS3UF1_3790"
                     /note="Zn-ribbon protein, possibly nucleic acid-binding
                     [General function prediction only]; Region: COG1579"
                     /db_xref="CDD:224495"
     misc_feature    complement(<402060..>402401)
                     /locus_tag="TCCBUS3UF1_3790"
                     /note="Protein of unknown function (DUF515); Region:
                     DUF515; cl19548"
                     /db_xref="CDD:267901"
     misc_feature    complement(401898..402074)
                     /locus_tag="TCCBUS3UF1_3790"
                     /note="Putative zinc ribbon domain; Region: DUF164;
                     pfam02591"
                     /db_xref="CDD:251399"
     gene            complement(402605..403237)
                     /locus_tag="TCCBUS3UF1_3800"
                     /db_xref="GeneID:12251735"
     CDS             complement(402605..403237)
                     /locus_tag="TCCBUS3UF1_3800"
                     /note="similar to Beta-lactamase domain protein of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A9H9_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase domain protein"
                     /protein_id="YP_005653502.1"
                     /db_xref="GI:384438778"
                     /db_xref="GeneID:12251735"
                     /translation="MRVFRLTLGPLEENAYLVEGPEGALLIDPGDEPERILGLLEATG
                     LTPKAILLTHAHFDHVGAVAPLVERLALPVFLHPLDLPLYRHAAEAARSWGLAIPQPP
                     LPVEPLAEGGQAFGLEVWHLPGHSPGHVAFLYRKEEGPPQVFSGDLLFRGSIGRYDLP
                     GASREALFRSLKRLLTLPPETQVYPGHGPPTTLGLEARANPFLKGLEWEA"
     misc_feature    complement(402677..403198)
                     /locus_tag="TCCBUS3UF1_3800"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(403234..403926)
                     /locus_tag="TCCBUS3UF1_3810"
                     /db_xref="GeneID:12251736"
     CDS             complement(403234..403926)
                     /locus_tag="TCCBUS3UF1_3810"
                     /note="similar to Rhodanese-related sulfurtransferase
                     COG2897;
                     similar to Thiosulfate sulfurtransferase of Thermaceae
                     UniRef RepID=Q72I74_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="YP_005653503.1"
                     /db_xref="GI:384438779"
                     /db_xref="GeneID:12251736"
                     /translation="MELPQGAVLVDTRPRAAYEAGHLPGARHLDLSAPRLRLREEGEL
                     KALEAGLTELFQTLGLESPVVLYDEGLTSRLCRTAFFLGLGGLEVELWTEGWEAYATE
                     KEEPKPERTQVEARLRRDWLLTADEAARHPLLLDVRSPEEFQGKVHPPCCPRGGRIPG
                     SRNAPLEVFLEPGRVLERLGLAPGQEVGVYCHSGARSAVAFFVLRSLGVRARNYLGSM
                     HEWLGEGLPTEP"
     misc_feature    complement(403660..403917)
                     /locus_tag="TCCBUS3UF1_3810"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    complement(403723..403725)
                     /locus_tag="TCCBUS3UF1_3810"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     misc_feature    complement(403264..403527)
                     /locus_tag="TCCBUS3UF1_3810"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:260205"
     misc_feature    complement(403354..403356)
                     /locus_tag="TCCBUS3UF1_3810"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            404025..404489
                     /locus_tag="TCCBUS3UF1_3820"
                     /db_xref="GeneID:12251737"
     CDS             404025..404489
                     /locus_tag="TCCBUS3UF1_3820"
                     /note="similar to Molecular chaperone (small heat shock
                     protein) COG0071;
                     similar to Heat shock protein, class I of Thermus UniRef
                     RepID=Q5SHV9_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Heat shock protein, class I"
                     /protein_id="YP_005653504.1"
                     /db_xref="GI:384438780"
                     /db_xref="GeneID:12251737"
                     /translation="MALVRRETRPAEITPFRTWGPFSLLEEANRLFEEVLGEFARPGV
                     AYVAPADLYETDEALVLEMAVPGLAPEDLEVSLEGQKLTVRGQVKPAEEAKARRYYLQ
                     EIPHGSFVRSFSLPVEVKAEEAKAEFRHGVLRLTLPKVAEARAKRIPIEVVR"
     misc_feature    404064..404480
                     /locus_tag="TCCBUS3UF1_3820"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    404175..404441
                     /locus_tag="TCCBUS3UF1_3820"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    order(404175..404189,404208..404210,404214..404216,
                     404220..404225,404355..404357,404415..404420)
                     /locus_tag="TCCBUS3UF1_3820"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(404516..405586)
                     /locus_tag="TCCBUS3UF1_3830"
                     /db_xref="GeneID:12251738"
     CDS             complement(404516..405586)
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="similar to Bifunctional PLP-dependent enzyme with
                     beta-cystathionase and maltose regulon repressor
                     activities COG1168;
                     similar to Aminotransferase class I and II of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A9I2_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="class I and II aminotransferase"
                     /protein_id="YP_005653505.1"
                     /db_xref="GI:384438781"
                     /db_xref="GeneID:12251738"
                     /translation="MGLPPRKDSLKWSAYPEDVLPLWVADMDFPVAEPIRKAIAERAE
                     GFLGYPPREGDEGLRDLLLEGSGLEGEVAFMPGVVVGLYAAVAAFTAPGQGVLTQVPI
                     YPPFLAAIREQKRTVLANPLQETEAGYRLDLQGLERLAYASRLLLFCHPHNPTGRVFT
                     EEELAALAAIARKHDLIVVSDELHAPLTYEGGHLPLARLLPERTLTLLGPGKAYNLAG
                     LPIGAAVGPKPLVEALRRHLPHTFPNVLAMAAWKAALKEGGAWLGETLKRLKANRDRV
                     AAWAQEVGLGHFPPEGTYLAWLKTPIPRAGAFFLREARVALNPGESFGEGYERFVRLN
                     FATYPEVLEEALARMARALNKA"
     misc_feature    complement(404528..405565)
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="putative C-S lyase; Region: C_S_lyase_PatB;
                     TIGR04350"
                     /db_xref="CDD:213963"
     misc_feature    complement(404534..405529)
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(404927..404929,404951..404956,
                     404960..404962,405035..405037,405128..405130,
                     405278..405280,405350..405358))
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(404837..404839,404846..404848,
                     404927..404935,405056..405058,405248..405250,
                     405347..405349))
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(404951..404953)
                     /locus_tag="TCCBUS3UF1_3830"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(405612..406637)
                     /locus_tag="TCCBUS3UF1_3840"
                     /db_xref="GeneID:12251739"
     CDS             complement(405612..406637)
                     /locus_tag="TCCBUS3UF1_3840"
                     /note="similar to tRNA (guanine-N(7)-)-methyltransferase
                     PRK00121;
                     similar to tRNA (guanine-N(7)-)-methyltransferase of
                     Thermaceae UniRef RepID=TRMB_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="YP_005653506.1"
                     /db_xref="GI:384438782"
                     /db_xref="GeneID:12251739"
                     /translation="MPNRDIHPPPSPLTLAPPCEKALKKVESPSVLVRPALLPSWPPS
                     PSDLFGREGPLVLEVGFGDGRFTAELAQTHPGWLILGAEVSAASVLRALKRLRRAGLA
                     NVRLYHGEGPFALRNLVPPRGLHQVIVNFPDPWPKKRHQRKRLLQEGFFRRLSTRLEE
                     GGSLRLTTDHEAYFRFALEEAERTGLYRIHVEPPPEAHLRTKYALKWKEAGRPFFHAV
                     FTKVAEDPTPWPPTRRYPMAHALLAGDLPESLPLGKEPIPFPGGVAVFLEVARGETGF
                     YILTHVEEEELTQDLLLEVRPSAHGIYAGASRFASPLLTEGVKAAVRALVARLTALGL
                     EVVQDHT"
     misc_feature    complement(406146..406472)
                     /locus_tag="TCCBUS3UF1_3840"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(406248..406250,406299..406307,
                     406386..406391,406443..406463))
                     /locus_tag="TCCBUS3UF1_3840"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            406621..407214
                     /locus_tag="TCCBUS3UF1_3850"
                     /db_xref="GeneID:12251740"
     CDS             406621..407214
                     /locus_tag="TCCBUS3UF1_3850"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653507.1"
                     /db_xref="GI:384438783"
                     /db_xref="GeneID:12251740"
                     /translation="MSLFGNLRSLPLEELLQLLAQKEGALEIWNVRGVPATTLYLKPG
                     RLRSLDQGGKPLDPVDAKAALQALLLAREGSFEFCPGARPPHAFRLNWPLERLLLGLI
                     TFSDELAHLRPHLPPPRAVFRVERPAPGPGGLEGQAFWEKALPHLRQGTTPEALARLL
                     GMPLDLVRYRLYQLEGQGLVRRTGQVKGLGRSGGVGS"
     gene            407211..408173
                     /locus_tag="TCCBUS3UF1_3860"
                     /db_xref="GeneID:12251741"
     CDS             407211..408173
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="similar to Response regulator containing a
                     CheY-like receiver domain and an HD-GYP domain COG3437;
                     similar to Two-component response regulator of Thermus
                     UniRef RepID=Q72JY5_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_005653508.1"
                     /db_xref="GI:384438784"
                     /db_xref="GeneID:12251741"
                     /translation="MRGPALPRVLVAEDDPGQRFLLARAMAPLGVEVWQAPNGQEALG
                     LLRQGLPHVVLADLHMPLMDGLELTRRLKALDPLLPVILLTADAEREVRLQGIQAGAD
                     DFLHKPVDLTELRLRVGGHLERRRLQEKLEDLERALLALVRAVEAKDAYTAGHGERVA
                     TYALYAAGELGAGEEELADLRLGALLHDVGKIALPDPILRGGYPLTEAEWRAIREHPV
                     KGDEILKPLRAHPRLRPYVRWHHERLDGSGYPDGLTEVPPLVQAVAAADIYDALTSGR
                     TYRQALRPEEALEALEAEVRQGRLSREVVRAFRSGMARNRFRLT"
     misc_feature    407238..407564
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(407247..407252,407379..407381,407403..407405,
                     407463..407465,407520..407522,407529..407534)
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    407379..407381
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(407388..407393,407397..407405)
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    407529..407537
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    407661..408032
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(407673..407675,407769..407774,408009..408011)
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    407772..407774
                     /locus_tag="TCCBUS3UF1_3860"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(408170..409957)
                     /locus_tag="TCCBUS3UF1_3870"
                     /db_xref="GeneID:12251742"
     CDS             complement(408170..409957)
                     /locus_tag="TCCBUS3UF1_3870"
                     /note="similar to Carboxylyase-related protein of Bacteria
                     UniRef RepID=Q1IW50_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653509.1"
                     /db_xref="GI:384438785"
                     /db_xref="GeneID:12251742"
                     /translation="MFRNLRAYLDALERRGELKRVRVPVSAELEITEIADRMVKRGGP
                     ALLFEQVVGKDFPVAIGLFGTRERTAFALGVKDLDELARKVEHLLALHPGKGGLSALL
                     GLLPKLPLLKGFFPRRVGRAPVQEVVYRGEAVDLSRLPVLRCWPLDGGPFLTLPLVIT
                     KDPETGELNLGMYRMQVLDRRSTAMHWQLHKVGRRHLEKARKLGKRLEVAVALGGDPV
                     LTYAATAPLPPLPGVSEFHLAGFLRGAPVELAQGVTVDLPVPAEAEFVLEGYIDPEEP
                     PVVEGPFGDHTGFYTPPDLYPRFHVTALTHRRGAIYPATIVGVPPMEDAYLIEASERL
                     FLPPLRLILPEVADYHMPPEGVAHNWVNVALKKEYPGQAYKVAYGMLGLGQMMFAKVI
                     VAVDAGVPVRPGWAALLKALEHALPGRDTLLLRGPIDVLDHSSRGFAFGGKLLIDGTR
                     KLPEEGGEVAFTPRAHPDLPQDLEVLAQRQWPGLWGATLAKRRPHQAWEVAERLLGTP
                     QSAGIRLLLLADHDTALTPEELLWAVLNNIDPERDARVLPGAEGPVLVLDGTRKLPEE
                     GFARVWPERIRMDPGVQALVEARWAEYGL"
     misc_feature    complement(408629..409939)
                     /locus_tag="TCCBUS3UF1_3870"
                     /note="menaquinone biosynthesis decarboxylase, SCO4490
                     family; Region: mena_SCO4490; TIGR03701"
                     /db_xref="CDD:163413"
     gene            complement(410000..410329)
                     /locus_tag="TCCBUS3UF1_3880"
                     /db_xref="GeneID:12251743"
     CDS             complement(410000..410329)
                     /locus_tag="TCCBUS3UF1_3880"
                     /note="similar to hypothetical protein PRK12497;
                     similar to UPF0102 protein TTHA0372 of Thermaceae UniRef
                     RepID=Y372_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653510.1"
                     /db_xref="GI:384438786"
                     /db_xref="GeneID:12251743"
                     /translation="MRGGWAEEAALAHLLAQGYRLLGRNRRTPFGEVDLLLEKDGVYV
                     VVEVKQRRTGRFGTPLEAITPRKVARLLACARHLLGRDDLPVRLEAVLVHGTPEAFRL
                     EHLPLEV"
     misc_feature    complement(410012..410326)
                     /locus_tag="TCCBUS3UF1_3880"
                     /note="hypothetical protein; Reviewed; Region: PRK12497"
                     /db_xref="CDD:237119"
     gene            complement(410326..411651)
                     /locus_tag="TCCBUS3UF1_3890"
                     /db_xref="GeneID:12251744"
     CDS             complement(410326..411651)
                     /locus_tag="TCCBUS3UF1_3890"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653511.1"
                     /db_xref="GI:384438787"
                     /db_xref="GeneID:12251744"
                     /translation="MILDDRYPVLETLEERDGITLYRVEGGVVFFFQVHTPEGRERFY
                     RYRTALRRLEELGLLEAVVSAKPGRYYAFFPEKPLAPKPPPRAALEALAPLGFGREHL
                     AMAEEGVAYLSPWPLGKPARSPRPRPGFLVGVAPGLLLAALGLWLLSQGLYRYFNPPE
                     YTVPNLVGKSAREAFLLLKDTGLVLEVAEGNDPSRPKEEVLAQDPPPGTRLRAGRTVR
                     LTLNQARLNPLPNLTGLRREEAEARLKELGYRLEGLAQVESQEPLGRVLATFPPAGTP
                     LAPGGGVRLLLSRGAGPGPTLPLPKLTGLSRQEALFLLNAAGLQAEVVEVPSGAPPDL
                     VLAQDPAPGTPMPPGSGVRLRVAVRGEVALPSAPPEPETRAVSFSLDLPAEAQGRRVR
                     LVLLDARGEHVLYEGEGQEGLRLEGSYQAQGEARFRLYLDGDLFQEWSP"
     misc_feature    complement(410986..411168)
                     /locus_tag="TCCBUS3UF1_3890"
                     /note="PASTA domain of bacterial serine/threonine kinase
                     pknB-like proteins. PknB is a member of a group of related
                     transmembrane sensor kinases present in many gram positive
                     bacteria, which has been shown to regulate cell shape in
                     Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577"
                     /db_xref="CDD:119328"
     misc_feature    complement(410788..410970)
                     /locus_tag="TCCBUS3UF1_3890"
                     /note="PASTA domain of bacterial serine/threonine kinase
                     pknB-like proteins. PknB is a member of a group of related
                     transmembrane sensor kinases present in many gram positive
                     bacteria, which has been shown to regulate cell shape in
                     Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577"
                     /db_xref="CDD:119328"
     misc_feature    complement(410581..410760)
                     /locus_tag="TCCBUS3UF1_3890"
                     /note="PASTA domain of bacterial serine/threonine kinase
                     pknB-like proteins. PknB is a member of a group of related
                     transmembrane sensor kinases present in many gram positive
                     bacteria, which has been shown to regulate cell shape in
                     Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577"
                     /db_xref="CDD:119328"
     gene            411725..412252
                     /locus_tag="TCCBUS3UF1_3900"
                     /db_xref="GeneID:12251745"
     CDS             411725..412252
                     /locus_tag="TCCBUS3UF1_3900"
                     /note="similar to Thioredoxin reductase COG0492;
                     similar to Thioredoxin reductase related protein of
                     Thermus UniRef RepID=Q5SLC3_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin reductase protein"
                     /protein_id="YP_005653512.1"
                     /db_xref="GI:384438788"
                     /db_xref="GeneID:12251745"
                     /translation="MVGGGPAGLSAALFLARAGLKVLVLDGGRSQVAQVSQVPNYPGL
                     LDEPSGEELLARMREHARRYGAEIREGVVKGVRDLGGVFEVETGEGLVEAERLLLCTH
                     KDPTLPSLLGLARKGNFVDTDEGGRTSYPRVYAAGVARGKVPGHAIVSAGDGAYVAVH
                     LVSDLRGEPYKDHAK"
     misc_feature    411728..>412060
                     /locus_tag="TCCBUS3UF1_3900"
                     /note="Thioredoxin reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region: TrxB;
                     COG0492"
                     /db_xref="CDD:223566"
     misc_feature    411728..>412027
                     /locus_tag="TCCBUS3UF1_3900"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(412253..413023)
                     /locus_tag="TCCBUS3UF1_3910"
                     /db_xref="GeneID:12251746"
     CDS             complement(412253..413023)
                     /locus_tag="TCCBUS3UF1_3910"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK07231;
                     similar to Short-chain dehydrogenase/reductase SDR of
                     Bacteria UniRef RepID=Q1J0J2_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_005653513.1"
                     /db_xref="GI:384438789"
                     /db_xref="GeneID:12251746"
                     /translation="MGLFAGKGVLVTGGARGIGRAVAEAFAREGALVALCDLRPEGKE
                     VAQGIGGFFVQADLAEERDRVRFVEEAAQALGRVDVLVNNAAIAAPGSALTVRLPEWR
                     RVLEVNLTAPMHLSALAAREMRRVGGGAIVNVASVQGLFAEQENAAYNASKGGLVNLT
                     RSLALDLAPLGIRVNAVAPGAIATEAVLEAIALAEDPERTRRDWEDLHALRRLGRPEE
                     VAEAVLFLASEKASFITGAILPVDGGMTASFMMAGRPV"
     misc_feature    complement(412283..413014)
                     /locus_tag="TCCBUS3UF1_3910"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK05565"
                     /db_xref="CDD:235506"
     misc_feature    complement(412298..412999)
                     /locus_tag="TCCBUS3UF1_3910"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(412469..412474,412478..412489,
                     412565..412567,412577..412579,412616..412624,
                     412703..412705,412766..412774,412850..412858,
                     412907..412915,412970..412981,412985..412987))
                     /locus_tag="TCCBUS3UF1_3910"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(412565..412567,412577..412579,
                     412616..412618,412700..412702))
                     /locus_tag="TCCBUS3UF1_3910"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(413028..414152)
                     /locus_tag="TCCBUS3UF1_3920"
                     /db_xref="GeneID:12251747"
     CDS             complement(413028..414152)
                     /locus_tag="TCCBUS3UF1_3920"
                     /note="similar to alanyl-tRNA synthetase PRK13902;
                     similar to Alanyl-tRNA synthetase related protein of
                     Thermus UniRef RepID=Q72GK0_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Alanyl-tRNA synthetase protein"
                     /protein_id="YP_005653514.1"
                     /db_xref="GI:384438790"
                     /db_xref="GeneID:12251747"
                     /translation="MRLYQLDSYATHFQARVERAWSDARGHYAVLSQTLFYPESGGQP
                     ADTGVLRGGFGEVRVLHAYEEEKAFGNVVHVLERPIPEGEAVEGEIDWPRRFRHMQRH
                     TAQHLLSQALLRAGGYHTVAVSLDSAVCTVDLEEEAEEEKIRQAEALANFAVYADHPV
                     EAFFVTEEELGHYPLRRPPKVQGQIRLVRIGDFDLAACGGTHLKTSAQAGPIKVLKWE
                     RYKGGSRVYFTAGWEALEDYHAKHALLSRLALGFSTNPLDLEKPVRRLQEELQALKGE
                     NLALKEALVEALLPRALEAGTLLVPGPALGELAKRLLAWKERTFLLLSPEGRFALLGP
                     GREAVLERLKALGAKGGGKEVVQGALPRERVAEALAGPLG"
     misc_feature    complement(413442..414146)
                     /locus_tag="TCCBUS3UF1_3920"
                     /note="Predicted metal-dependent hydrolases related to
                     alanyl-tRNA synthetase HxxxH domain [General function
                     prediction only]; Region: COG2872"
                     /db_xref="CDD:225427"
     misc_feature    complement(413466..414065)
                     /locus_tag="TCCBUS3UF1_3920"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; cl08469"
                     /db_xref="CDD:263673"
     gene            414151..414393
                     /locus_tag="TCCBUS3UF1_3930"
                     /db_xref="GeneID:12251748"
     CDS             414151..414393
                     /locus_tag="TCCBUS3UF1_3930"
                     /note="similar to Uncharacterized conserved protein
                     related to C-terminal domain of eukaryotic chaperone,
                     SACSIN COG2250;
                     similar to Putative uncharacterized protein of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A9J3_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653515.1"
                     /db_xref="GI:384438791"
                     /db_xref="GeneID:12251748"
                     /translation="MPLRIRRMAPLEREAYGPWRAQALRTLRPAAGDFREGDGDWASF
                     KAHQAGALGLKGLLRRPASPICLRRWRKPLLRFPCR"
     misc_feature    414187..>414336
                     /locus_tag="TCCBUS3UF1_3930"
                     /note="Uncharacterized conserved protein related to
                     C-terminal domain of eukaryotic chaperone, SACSIN
                     [Function unknown]; Region: COG2250"
                     /db_xref="CDD:225159"
     gene            414406..415155
                     /locus_tag="TCCBUS3UF1_3940"
                     /db_xref="GeneID:12251749"
     CDS             414406..415155
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="similar to 16S rRNA uridine-516 pseudouridylate
                     synthase and related pseudouridylate synthases COG1187;
                     similar to Pseudouridine synthase of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A9J5_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Pseudouridine synthase"
                     /protein_id="YP_005653516.1"
                     /db_xref="GI:384438792"
                     /db_xref="GeneID:12251749"
                     /translation="MAGRRAGGVRGERLDRLLARLGLGSRKEVARLVRGGRVRVAGEE
                     VRDPGCHVPPGATVELDGKPLRVRRHHHVLLHKPAGYVTSRTEGPSVYALLEGFPTRD
                     LSPVGRLDKDTEGLLLFTTHGELLHRLTHPRHKVAKRYLVHLLHPATEADRQAFAEGL
                     VLEGERLLPALLAWGEDPTRVELTLLEGRFHQVKRMFAARGNRVLYLKRLALGPLGLE
                     GLARGEARYLTPEEEAALYRAVGLWGEDAQG"
     misc_feature    414433..415131
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    414439..414606
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(414442..414444,414475..414480,414484..414489,
                     414493..414498,414505..414510,414514..414516,
                     414535..414558,414562..414564)
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    414619..415101
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="Pseudouridine synthase, Escherichia coli RsuA like;
                     Region: PseudoU_synth_RsuA; cd02553"
                     /db_xref="CDD:211327"
     misc_feature    order(414724..414735,414985..414987)
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="active site"
                     /db_xref="CDD:211327"
     misc_feature    order(414823..414825,414976..414987)
                     /locus_tag="TCCBUS3UF1_3940"
                     /note="uracil binding [chemical binding]; other site"
                     /db_xref="CDD:211327"
     gene            complement(415129..415602)
                     /locus_tag="TCCBUS3UF1_3950"
                     /db_xref="GeneID:12251750"
     CDS             complement(415129..415602)
                     /locus_tag="TCCBUS3UF1_3950"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653517.1"
                     /db_xref="GI:384438793"
                     /db_xref="GeneID:12251750"
                     /translation="MKPPIWLWFLLPLGVLLWSAQGLFSAYAGYRQAIEAVRALERES
                     EALARGLPAALAEAPVKAEALPALYEELVRLAEGKGLALKRLQPEREAVQVGEVRAWS
                     LGLTLEGPYLGVLAYLEALPKADKPLWVAGYALSPVPETRGERLTLDLTLRILAP"
     gene            complement(415599..416789)
                     /locus_tag="TCCBUS3UF1_3960"
                     /db_xref="GeneID:12251751"
     CDS             complement(415599..416789)
                     /locus_tag="TCCBUS3UF1_3960"
                     /note="similar to Type II secretory pathway, component
                     PulF COG1459;
                     similar to General secretion pathway protein F of Thermus
                     thermophilus HB27 UniRef RepID=Q72GK3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="General secretion pathway protein F"
                     /protein_id="YP_005653518.1"
                     /db_xref="GI:384438794"
                     /db_xref="GeneID:12251751"
                     /translation="MRFLYEATDERGERVYRGVLEAQNPQEARKRLREMGLYPLRLEP
                     GRRPPRGRVPLPELVLFMEELATLVGAGVPVAQALHTLSLESRHALLKEAARGVRERV
                     EGGESLAQAMGHYPEVFPPLVRALVAAAEVGGALEVVLRRIAEYLDKSHDLREKVRTA
                     LLYPSFVVVVLVLVVAVLLLFVIPVFARLYGAAGAELPWPTRFLIGTSLFVRQNALWI
                     LLFLLALAYFLRAYHRTPGGARLLDGLSLRLPLVGPILHKAAMARFARTLATLYEGGV
                     LITQALEATRNVLGNAALAEALDRVLERVVRGESLSAAMSREPLFLPILVRLALVGEE
                     AGNLERMLYQVAFHLEREVDYGVKRLSSSIEPALTVLLGGIMLLVALALYLPLFDLSR
                     ILRR"
     misc_feature    complement(415617..416789)
                     /locus_tag="TCCBUS3UF1_3960"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility and secretion / Intracellular trafficking and
                     secretion]; Region: PulF; COG1459"
                     /db_xref="CDD:224376"
     misc_feature    complement(416298..416609)
                     /locus_tag="TCCBUS3UF1_3960"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     misc_feature    complement(415632..416000)
                     /locus_tag="TCCBUS3UF1_3960"
                     /note="Type II secretion system (T2SS), protein F; Region:
                     T2SF; pfam00482"
                     /db_xref="CDD:249893"
     gene            complement(416793..418442)
                     /locus_tag="TCCBUS3UF1_3970"
                     /db_xref="GeneID:12251752"
     CDS             complement(416793..418442)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="similar to Type II secretory pathway, ATPase
                     PulE/Tfp pilus assembly pathway, ATPase PilB COG2804;
                     similar to Type II secretion system protein E of
                     Thermaceae UniRef RepID=D3PQS2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Type II secretion system protein E"
                     /protein_id="YP_005653519.1"
                     /db_xref="GI:384438795"
                     /db_xref="GeneID:12251752"
                     /translation="MPRPKLGELLLRLGYLTEEQLQGALEEQARTGDLLGQILLRRGY
                     VREEDLVRALADQQKAPLVRVGELSPDPKALALLDPRFAREKRVLPFRVEGNRLHVAM
                     AHPSDLALLDELRFLTGKEIQPYLAPDREILEALDRLLAEEARPRQPEEAQASPPAEM
                     DLTLEAMPAVRLAQALLERAIALLASDLHLDPGETQLVVRARVDGVMQELERLPKDLE
                     APLSARYKVLAGMDIAERRRPQDGHFSFAFEGKRYEVRVASVGSLHGEKLTLRIIYPT
                     GVRLGLLELGMLPEELALFQRLIRRPHGILFVTGPTGSGKTTTLYAALEQLYTKDKTF
                     VTIEDPVEFPLEGVVQIPVQPKIGLTFAEALRSVLRLDPDVILVGEVRDGETLDTALR
                     AALTGHLVLATLHANDALAAVTRLLEMGAERHLLASTLIGTVAQRLVRRVCPQCARPA
                     PLSEEARLFFGTEAPEEELRGEGCPYCRGTGYRGRVGLYEVYAPDREALYQLGQGAGE
                     GDLRQLAALRGHRDLRQVGLLQVRAGTTTGEELLRVLGLWE"
     misc_feature    complement(418008..418328)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="Type II secretion system (T2SS), protein E,
                     N-terminal domain; Region: T2SE_Nter; pfam05157"
                     /db_xref="CDD:253049"
     misc_feature    complement(416805..418235)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="Type II secretory pathway, ATPase PulE/Tfp pilus
                     assembly pathway, ATPase PilB [Cell motility and secretion
                     / Intracellular trafficking and secretion]; Region: PulE;
                     COG2804"
                     /db_xref="CDD:225363"
     misc_feature    complement(416988..417773)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="PulE/GspE The type II secretory pathway is the main
                     terminal branch of the general secretory pathway (GSP).
                     It is responsible for the export the majority of
                     Gram-negative bacterial exoenzymes and toxins. PulE is a
                     cytoplasmic protein of the GSP, which...; Region:
                     PulE-GspE; cd01129"
                     /db_xref="CDD:238549"
     misc_feature    complement(417492..417515)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(order(417303..417308,417426..417431,
                     417435..417437,417492..417500,417510..417512))
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238549"
     misc_feature    complement(417303..417320)
                     /locus_tag="TCCBUS3UF1_3970"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238549"
     gene            complement(418420..419628)
                     /locus_tag="TCCBUS3UF1_3980"
                     /db_xref="GeneID:12251753"
     CDS             complement(418420..419628)
                     /locus_tag="TCCBUS3UF1_3980"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653520.1"
                     /db_xref="GI:384438796"
                     /db_xref="GeneID:12251753"
                     /translation="MPSLAMHLLFPRRDRILRLKEGAVEVIPAPDLVDEEGKPRYERL
                     WYHLRGLEARGGYLGLGPEFALLRLQPFPSLQGFPLEEAVLAEAERSPLFAGEELLAD
                     YLLVAPEDERRVRVLYGAMPRRRAAWLYRLRPARVEPLPLLLWRYALGQSRGTSVLVL
                     ENLAHTLALFEGGVLKGFRYLTSGADEGSERLTEEVVRSLALFGHPGKVEEAWVLGLP
                     TPPPLPPGLPAQRVEQLAPLNLAEAALAKELSLDLRPRRKALGEGLPREAQVAVFLAA
                     LFFAMGLVGKGVLENLKAAEARRAEALRQQVELLRAQTFQPARPRGLSLEEILRVAAE
                     RPENLWLTTLTAEENRLFLAGKALDPYAPLLLARRLGGRPGPIQASSEGERGPRVYTW
                     EVEVAKAEAR"
     gene            complement(419632..420177)
                     /locus_tag="TCCBUS3UF1_3990"
                     /db_xref="GeneID:12251754"
     CDS             complement(419632..420177)
                     /locus_tag="TCCBUS3UF1_3990"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653521.1"
                     /db_xref="GI:384438797"
                     /db_xref="GeneID:12251754"
                     /translation="MTARGVSLIELAVVLALAGILALALSSLLLAGVRSQQETPLLQA
                     QALAQDLRDRLGADLRNTTSTGVIALLGQSPTATSFIAEVQVGTGKVCVQYRLQASVL
                     ERRSWTGSCTSPTGTFSKALDPALLPFAAFCYDDPNAPGTVALMDAPCTLADLNGKGL
                     TLRLSGRDYPFPPLVISLRSG"
     gene            complement(420178..420906)
                     /locus_tag="TCCBUS3UF1_4000"
                     /db_xref="GeneID:12251755"
     CDS             complement(420178..420906)
                     /locus_tag="TCCBUS3UF1_4000"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653522.1"
                     /db_xref="GI:384438798"
                     /db_xref="GeneID:12251755"
                     /translation="MRKGFTLVEAAVALLLVGAVVYMVLALSQTLRAGTATGPQEEVL
                     QAAETLLEAGVAAPTCPTSASVTLAGKAYRICRQMAGVSLSPPSNTTLQAFTYRFEDV
                     AQGESFFLTQISWEGSPPPPPPSPNFSASCRKVSPNRLRMEISNTGATISTKVLSLSW
                     NGEGKRRLKEIYQGSTTLWSDNKGVKKGSQVSLSQSLTFGNATLDFTFDKNFKTGSYT
                     FTLQLFVGQGNNQTPYTVSCSVGW"
     misc_feature    complement(<420748..420903)
                     /locus_tag="TCCBUS3UF1_4000"
                     /note="Type II secretory pathway, component PulJ
                     [Intracellular trafficking and secretion]; Region: PulJ;
                     COG4795"
                     /db_xref="CDD:227132"
     gene            complement(420903..421343)
                     /locus_tag="TCCBUS3UF1_4010"
                     /db_xref="GeneID:12251756"
     CDS             complement(420903..421343)
                     /locus_tag="TCCBUS3UF1_4010"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653523.1"
                     /db_xref="GI:384438799"
                     /db_xref="GeneID:12251756"
                     /translation="MGRRGYLVLTLALALVFFGILLLPSTLLARLNAERTLTSQSALQ
                     ALYLAEAGAWEAIARLDSQNGPGQAVQVCRTAGASCTPASPEYVGCYTYSTTQPTDCT
                     APSLPSGGTVTLWGFGKTKGGSVRWVRVSYDTANQTVLSWEVLP"
     gene            complement(421346..421795)
                     /locus_tag="TCCBUS3UF1_4020"
                     /db_xref="GeneID:12251757"
     CDS             complement(421346..421795)
                     /locus_tag="TCCBUS3UF1_4020"
                     /note="similar to General secretion pathway protein G of
                     Thermus thermophilus HB27 UniRef RepID=Q72GK9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="General secretion pathway protein G"
                     /protein_id="YP_005653524.1"
                     /db_xref="GI:384438800"
                     /db_xref="GeneID:12251757"
                     /translation="MRQGFTLIELALVLLIVGVLVAVAVPRFLDLSLQAERAAAQKTL
                     LALNSTVRILTVRLGRPPTLDEVWEALDSPYKKDVWEEPFLKRNPYGSYNYQIVLRYR
                     PGREYCMDGYNPLGGLAEAGSPNEPRAQIVVFRPYTSGHGDYYQGEF"
     gene            complement(421806..422180)
                     /locus_tag="TCCBUS3UF1_4030"
                     /db_xref="GeneID:12251758"
     CDS             complement(421806..422180)
                     /locus_tag="TCCBUS3UF1_4030"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653525.1"
                     /db_xref="GI:384438801"
                     /db_xref="GeneID:12251758"
                     /translation="MILALAVPRYTDLKGMAQKAQRQEVLRNLRSTYAIYVAQHRTVP
                     TWNALKTLMGEPTNLRLSSSCPSGTTVAYWDHNENAACNVGERLAYLYADEACTLFLI
                     GLSSTTVTVSIRCLRGHPETLD"
     gene            complement(422219..423664)
                     /locus_tag="TCCBUS3UF1_4040"
                     /db_xref="GeneID:12251759"
     CDS             complement(422219..423664)
                     /locus_tag="TCCBUS3UF1_4040"
                     /note="similar to Lipid A core - O-antigen ligase and
                     related enzymes COG3307;
                     similar to Hypothetical membrane spanning protein of
                     Thermus thermophilus HB27 UniRef RepID=Q72GL1_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653526.1"
                     /db_xref="GI:384438802"
                     /db_xref="GeneID:12251759"
                     /translation="MRPSTPPSVHPVLEGGMLLGLWAALVALNPWGKEFTAIWNSPRE
                     VSMGTFVFAALLGLLLRRNNLPDPPKRNVSAPLWASVSFLAFGLAATVYSPQPIWSWT
                     GYPSVGDGLRFWALGIAFAWSTYLALETGLLKPRLLVAALLLALGTHALAIFPQLFDW
                     KLDYTQTSGQTYVRCFDLERSFCQENPNATASGIHRSHMPIGLTSHRGHAAGALALLS
                     LFVAGLYVQRPNPKLLFLFALGALALWFTQTRGGWMALWGILLFLVLAFSVKRSALAP
                     LAWHLLGIGLLTYGVYWGAGKLLPTEMRSFGELGASFDKVNTYTSGRLDLWQKALTAF
                     PIRPLLGWGFDGYARAYPYGVDWNGKDRPLLPQGLKPPVQVVLGEDRLIYLEDRHGLR
                     ILAPAPYAKAHNLFLDLLLSVGILGGISYLLWLGLAIKQATWPKFPLLLVLLGYLLFG
                     FTWYDSIHVTPIALLALGASFASETVWLKKE"
     misc_feature    complement(422390..422932)
                     /locus_tag="TCCBUS3UF1_4040"
                     /note="O-antigen ligase like membrane protein; Region:
                     O-antigen_lig; pfam13425"
                     /db_xref="CDD:257750"
     misc_feature    complement(422369..>422926)
                     /locus_tag="TCCBUS3UF1_4040"
                     /note="Lipid A core - O-antigen ligase and related enzymes
                     [Cell envelope biogenesis, outer membrane]; Region: RfaL;
                     COG3307"
                     /db_xref="CDD:225844"
     gene            complement(423667..424062)
                     /locus_tag="TCCBUS3UF1_4050"
                     /db_xref="GeneID:12251760"
     CDS             complement(423667..424062)
                     /locus_tag="TCCBUS3UF1_4050"
                     /note="similar to Putative uncharacterized protein of
                     Thermus thermophilus HB27 UniRef RepID=Q72GL2_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653527.1"
                     /db_xref="GI:384438803"
                     /db_xref="GeneID:12251760"
                     /translation="MKAKGFTLIELAIVIVIIGILVAIAVPRFVDLSGDAKDAAVQAT
                     ASSVRSAYAIYVAQNKDYPDYCSDVLNGLEGVNIGSGSSSVTLAGNVVVSCANANPAA
                     GNADISVYATGAKTYNSATNALKVNLRFK"
     gene            424225..425352
                     /locus_tag="TCCBUS3UF1_4060"
                     /db_xref="GeneID:12251761"
     CDS             424225..425352
                     /locus_tag="TCCBUS3UF1_4060"
                     /note="similar to Uncharacterized vancomycin resistance
                     protein COG2720;
                     similar to VanW family protein of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A9J6_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="VanW"
                     /protein_id="YP_005653528.1"
                     /db_xref="GI:384438804"
                     /db_xref="GeneID:12251761"
                     /translation="MGLAWALAFLLGGMGAKGSPMEALLVLQEEAIEEGRLLTYTGVQ
                     RYPVASEGELLALLKRLARPPRPPRFILQDGRWRGVEKKGLSFDEAEVLAAYRQALAA
                     GQGSFRLPVRYTPPQPSLKALYALGVREHLATGETDFRGSSRARLHNLLLASSKLDGL
                     LIPPGPFSFHQALGPVSEEAGYREAFVIVGDRTEQGIGGGVCQVSTTLFRAFFFAGLP
                     ILERHAHSYQVAYYKPTGLDAAVIAPHKDLRVLNDTPGHLWVQRSVVGTRLRFHLFGT
                     KDREVRWEGPFVSERKPPLPPKEVLDPSLPPGVRQQVDFAAEGARVEVRRTVRYRDGR
                     VREERLLSLYRPWGAVYRVGPTPPAKAPPSPPAGGGGARSP"
     misc_feature    424657..425049
                     /locus_tag="TCCBUS3UF1_4060"
                     /note="VanW like protein; Region: VanW; pfam04294"
                     /db_xref="CDD:252509"
     misc_feature    425089..>425250
                     /locus_tag="TCCBUS3UF1_4060"
                     /note="G5 domain; Region: G5; pfam07501"
                     /db_xref="CDD:254241"
     gene            complement(425551..427983)
                     /locus_tag="TCCBUS3UF1_4070"
                     /db_xref="GeneID:12251762"
     CDS             complement(425551..427983)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="similar to DNA topoisomerase I PRK09137;
                     similar to DNA topoisomerase of Thermus thermophilus
                     UniRef RepID=Q5SM69_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase"
                     /protein_id="YP_005653529.1"
                     /db_xref="GI:384438805"
                     /db_xref="GeneID:12251762"
                     /translation="MVVESPAKAKSIQKMLGAGYEVRASRGHVADLPERELGVDVERG
                     FAPTYEVKKDKKPVVEELKRAAQGRRLLIATDPDREGEAIGWHLARLLGRDPQEPLRV
                     EFHEITPKVVREAVARPRPIDQNLVDAQQARRVLDRLLGYNLSPLLSLEFRKRALSAG
                     RVQSVALRLVVEREEAIEAFRPEAYWTLEGRFAVEGQELAASLHEVEGRRLWTGQGDK
                     EGRLHLQSEAEAQALAEAMRGLPFRVAQVETKERRKAPPPPFTTSTLQQAASSRLGYT
                     ASRTMRIAQRLYEGVDLPEGTVGLITYMRTDSVRVSPEALQAAREAIAQAFGPAYLPE
                     SPRVYKNRREGVQDAHEAIRPTDPRRTPEGVRPYLSEEEYRLYDLIWRRFLASQMREA
                     LYDQTVVLLQDQGEKPRFTFRAAGSVLRFEGYLKAWGREGEEEEEAPVPAVAQGAEAR
                     LLGVRPEGHTTEPPPRYTDASLVKAMEELGIGRPSTYAPTLETLEKRGYVERKGRTLL
                     PTLLGRQVTRYLKERFPQVVAYEFTARMEDRLDQIEEGKAPWPQVVWEFYEPFLGELA
                     QVPKKACPRCGRPLELKVSRFGQFLGCTGYPGCTYTEPLEKKEAEAIGEVCPRCGRPL
                     LRKEGRYGSFIACSGYPECDYTRDDGKATGHTCPKCGGRVLEKRSRRGKPYYRCESCD
                     FLSFYPLLDKPCPACGWPLAGKGEGACLNPSCPAHDPRLQPSPREERTKASGKGGKPK
                     GKARASSPKPPQDWGDLIPFLPELPPEERQAVEALAQGEALSEEGAKLAKRALFKLRM
                     RKGRARKEVAPT"
     misc_feature    complement(427627..427983)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="TOPRIM_TopoIA_TopoI: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to Escherichia coli
                     DNA topoisomerase I.   Type IA DNA topoisomerases remove
                     (relax) negative supercoils in the...; Region:
                     TOPRIM_TopoIA_TopoI; cd03363"
                     /db_xref="CDD:173783"
     misc_feature    complement(426043..427980)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="DNA topoisomerase I; Validated; Region: PRK06599"
                     /db_xref="CDD:235840"
     misc_feature    complement(order(427744..427746,427750..427752,
                     427756..427758,427960..427962,427969..427974))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="active site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(427714..427719,427723..427728,
                     427747..427749,427753..427755,427951..427953))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173783"
     misc_feature    complement(order(427750..427752,427756..427758))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(427747..427749)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    complement(426301..427611)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(427453..427515,427531..427611))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426493..426498,426508..426510,
                     426514..426519,426526..426531,427069..427071,
                     427117..427119,427129..427131,427549..427551,
                     427561..427563,427573..427575,427582..427587))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426421..426423,427468..427470,
                     427480..427482))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426598..426630,426700..426750,
                     426763..426768,426772..426816,427219..427263,
                     427417..427440))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426817..426879,426913..426939,
                     427003..427089,427114..427194,427198..427218))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426463..426465,426529..426531,
                     426535..426537,426838..426840,426850..426852,
                     426859..426861,426934..426936,427165..427173,
                     427183..427185))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426934..426936,427069..427071,
                     427075..427077))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    complement(order(426301..426405,426421..426465,
                     426475..426597))
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     misc_feature    complement(426160..426267)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    complement(425842..426180)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="Zn-finger domain associated with topoisomerase type
                     I [DNA replication, recombination, and repair]; Region:
                     TopA; COG0551"
                     /db_xref="CDD:223625"
     misc_feature    complement(426043..426144)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    complement(425869..426063)
                     /locus_tag="TCCBUS3UF1_4070"
                     /note="Zinc finger domain of DnaJ and HSP40; Region:
                     DnaJ_zf; cl19048"
                     /db_xref="CDD:267401"
     gene            427949..428098
                     /locus_tag="TCCBUS3UF1_4080"
                     /db_xref="GeneID:12251763"
     CDS             427949..428098
                     /locus_tag="TCCBUS3UF1_4080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653530.1"
                     /db_xref="GI:384438806"
                     /db_xref="GeneID:12251763"
                     /translation="MLLALAGDSTTTKAVASAFPGEGVLARGPSEDPLAGLFLGVGIA
                     PYLGV"
     gene            complement(428110..429438)
                     /locus_tag="TCCBUS3UF1_4090"
                     /db_xref="GeneID:12251764"
     CDS             complement(428110..429438)
                     /locus_tag="TCCBUS3UF1_4090"
                     /note="similar to Acetyl-CoA hydrolase COG0427;
                     similar to Acetyl-CoA hydrolase/transferase of Meiothermus
                     UniRef RepID=D3PSE2_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-CoA hydrolase/transferase"
                     /protein_id="YP_005653531.1"
                     /db_xref="GI:384438807"
                     /db_xref="GeneID:12251764"
                     /translation="MSYRKKLTSPEDAVGLIRSGMRVFVSGNAATPTPLLKALAARKD
                     ELENVELVHLLQMGEDPFAAPEMEGHFRRRSLFVGPADREAVNQGRADYVPITLHQVP
                     WLFKRRVLPLDAAIVQVSPPDEHGFCSLGVEVIATKAALEAAPIVIAMVNPRMPRTLG
                     DTFVHVSRFSAIVELDWPLPELKREGFGEVERKIGEHVASLIEDGATLQMGIGAIPDA
                     VLASLTGRRDLGVHTEMISDGVLEAFEKGLITGARKTLHPGKVIGTFVLGSERLYRFV
                     HDNPLFELHPTDYVNDPFVVAQNRKMVAINSAIEVDLTGQVVADSIGTRIYSGFGGQL
                     DFIRGAARSEGGKPIIALPSTAKGHSRIVPYLKPGAGVVTTRADVHYVVTEWGIAELF
                     GRSLRERALALIGVAHPDFREELMKAAWERKLLPRSYPGASLPAKDEPRS"
     misc_feature    complement(428134..429435)
                     /locus_tag="TCCBUS3UF1_4090"
                     /note="Acetyl-CoA hydrolase [Energy production and
                     conversion]; Region: ACH1; COG0427"
                     /db_xref="CDD:223504"
     misc_feature    complement(428917..429432)
                     /locus_tag="TCCBUS3UF1_4090"
                     /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
                     Region: AcetylCoA_hydro; pfam02550"
                     /db_xref="CDD:251367"
     misc_feature    complement(428182..428637)
                     /locus_tag="TCCBUS3UF1_4090"
                     /note="Acetyl-CoA hydrolase/transferase C-terminal domain;
                     Region: AcetylCoA_hyd_C; pfam13336"
                     /db_xref="CDD:257666"
     gene            complement(429435..430496)
                     /locus_tag="TCCBUS3UF1_4100"
                     /db_xref="GeneID:12251765"
     CDS             complement(429435..430496)
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="similar to Alanine dehydrogenase COG0686;
                     similar to Alanine dehydrogenase/PNT domain protein of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A9J9_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Alanine dehydrogenase/PNT domain protein"
                     /protein_id="YP_005653532.1"
                     /db_xref="GI:384438808"
                     /db_xref="GeneID:12251765"
                     /translation="MDFGLPKERARLKTLPPFGEEVREGRVALTPQGVRELSARGHRV
                     YVERGAGEAAGFPDAAYEEAGARLVSREEAFRRGEVVLKVARPTQEEVALLRPGAAVM
                     AFLHLAVAESALVEAMAAKGLTAIGYELVGNEGKRPVLKAMSEIAGRLAPQLAGRLLE
                     APTGPGVLLSGLPGIPPADVVILGAGTLGRAAARAFLGAGASVYLLDKDLPALEKAAR
                     EAPGAVTALVTQSRLERYVGFADVLVGAVAVPGEKTPVLLSRELLARMRKGAVLLDFA
                     IDQGGIAETSRPGVYQELGITHFCLPNVPALVPRTASHALTATLLPFLLQLEDDPLRV
                     PELRQGAYLLLGQKGGHLE"
     misc_feature    complement(429456..430496)
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="Alanine dehydrogenase NAD-binding and catalytic
                     domains; Region: L-AlaDH; cd05305"
                     /db_xref="CDD:240630"
     misc_feature    complement(order(429531..429536,429543..429545,
                     429552..429557,429564..429578,429813..429824,
                     429828..429830,429834..429848,429855..429860,
                     429867..429869,429891..429893,429900..429905,
                     429912..429917,429927..429929,429966..429968,
                     429972..430004,430017..430019,430023..430031,
                     430038..430040,430047..430052,430059..430064,
                     430332..430334,430338..430340,430401..430406,
                     430422..430424,430428..430430))
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240630"
     misc_feature    complement(order(429588..429590,430185..430187,
                     430242..430244,430419..430421))
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     misc_feature    complement(order(429663..429665,430179..430181))
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="putative active site [active]"
                     /db_xref="CDD:240630"
     misc_feature    complement(order(429582..429596,429660..429665,
                     429672..429674,429726..429728,429753..429761,
                     429861..429863,429873..429881,429933..429941,
                     429945..429950,430056..430058,430065..430070,
                     430077..430079))
                     /locus_tag="TCCBUS3UF1_4100"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     gene            430585..431061
                     /locus_tag="TCCBUS3UF1_4110"
                     /db_xref="GeneID:12251766"
     CDS             430585..431061
                     /locus_tag="TCCBUS3UF1_4110"
                     /note="similar to Putative uncharacterized protein
                     TTHA0382 of Thermus thermophilus UniRef
                     RepID=Q5SLB1_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653533.1"
                     /db_xref="GI:384438809"
                     /db_xref="GeneID:12251766"
                     /translation="MEALADWLFVAFWVAGVGLTLLPFVPATLIILLGAFLHELLLGF
                     RELSVGAWLALGVLALLAMTLDNVAALLGARRYGAGRAGLWGAFLGGVLGLFLGVVGV
                     LVLPFLLAWLLEYLSGRRPDEALRAAWGTLVGLLGGVVAKTLVHVAMGLLVLRAIF"
     misc_feature    430642..431058
                     /locus_tag="TCCBUS3UF1_4110"
                     /note="Protein of unknown function (DUF456); Region:
                     DUF456; pfam04306"
                     /db_xref="CDD:252516"
     gene            431073..431318
                     /locus_tag="TCCBUS3UF1_4120"
                     /db_xref="GeneID:12251767"
     CDS             431073..431318
                     /locus_tag="TCCBUS3UF1_4120"
                     /note="similar to Glutaredoxin 2 of Thermus UniRef
                     RepID=B7A9K1_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutaredoxin 2"
                     /protein_id="YP_005653534.1"
                     /db_xref="GI:384438810"
                     /db_xref="GeneID:12251767"
                     /translation="MLPPMELVFLTREGCGLCERAERALWTLGVPYVRRLVDQEPQLL
                     ARYAWRVPVLLVGEEPLLEGAFTEKELLALWPNLEGR"
     misc_feature    431088..431291
                     /locus_tag="TCCBUS3UF1_4120"
                     /note="Glutaredoxin-like domain (DUF836); Region: DUF836;
                     pfam05768"
                     /db_xref="CDD:253377"
     gene            431322..432173
                     /locus_tag="TCCBUS3UF1_4130"
                     /db_xref="GeneID:12251768"
     CDS             431322..432173
                     /locus_tag="TCCBUS3UF1_4130"
                     /note="similar to prolipoprotein diacylglyceryl
                     transferase PRK00052;
                     similar to Prolipoprotein diacylglyceryl transferase of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7A9K2_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="YP_005653535.1"
                     /db_xref="GI:384438811"
                     /db_xref="GeneID:12251768"
                     /translation="MDPTMIQIGPLRIQWYGFLLTLAIFLGFELAKRRLRAWGLDAEK
                     FETVAFWAVVFGVVGARLGYVLTSPGYFLENPLEILYIWHGGLSFHGAILGGALVFLY
                     YHRRRGYPLWPYLDAATPGVALGILAGRIGNLMNGSDTAGRLTTLPIGFTWPEWAKGF
                     PGICPGIDDIAQVYSCQELLRGPVHLTQVYGALVGLILLPLALAWLRKRPFDGYAFWQ
                     FLLWYSVLRSVLEEPFRLNPLWLPVYRNDELGIGLFTATQVVSLPLILLALYMLRRLG
                     QRAKALG"
     misc_feature    431322..432161
                     /locus_tag="TCCBUS3UF1_4130"
                     /note="prolipoprotein diacylglyceryl transferase;
                     Reviewed; Region: PRK00052"
                     /db_xref="CDD:234599"
     gene            432183..433544
                     /locus_tag="TCCBUS3UF1_4140"
                     /db_xref="GeneID:12251769"
     CDS             432183..433544
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="similar to bifunctional
                     N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase PRK14360;
                     similar to Glucosamine-1-phosphate N-acetyltransferase of
                     Deinococci UniRef RepID=GLMU_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Glucosamine-1-phosphate N-acetyltransferase"
                     /protein_id="YP_005653536.1"
                     /db_xref="GI:384438812"
                     /db_xref="GeneID:12251769"
                     /translation="MHAHVILAAGQGTRMRSRLPKVLHPLLGKPMLAYAVETALALNP
                     AKLVVVVGHGKEKVLEALEGYPVEVAFQKEQLGTAHALLQAEPFLKDFPGPTLVTQGD
                     TPLLSPSTLGGLLERVGEGAGMALLTVELSDPTGYGRILRQGEEVLGSVEEKDATPEV
                     RAIREVNAGAYAFDPFLFRALKEVRNENAAREYYLPDLIAIYRAHGKRVAAVRGAAEE
                     ALGVNTREELARVEGILLARLRAEWMRRGVRMILPESVYLEPSVELAPDVTLWPGVVL
                     KGKTRIGEGAEVGPYALLEDTVLEPGARVLGHTVAQGAVIAGGADAGPFARLRPGAVL
                     REGVHVGNFVEVKNSLLHPGVKAGHLAYLGDAEVGEGANIGAGVITANYDGKRKHRTW
                     IGKGAFIGSNAVLVAPVRVGDGAMVGAGSVITQDVPEEALAVARGRQRNLEGYARRKR
                     EGE"
     misc_feature    432195..433541
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="N-acetylglucosamine-1-phosphate uridyltransferase
                     (contains nucleotidyltransferase and I-patch
                     acetyltransferase domains) [Cell envelope biogenesis,
                     outer membrane]; Region: GlmU; COG1207"
                     /db_xref="CDD:224128"
     misc_feature    432195..432866
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    order(432201..432209,432330..432332,432414..432416,
                     432423..432425,432480..432482,432486..432488)
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    order(432486..432488,432849..432851)
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    432921..433499
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    order(433167..433169,433215..433217,433221..433223,
                     433257..433259,433266..433268,433299..433310,
                     433323..433331,433344..433346,433374..433376,
                     433380..433385,433434..433439,433488..433490)
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    order(433167..433169,433215..433217,433221..433223,
                     433257..433259,433266..433268,433299..433307,
                     433326..433328,433344..433346)
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    order(433308..433310,433323..433325,433329..433331,
                     433380..433385,433434..433439,433488..433490)
                     /locus_tag="TCCBUS3UF1_4140"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            433586..433819
                     /locus_tag="TCCBUS3UF1_4150"
                     /db_xref="GeneID:12251770"
     CDS             433586..433819
                     /locus_tag="TCCBUS3UF1_4150"
                     /note="similar to Sec-independent protein secretion
                     pathway components COG1826;
                     similar to Sec-independent protein translocase protein
                     TatA of Bacteria UniRef RepID=Q5SLA7_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase protein
                     TatA"
                     /protein_id="YP_005653537.1"
                     /db_xref="GI:384438813"
                     /db_xref="GeneID:12251770"
                     /translation="MNLGMPEILVILVVALLIFGPKKLPELGRSLGQSIREFKRGAQE
                     IREELEKSVEVREEPKPKAETPAKALEAEERKA"
     misc_feature    433586..433762
                     /locus_tag="TCCBUS3UF1_4150"
                     /note="twin arginine translocase protein A; Provisional;
                     Region: tatA; PRK14861"
                     /db_xref="CDD:237837"
     gene            433816..434559
                     /locus_tag="TCCBUS3UF1_4160"
                     /db_xref="GeneID:12251771"
     CDS             433816..434559
                     /locus_tag="TCCBUS3UF1_4160"
                     /note="similar to Sec-independent protein translocase
                     protein tatC of Thermus UniRef RepID=Q72LN9_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase protein
                     tatC"
                     /protein_id="YP_005653538.1"
                     /db_xref="GI:384438814"
                     /db_xref="GeneID:12251771"
                     /translation="MKEAPLVEHLEELRARLLWSLLAWVVGTGVAWSFRVGLLDWLKR
                     PLDLAAAQNGIQVNLIVLDITEPFLVSLKVAAFGGLVLALPFIVYQVWAFIAPGLYEH
                     EKRLAAPFLLGAGFSFALGALFAYYGFLPFAIPFLLGFLGDVITPQISIGRYMGQVLM
                     MMSVMGLVFEMPVVSYLLARLGILSSGFLARNWRVAVVLLLTLAAVITPTVDIVSLSI
                     VTGPLLLLYWVSVLVARLAERARPKEETA"
     misc_feature    433816..434553
                     /locus_tag="TCCBUS3UF1_4160"
                     /note="Sec-independent protein secretion pathway component
                     TatC [Intracellular trafficking and secretion]; Region:
                     TatC; COG0805"
                     /db_xref="CDD:223876"
     gene            434565..435632
                     /locus_tag="TCCBUS3UF1_4170"
                     /db_xref="GeneID:12251772"
     CDS             434565..435632
                     /locus_tag="TCCBUS3UF1_4170"
                     /note="similar to bifunctional
                     3-deoxy-7-phosphoheptulonate synthase/chorismate mutase
                     PRK12595;
                     similar to Phospho-2-dehydro-3-deoxyheptonate aldolase of
                     Bacteria UniRef RepID=Q1IY17_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="YP_005653539.1"
                     /db_xref="GI:384438815"
                     /db_xref="GeneID:12251772"
                     /translation="MDERILALRKEVDRVNRELLRLLSERGRLVQEIGRIQTELGLPH
                     YDPKREEEMLAYLTAENPGPFPAETIRKLFKEIFQASLDLEERQDQKKFLYSKAHKPE
                     PTRVRVKDVVFGEKPLLIAGPCSIESEAQMLETARFLAGKGVRVLRGGAFKPRTSPYG
                     FQGLGVEGLRIGRRAADAFGMVFVTEVMDTRDVEVVAEYADILQIGARNMQNFALLKE
                     VGRAGRPVLLKRGLSATMEEWFYAAEYILSQGNEQVILAERGIRTFERWTRNTLDLSA
                     VALAKQETHLPVIVDVTHAAGRTDLLAPLARAALAVGADGVHVEVHPNPKVALSDNQQ
                     QLDFPQFARFLEAIRDLLPGG"
     misc_feature    434565..435623
                     /locus_tag="TCCBUS3UF1_4170"
                     /note="bifunctional 3-deoxy-7-phosphoheptulonate
                     synthase/chorismate mutase; Reviewed; Region: PRK12595"
                     /db_xref="CDD:183614"
     misc_feature    434586..434867
                     /locus_tag="TCCBUS3UF1_4170"
                     /note="Chorismate mutase type II; Region: CM_2; cl00693"
                     /db_xref="CDD:260576"
     misc_feature    434844..435617
                     /locus_tag="TCCBUS3UF1_4170"
                     /note="DAHP synthetase I family; Region: DAHP_synth_1;
                     cl17225"
                     /db_xref="CDD:266568"
     gene            435633..436574
                     /locus_tag="TCCBUS3UF1_4180"
                     /db_xref="GeneID:12251773"
     CDS             435633..436574
                     /locus_tag="TCCBUS3UF1_4180"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653540.1"
                     /db_xref="GI:384438816"
                     /db_xref="GeneID:12251773"
                     /translation="MGFLDNLLQAFLKATDPRPRYTEARCLLYKNSVGGCDRCHQACP
                     KGAVRLEGWRVELDEVLCTGCGLCTGVCPGVALEFPLGGVQEALIRGKGQLRCSKAEG
                     KGEEVLCLGRLTPGLLAEAGSRFGRVVLARGACEGCRVGGASVPQHLERMAAEARRYF
                     PVEVEVRQGELPGEKVGRRELFQALMGSAKRTAADLVPELPLPQEPEEKGLPAELRLR
                     ALAASRSPEVRWPRIRVEEGCTLCPVCTNVCPTEAVSRVREGEEYVLRLRVAACTGCG
                     ACVESCPPQVIRLEEAPKDLLGEEVELFRGKPPWYDL"
     misc_feature    435795..>435857
                     /locus_tag="TCCBUS3UF1_4180"
                     /note="4Fe-4S single cluster domain; Region: Fer4_15;
                     pfam13459"
                     /db_xref="CDD:257783"
     misc_feature    436338..436481
                     /locus_tag="TCCBUS3UF1_4180"
                     /note="4Fe-4S dicluster domain; Region: Fer4_10;
                     pfam13237"
                     /db_xref="CDD:257594"
     misc_feature    <436347..>436481
                     /locus_tag="TCCBUS3UF1_4180"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            436598..438238
                     /locus_tag="TCCBUS3UF1_4190"
                     /db_xref="GeneID:12251774"
     CDS             436598..438238
                     /locus_tag="TCCBUS3UF1_4190"
                     /note="similar to putative FAD-binding dehydrogenase
                     PRK12834;
                     similar to Fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein of cellular organisms UniRef
                     RepID=D7AVI1_NOCDA"
                     /codon_start=1
                     /transl_table=11
                     /product="Fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein"
                     /protein_id="YP_005653541.1"
                     /db_xref="GI:384438817"
                     /db_xref="GeneID:12251774"
                     /translation="MDAEAIVVGGGLAGLVAATELAAKGKRVLLLEQEAHLGGQAFWS
                     FGGLFLVNSPEQRRLGIRDSVELAFQDWMGSAAYDREEDHWGRLFAQAYLEFAAGEKR
                     AWLASMGVRFFPVVGWAERGGGLASGHGNSVPRFHIVWGTGPGLLEPFLRRARQLEER
                     GLLQVRLRHRAEEVLVEGGKAVGVAGLVLEEDPKPRGVPTSRRALGEFCYRAQAVLLA
                     TGGIGGNLELVRRFWPERLGKPPQRMLSGVPDHVDGAGLFLAERAGARLVNLDRMWHY
                     PEGVENHTPIWSHHGIRILPGPSALWVDATGKRLPPPLFPGFDALETLRHLRQRGWDW
                     SWFILDLATLKKEFALSGSEQNPDLTGRSWLRVMQNRLLGPAAPVRAFLERGRDFLVA
                     EDLSELLSKMDALAPGVLDPVGLEREVKARDRELLHPFAKDAQVQALWGFRRYRGDRL
                     FRVAKPHPFLGGRGGPLVAVRLWTLTRKTLGGIQTDLKGRALTPGGKPLPGLFAAGEA
                     AGFGGGGFHGYKALEGTFLGGCLFSGLQAARGILEGLE"
     misc_feature    436598..438229
                     /locus_tag="TCCBUS3UF1_4190"
                     /note="putative FAD-binding dehydrogenase; Reviewed;
                     Region: PRK12834"
                     /db_xref="CDD:183782"
     misc_feature    436601..438232
                     /locus_tag="TCCBUS3UF1_4190"
                     /note="Predicted oxidoreductase [General function
                     prediction only]; Region: COG3573"
                     /db_xref="CDD:226103"
     gene            438243..438638
                     /locus_tag="TCCBUS3UF1_4200"
                     /db_xref="GeneID:12251775"
     CDS             438243..438638
                     /locus_tag="TCCBUS3UF1_4200"
                     /note="similar to Methylmalonyl-CoA epimerase of
                     Meiothermus silvanus DSM 9946 UniRef RepID=D7BAS4_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="Methylmalonyl-CoA epimerase"
                     /protein_id="YP_005653542.1"
                     /db_xref="GI:384438818"
                     /db_xref="GeneID:12251775"
                     /translation="MRLHHVGIAVEDLEAAKARYLLLGYRVLAEGEVTAQGVRVAMLQ
                     GEGETLLELLAPLGPDTPVGRFLAKRGPGLHHLAFATPRILEDLARLRQEGAQAIDET
                     PRPGFGGHRVAFLHPSFGLGVLWELVEEA"
     misc_feature    438249..438629
                     /locus_tag="TCCBUS3UF1_4200"
                     /note="Methylmalonyl-CoA epimerase (MMCE); Region: MMCE;
                     cd07249"
                     /db_xref="CDD:211350"
     misc_feature    order(438249..438251,438258..438260,438264..438266,
                     438285..438287,438297..438302,438309..438320,
                     438384..438389,438393..438395,438453..438458,
                     438462..438464,438468..438473,438477..438479,
                     438522..438524,438528..438530,438585..438587,
                     438606..438611)
                     /locus_tag="TCCBUS3UF1_4200"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:211350"
     misc_feature    order(438255..438257,438360..438362,438396..438398,
                     438429..438431,438468..438470,438576..438578,
                     438582..438584,438618..438620,438624..438626)
                     /locus_tag="TCCBUS3UF1_4200"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:211350"
     misc_feature    order(438255..438257,438396..438398,438468..438470,
                     438618..438620)
                     /locus_tag="TCCBUS3UF1_4200"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211350"
     gene            438635..438976
                     /locus_tag="TCCBUS3UF1_4210"
                     /db_xref="GeneID:12251776"
     CDS             438635..438976
                     /locus_tag="TCCBUS3UF1_4210"
                     /note="similar to Predicted integral membrane protein
                     COG5652;
                     similar to VanZ family protein of Thermus aquaticus
                     Y51MC23 UniRef RepID=B7A9L0_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="VanZ"
                     /protein_id="YP_005653543.1"
                     /db_xref="GI:384438819"
                     /db_xref="GeneID:12251776"
                     /translation="MRRPWALVLALLHMGLLFWLSHQPATGAGLPHPWDKAAHFLAYL
                     LLGGLLGLGLGRWRAAFLGAFLYGVGDEWHQSFIPGREAFGWDLVADALGAWVGARWG
                     GRWEAPEASLP"
     misc_feature    438635..438946
                     /locus_tag="TCCBUS3UF1_4210"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5652"
                     /db_xref="CDD:227939"
     gene            complement(438930..439613)
                     /locus_tag="TCCBUS3UF1_4220"
                     /db_xref="GeneID:12251777"
     CDS             complement(438930..439613)
                     /locus_tag="TCCBUS3UF1_4220"
                     /note="similar to 3-ketoacyl-(acyl-carrier-protein)
                     reductase PRK05653;
                     similar to Oxidoreductase, short-chain
                     dehydrogenase/reductase family of Thermus UniRef
                     RepID=Q5SL99_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_005653544.1"
                     /db_xref="GI:384438820"
                     /db_xref="GeneID:12251777"
                     /translation="MLQGKAFLVTGAGGALARAVIPALHRAGARLFLSDPRPERMAER
                     AQGVGAETFVADLTRLEEAEALARFVERQAPLHGVVHTVGGFAAGRFLDSDPGLYDWM
                     LDLNLRTTYNLLRAVLPYMERRGEGFFAAIAAGPAWTGSGPGRVLYTVAKTALASLLR
                     SLQGEVEGVRFLVVYPMGTLDTEANRRAMPEADPSRWIAPEFLAEAIVLAASARGGRL
                     LELPIYPPT"
     misc_feature    complement(438978..439610)
                     /locus_tag="TCCBUS3UF1_4220"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(438978..439592)
                     /locus_tag="TCCBUS3UF1_4220"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(439065..439070,439074..439082,
                     439086..439088,439158..439160,439170..439172,
                     439221..439229,439299..439301,439362..439370,
                     439443..439451,439503..439511,439566..439577,
                     439581..439583))
                     /locus_tag="TCCBUS3UF1_4220"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(439158..439160,439170..439172,
                     439221..439223,439296..439298))
                     /locus_tag="TCCBUS3UF1_4220"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(439618..440604)
                     /locus_tag="TCCBUS3UF1_4230"
                     /db_xref="GeneID:12251778"
     CDS             complement(439618..440604)
                     /locus_tag="TCCBUS3UF1_4230"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653545.1"
                     /db_xref="GI:384438821"
                     /db_xref="GeneID:12251778"
                     /translation="MRSLFRLFPFLLLGLYACTGSQEPLLPALVAAGGEGQVRFFRAQ
                     DLQGGAGSPVGTWNTPGLQDLAYSNASGRLYLLFPDRVEAYATQGFTENAAPQAPPLS
                     APLPADCTGGYLRLGQNRLLVHCPGAGRAFLLNLADLGNQEEADLTGLPPGSRLALYP
                     QNTLELLAYLTDTVLGYRPPSNPTGSPKGEAALGLAFTPSDLRLDPIRGRLLGAGRGA
                     TETYLVRWEGTSPNTPSLGLQGAVRLALDPVQGLAAYGGGFRALEPQDSGPRQGFSTY
                     GAGLVGQDAYLYLARGNLLEVYDLQANPFPASPQATALLGFSPSALAFIPVE"
     gene            complement(440601..443081)
                     /locus_tag="TCCBUS3UF1_4240"
                     /db_xref="GeneID:12251779"
     CDS             complement(440601..443081)
                     /locus_tag="TCCBUS3UF1_4240"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653546.1"
                     /db_xref="GI:384438822"
                     /db_xref="GeneID:12251779"
                     /translation="MRPWLWLLLFLLAPAWAQEKALKVLEAERLELRQDGGEEVYVLT
                     GNPVRLEREGEAIQALRVVYFRGRRLLFLSGEVRYLDREGRRIEAEELQIDLGDESFD
                     ALEVRIEAKDLLLTGPLCQRAAGAILLERGYATPCAGCGQEVPDYAFRAREILLYPGD
                     RVVARGVVLLMGEKPVLELPVLLLYLSERRPRLELGQDEGGAYLKAALPYVSPLGLGY
                     TLLHYYAGRGYGFGLDHFGTGEAKERYFFLHTPPDTFQYRGEYGLKRPEFALSALLER
                     DDTREKLSRFRLEALLPGTPTPGDWRYALRLEGFLDHDPTTPPPRSLQRLPELEAQTP
                     TLREGPFSLQASLVLGRYLAETNPLNRSARALGPYGEAGRALLTHGESLLLTPWTGAS
                     LRLENRFRGFYYTTQNPDGEYERQVDWTTTASFRQALGGVSAELGYGRSLQEGESPFR
                     FDALPQRRSHQATLALAFQERPLNLALRTGRDLEAGKYLPLEAQAGLQDAGYALSLVH
                     RRGLSGEGPLETRAEGSLTPYPFSLRMSLRYDHTKEVFDPLALQAGYALPGGSLNLSH
                     RHGLNGEGALTTDLALSLREGTSAYTLQARRDWRQDTLGLQGQAIWGPESLSLQASLD
                     RQALGYTLGFRSGTAPGPLGELQLSGRYQEGPRGTNLRLSLVQALPEVGFRLTANLHL
                     PEVGDEGVYLKDATFSGGAELWPPTPADEKGEGAIPGLALSGAFTYTRQPSRPEGYTL
                     ALRNFGPTLTFVGRERTKLHLAALLSQNLPGEALRPRFVLVLDRCCWALRFTLDAQKG
                     SLGLAFLYGGQAAGLLLSEEGIQLGGTR"
     misc_feature    complement(<442566..443030)
                     /locus_tag="TCCBUS3UF1_4240"
                     /note="Organic solvent tolerance protein OstA [Cell
                     envelope biogenesis, outer membrane]; Region: Imp;
                     COG1452"
                     /db_xref="CDD:224369"
     gene            complement(443078..444121)
                     /locus_tag="TCCBUS3UF1_4250"
                     /db_xref="GeneID:12251780"
     CDS             complement(443078..444121)
                     /locus_tag="TCCBUS3UF1_4250"
                     /note="similar to Permease YjgP/YjgQ family protein of
                     Thermaceae UniRef RepID=D3PLK5_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Permease YjgP/YjgQ"
                     /protein_id="YP_005653547.1"
                     /db_xref="GI:384438823"
                     /db_xref="GeneID:12251780"
                     /translation="MKTLDRYLLREALGLFALGLGVIVLLFLAGAVYEVLAPLVAKGA
                     DPATLLLYLLYRTPEALVRGAPVAYLFALLLLLSRMAEDSELKALLALGVRRERVLLP
                     FLFLGGALSLLGLLLGESLVPRALAEGQDLLRRQVLERPRALLTPGTTFQDAKGRVVY
                     VGEVAGERIGKLRVLSREEVVLAEAGRFSGGVLQVGGGQRVTYEGDRPRTLTRFQRGE
                     LVLKDLTFEPWQNPANRMGLAQLRQEVERLRAQGVKAGLEATTYYRRYAEPAAALVFA
                     LFAVGLAFYLLGGSRSLGLVGVAVLTFFYYATWSVGRIMGEQNALDPLLAAWGPNLVY
                     GALGLLLFLGGRR"
     misc_feature    complement(443120..444106)
                     /locus_tag="TCCBUS3UF1_4250"
                     /note="Predicted permease YjgP/YjgQ family; Region:
                     YjgP_YjgQ; pfam03739"
                     /db_xref="CDD:252138"
     gene            complement(444118..445128)
                     /locus_tag="TCCBUS3UF1_4260"
                     /db_xref="GeneID:12251781"
     CDS             complement(444118..445128)
                     /locus_tag="TCCBUS3UF1_4260"
                     /note="similar to Permease YjgP/YjgQ family protein of
                     Thermus UniRef RepID=B7A9L5_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Permease YjgP/YjgQ"
                     /protein_id="YP_005653548.1"
                     /db_xref="GI:384438824"
                     /db_xref="GeneID:12251781"
                     /translation="MLGRYALKEVLVPYLVGVFLFVALLTFDLLSSLSGVLLSRGVGV
                     EAIGRLILLRLPWTLSLALPLGLVFAILVGLARLIRHSELKAAYAAGVPPWALLKPLG
                     LLALGVSLLNLANLAELRPRALEAYDAHLARLLYGEGGLSGVLRQQLYAPPGLGVYYA
                     EEVRPEVGQNRLFGVRVVDPQGRVYSGAEGVWDAEGWHFRGYVLEGGRLKPFQGTLPF
                     PAQFRPKESLGSRDPYDTSTLGELWERGKVESGARFALARRLADALGGFFLAWVAAAL
                     GLSFREAAWAFLSIVLLIFGYYVLWTFSAQLARYDVNPLWAFLPNGAFAALALGLTWR
                     LR"
     misc_feature    complement(444127..445119)
                     /locus_tag="TCCBUS3UF1_4260"
                     /note="Predicted permease YjgP/YjgQ family; Region:
                     YjgP_YjgQ; pfam03739"
                     /db_xref="CDD:252138"
     gene            complement(445168..445428)
                     /locus_tag="TCCBUS3UF1_4270"
                     /db_xref="GeneID:12251782"
     CDS             complement(445168..445428)
                     /locus_tag="TCCBUS3UF1_4270"
                     /note="similar to Putative uncharacterized protein
                     TTHA0399 of Thermus UniRef RepID=Q5SL94_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653549.1"
                     /db_xref="GI:384438825"
                     /db_xref="GeneID:12251782"
                     /translation="MEAQAQREAQGAKAALEAQGIPVEEAKPGDISPLLALEEELQAH
                     PGTYQAIVLATLPPGLSRWLRLDVHTQAERFGLPVIHVVAQP"
     gene            complement(445796..446830)
                     /locus_tag="TCCBUS3UF1_4290"
                     /db_xref="GeneID:12251783"
     CDS             complement(445796..446830)
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="similar to Alcohol dehydrogenase GroES domain
                     protein of Bacteria UniRef RepID=D5WWU7_BACT2"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase GroES domain-containing
                     protein"
                     /protein_id="YP_005653550.1"
                     /db_xref="GI:384438826"
                     /db_xref="GeneID:12251783"
                     /translation="MRAVVYQGPFQVAVEEVPEPRLEGEGEAIVEVELSAICGSDLHI
                     YHGKIAGVLPGTVLGHEFVGRVVEKGPLVPWALGERVVGSFQVACGECPACRRGQYFA
                     CLKGGVYGFGLALGNLPGAQAQRVRVPFARHSLFPIGDLPAEEAILAGDILTTAYGGV
                     RPFLTPGMSVAVVGSGPVGLMAQAVAHALGAGPVFAIDPEESRLEKAQALGSLPVNPK
                     AEDPVARVRKETEGLGAELVVEAVGGDGEALKLALRLAGPGGVVSSLGVPTAERLDYP
                     WLPAFSRGITLRSALANIPRWIGEVLALQRVGRLRGSFVFSHRLPLGEAAEGYRLFHE
                     RRATKVALVP"
     misc_feature    complement(445799..446830)
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="Glutathione-dependent formaldehyde dehydrogenase
                     related proteins, child 2; Region: FDH_like_2; cd08284"
                     /db_xref="CDD:176244"
     misc_feature    complement(445799..446830)
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    complement(order(446378..446380,446651..446653,
                     446711..446713,446717..446719))
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176244"
     misc_feature    complement(order(445835..445837,445955..445963,
                     446030..446032,446036..446038,446087..446089,
                     446105..446110,446222..446224,446234..446239,
                     446300..446305,446309..446311,446366..446368,
                     446375..446380,446576..446578))
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176244"
     misc_feature    complement(order(446522..446524,446546..446548,
                     446555..446557,446564..446566))
                     /locus_tag="TCCBUS3UF1_4290"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176244"
     gene            complement(446827..447219)
                     /locus_tag="TCCBUS3UF1_4280"
                     /db_xref="GeneID:12251784"
     CDS             complement(446827..447219)
                     /locus_tag="TCCBUS3UF1_4280"
                     /note="similar to motif PHA03247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653551.1"
                     /db_xref="GI:384438827"
                     /db_xref="GeneID:12251784"
                     /translation="MQLFSEAWAQAYCQKLSESEAYRKAAATWEGSLALAVRQDPAQG
                     LPQGVAVVLDLWHGTCRGVKVVEGDAEADFVIEADLATWQEVLSGGLEPLTALMRGLL
                     ELKKGSIAALAPYAQAAQELVRVAREVA"
     misc_feature    complement(446893..447174)
                     /locus_tag="TCCBUS3UF1_4280"
                     /note="SCP-2 sterol transfer family; Region: SCP2;
                     cl01225"
                     /db_xref="CDD:260844"
     gene            447269..447694
                     /locus_tag="TCCBUS3UF1_4300"
                     /db_xref="GeneID:12251785"
     CDS             447269..447694
                     /locus_tag="TCCBUS3UF1_4300"
                     /note="similar to Putative uncharacterized protein
                     TTHA0402 of Thermus UniRef RepID=Q5SL91_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653552.1"
                     /db_xref="GI:384438828"
                     /db_xref="GeneID:12251785"
                     /translation="MVYLLDLSGVYCEPVEPHLLRLLSQASGEPLFYLSQAFYDLLPR
                     LRGEGPGALEALFPGASRLYPKAFRPRERAFPEPFYLVSDLPFPEGMTGFFHPEKLKA
                     LPLALAALGLSPEEALYLDDNPLLVERARALGYRAELFL"
     gene            complement(447691..449973)
                     /locus_tag="TCCBUS3UF1_4310"
                     /db_xref="GeneID:12251786"
     CDS             complement(447691..449973)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="similar to ATP-dependent RNA helicase HrpB
                     PRK11664;
                     similar to ATP-dependent helicase HrpB of Thermus
                     aquaticus Y51MC23 UniRef RepID=B7A9M0_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase HrpB"
                     /protein_id="YP_005653553.1"
                     /db_xref="GI:384438829"
                     /db_xref="GeneID:12251786"
                     /translation="MPGWLDQAVALLLKEGRLLLQAYPGAGKSTLFPLQVLKALPGRV
                     LLFEPRRVAARAVAARLAENLGEPLGKTVGYRVRLEGRESRETRLLVMTEGLLTRLLL
                     KDPTLEGVSAVLLDEAHERHLEGDLALALLLRIQETLRPDLKLALLTATPDEDLERAF
                     QGASLAVEGQSYPVEILHLTKAPEGPLEPLAARYAKEAFLEGEGDVLVFLPGKAEIER
                     TRALLQGLPAYPLHGGLPLEEQAALLRPGPRKIVLATDVAETSLTLPGVRRVVDSGLA
                     KKPRFDPRTGLTRLVLSPIPEASARQRAGRAGRVGPGRVYRLYPQGPFPPKRPEILEA
                     DLSRALLLALAFGEGLEALPLPTKPPAGALEGAWHLLERLGAVAGGRLTPLGKRMLAL
                     PTHPRLARMALEAEALGLLPLAADLMALLEERSPWEGEPDLLAHLEGLLEARRLGKGP
                     FLGVERAAALWRRRLGAQPLESLPAPEAVGRLLLAAYPDRAAEALSPGRYRLATGPLL
                     RLEAGGGPPYLVAAGAELGRVLLYAPLAREDLLEGAEVAAWAGWEEGKFRGYLERRYG
                     ALVLERVAIDPGPPGEAHLREALSQGLPLPEETRQVLLRLGFLRAHGVAVPELTEASL
                     LQDLSWLLPWAQGVRRLEDLEALPWKEILLALLGEARKTLEELAPESLPLGGKRKRLL
                     YREGAPPLLSLRIQEAFGLKETPRVLGGRVPVAVALLSPAGRPVQITQDLKGFWETHY
                     PGVRRELMRRYPKHPWPENP"
     misc_feature    complement(447694..449913)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="ATP-dependent helicase HrpB; Region: DEAH_box_HrpB;
                     TIGR01970"
                     /db_xref="CDD:233660"
     misc_feature    complement(449518..449904)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(449887..449901)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(449617..449628)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(449020..449379)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(449203..449211,449275..449280,
                     449332..449343))
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(449047..449049,449056..449058,
                     449068..449070,449185..449187))
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    complement(<448678..448875)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="Helicase associated domain (HA2); Region: HA2;
                     pfam04408"
                     /db_xref="CDD:252575"
     misc_feature    complement(447694..448086)
                     /locus_tag="TCCBUS3UF1_4310"
                     /note="ATP-dependent helicase C-terminal; Region: HrpB_C;
                     pfam08482"
                     /db_xref="CDD:254823"
     gene            complement(449973..451853)
                     /locus_tag="TCCBUS3UF1_4320"
                     /db_xref="GeneID:12251787"
     CDS             complement(449973..451853)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="similar to DNA topoisomerase IV subunit B PRK05559;
                     similar to DNA gyrase subunit B of Bacteria UniRef
                     RepID=B8FXX0_DESHD"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_005653554.1"
                     /db_xref="GI:384438830"
                     /db_xref="GeneID:12251787"
                     /translation="MLKGLEGVRHRPAMYIGGTGVEGYHHLFKEILDNAVDEALAGHA
                     TEIITTLNPDGSLTVEDNGRGIPVDVMPEEGKPAVEVIYTTLHSGGKFESGAYKVSGG
                     LHGVGASVVNALSEWTVVEVFRQGQHYRIAFSRGEVTEPLRVVGPAPEGKTGTRVTFK
                     PDPQIFGPLAFDPSKLRARLKEVSYLVAGLRLVFRDLQHGREEVYLDKGGVASFAKAL
                     AEGEELLYEKPFLIRKQEGEVEVEVGLIHTKGYTAEILTYANMIPTRDGGTHLTAFKG
                     AYSRALNQYAKKAGLHKEKGPQPTGDDLLEGLYAVVSVKLPQPQFEGQTKGKLLNPEA
                     GSAVSQVVYEKLLEILEENPRIAKTLYEKALRAAQAREAARKARELVRRQNPLESDDL
                     PGKLADCQTENPEEAELFIVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVEKAGLSKA
                     LKNAEVRAMVAAIGAGIGGTGDEAHFDLEGLRYHKIIIMTDADVDGSHIRTLLLTFFY
                     RYMRPLIEGGYVYIAQPPLYRLQVGKRVEYLYSDEALAARLKELEGKAYEVQRFKGLG
                     EMNPEQLWETTMNPEKRVLKRVELQDALEASELFEKLMGQEVAPRREFIEEHARYAQL
                     DI"
     misc_feature    complement(449976..451850)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    complement(<451506..451781)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(451530..451541,451656..451661,
                     451665..451667,451671..451673,451677..451679,
                     451743..451745,451752..451754,451764..451766))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(451752..451754)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(451533..451535,451539..451541,
                     451659..451661,451665..451667))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(450765..451229)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(451074..451076)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(450882..450884,450888..450893,
                     450900..450902))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(450876..450878,450882..450884))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(450279..450635)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     misc_feature    complement(order(450369..450371,450375..450377,
                     450381..450383,450603..450605,450612..450617))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="active site"
                     /db_xref="CDD:173773"
     misc_feature    complement(order(450381..450383,450615..450617))
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173773"
     misc_feature    complement(450006..450197)
                     /locus_tag="TCCBUS3UF1_4320"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(451877..451996)
                     /locus_tag="TCCBUS3UF1_4330"
                     /db_xref="GeneID:12251788"
     CDS             complement(451877..451996)
                     /locus_tag="TCCBUS3UF1_4330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653555.1"
                     /db_xref="GI:384438831"
                     /db_xref="GeneID:12251788"
                     /translation="MGKPPMQFGLKPNRLGRLEGTSGLPQGKNRREAYGILGG"
     gene            452024..452410
                     /locus_tag="TCCBUS3UF1_4340"
                     /db_xref="GeneID:12251789"
     CDS             452024..452410
                     /locus_tag="TCCBUS3UF1_4340"
                     /note="similar to DNA polymerase III subunits gamma and
                     tau PRK07764;
                     similar to Putative uncharacterized protein TTHA1585 of
                     Thermus thermophilus UniRef RepID=Q5SHZ5_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653556.1"
                     /db_xref="GI:384438832"
                     /db_xref="GeneID:12251789"
                     /translation="MPVLVYLHALLGVFLLLAVPALALVGLWGFLRPLPPRFYAGLRG
                     VAWVAILQVVLGFLLFFLGLRPKEGLHLLYGLLLAAGLHYLGGLEPGGWFHRGLKDPP
                     KRPELFVALGLLFALGLVLRVYFTGR"
     gene            complement(452397..453599)
                     /locus_tag="TCCBUS3UF1_4350"
                     /db_xref="GeneID:12251790"
     CDS             complement(452397..453599)
                     /locus_tag="TCCBUS3UF1_4350"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653557.1"
                     /db_xref="GI:384438833"
                     /db_xref="GeneID:12251790"
                     /translation="MTPLPRTSLGQVPTPAALVAFMVGLAEAPLGGRVLEPACAHGPF
                     LRAFREVHGAGYRFYGVEVDRKALDLPPWAHGVVTDFLLWEPQEAFDLILGNPPYGAL
                     GAGARIPPGLRRLYRGRFRTWRGRYNLYGAFLEKGVELLRPGGLLVYVVPAGWMVLEE
                     FRELRAFLAREGALEVYYLGRVFPGLKVRATVLAFRKGGKGLRLWEAEGLALGASPAP
                     LLEDPHWQGAMIRFPHPEGLALEREGVPLGEAFHLHFAARSPEIKAHPLTRPAPGPGL
                     VPVLTGRNLGPGTVDYATPYSGLYFPKGAVHLLKPFYALPHLVVGHTRHYRVVAAWDE
                     RAYPWREEFHLLPKEGVRVDPEGLVAYLNGPLVQAYYRGLYREVVPHLTRPMLERLPL
                     PRDLLTAR"
     misc_feature    complement(453147..453503)
                     /locus_tag="TCCBUS3UF1_4350"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(453312..453314,453357..453365,
                     453411..453416,453471..453491))
                     /locus_tag="TCCBUS3UF1_4350"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     misc_feature    complement(452424..452771)
                     /locus_tag="TCCBUS3UF1_4350"
                     /note="TaqI-like C-terminal specificity domain; Region:
                     TaqI_C; pfam12950"
                     /db_xref="CDD:257424"
     gene            complement(453601..454788)
                     /locus_tag="TCCBUS3UF1_4360"
                     /db_xref="GeneID:12251791"
     CDS             complement(453601..454788)
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="similar to 2-amino-3-ketobutyrate coenzyme A ligase
                     PRK06939;
                     similar to 8-amino-7-oxononanoate
                     synthase/2-amino-3-ketobutyrate coenzyme A ligase of
                     cellular organisms UniRef RepID=BIKB_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_005653558.1"
                     /db_xref="GI:384438834"
                     /db_xref="GeneID:12251791"
                     /translation="MSLSLRERVQEELERLKREGLYIRPRVLEAPQEPVTRVDGREVV
                     NLASNNYLGFANHPYLKEKARAYLERWGAGSGAVRTIAGTFTYHLELEEALARFKGTE
                     SALVLQSGFTANQGVLGSLLKEGDLVFSDELNHASIIDGLRLTKATRLVYRHADVDHL
                     EELLKAHDTDGLKLIVTDGVFSMDGDIAPLDRIVPLAKKYGAVVYVDDAHGSGVLGEK
                     GKGTVHHFGFHGDPDVIQVATLSKAWAVVGGYAAGALELKDLLINKARPFLFSTSHPP
                     AVVGALLGALELIEREPERVERLWENTRYFKAELARLGYDTLGSQTPITPVLFGEAPV
                     AFEASRMLLEEGVFAVGIGFPTVPRGKARIRNIVTAAHTQEMLDRALEAYAKVGRRLG
                     LIP"
     misc_feature    complement(453640..454713)
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    complement(453625..454668)
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(453694..453696,454063..454065,
                     454072..454074,454159..454164,454168..454170,
                     454240..454245,454255..454257,454384..454386,
                     454456..454464,454642..454644))
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(order(454063..454065,454072..454074,
                     454159..454164,454168..454170,454243..454245,
                     454255..454257,454384..454386,454456..454464))
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    complement(454063..454065)
                     /locus_tag="TCCBUS3UF1_4360"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            454941..456485
                     /locus_tag="TCCBUS3UF1_4370"
                     /db_xref="GeneID:12251792"
     CDS             454941..456485
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="similar to Aqualysin-1 of Bacteria UniRef
                     RepID=AQL1_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="Aqualysin-1"
                     /protein_id="YP_005653559.1"
                     /db_xref="GI:384438835"
                     /db_xref="GeneID:12251792"
                     /translation="MVHTYRAWLLGGVLLLLAACQVGPTGQGPARGPEATLAPVYNAE
                     SPDAVPGQYIVVFKKGAAEATLAALQADREGLAPLGLTPQEVRIQAVYTEALEGFAAQ
                     LSVRALDTLRKDPRVEFIEADTYVRLQATQTNPPWGLDRIDQRGLPLDARYTYTLTGA
                     GVNVYVIDTGIRTTHADFGGRAFVAYDALGGNGQDCNGHGTHVAGTVGGTTYGVAKGV
                     RLYAVRVLDCNGSGTNSGVIAGVNWVLQNHVKPAVANMSLGGVASTALDTAVKNAIAA
                     GVTFAVAAGNENQDACLSSPARVPEALTVGATTNTDARASFSNYGSCLDIFAPGQNIL
                     SAWHTSDAATNTISGTSMATPHVAGVAALYLQQNPTTTPSQVAAAILNGATPGVVSGG
                     GTGSPNRLLYSLVSGGGSDEPCTGCEKYTGTLSQGASAYQPNGSYYYSSISGTHEGYL
                     QGPSGTDFDLYLQKWNGAAWTTVASATTASSTESIRYSGTAGYYRWRIYAYSGSGAYT
                     FWMKRP"
     misc_feature    455094..455327
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="Peptidase inhibitor I9; Region: Inhibitor_I9;
                     pfam05922"
                     /db_xref="CDD:253461"
     misc_feature    455349..456098
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="Peptidase S8 family domain in ProteinaseK-like
                     proteins; Region: Peptidases_S8_PCSK9_ProteinaseK_like;
                     cd04077"
                     /db_xref="CDD:173790"
     misc_feature    order(455358..455360,455367..455372)
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="calcium binding site 2 [ion binding]; other site"
                     /db_xref="CDD:173790"
     misc_feature    455430..456098
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    order(455442..455444,455535..455537,455712..455717,
                     455796..455798,455982..455984,455991..455993)
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="active site"
                     /db_xref="CDD:173790"
     misc_feature    order(455442..455444,455535..455537,455991..455993)
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:173790"
     misc_feature    order(455838..455840,455844..455846,455913..455915)
                     /locus_tag="TCCBUS3UF1_4370"
                     /note="calcium binding site 1 [ion binding]; other site"
                     /db_xref="CDD:173790"
     gene            456617..457528
                     /locus_tag="TCCBUS3UF1_4380"
                     /db_xref="GeneID:12251793"
     CDS             456617..457528
                     /locus_tag="TCCBUS3UF1_4380"
                     /note="similar to motif PHA03245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005653560.1"
                     /db_xref="GI:384438836"
                     /db_xref="GeneID:12251793"
                     /translation="MRGHLQAETEAERLERRVKLLELLHRLRGEPDELLPFHQALALR
                     PKGEHHLGLRTIEVDKVVGSVDRYEDFDRHFLPKTLHTLERWKRLRALQLEGVELPPI
                     EVYQVGEAYFVKDGHHRVALAKATGQKYMDAYVIALDVPVPVEPGDTLKDLILKAEYA
                     HFLEQTRLKELVPDAEEIRFTALGRYDLLLDHIATRRYFKGLEEGREVSWEEAVVDWY
                     QNLYRPTVEAIRRLGLLRDFPGRTEADLYLWVMDHRYFLAQELGVDLGPEGAARSYEA
                     RFGPRWKRLGGWLKWLFKHSIQIPFDF"
     misc_feature    <457208..457438
                     /locus_tag="TCCBUS3UF1_4380"
                     /note="Domain of unknown function (DUF4032); Region:
                     DUF4032; pfam13224"
                     /db_xref="CDD:257582"
     gene            458504..459163
                     /locus_tag="TCCBUS3UF1_4390"
                     /db_xref="GeneID:12251794"
     CDS             458504..459163
                     /locus_tag="TCCBUS3UF1_4390"
                     /note="similar to Transcriptional regulators COG1802;
                     similar to Transcriptional regulator, GntR family of
                     Thermaceae UniRef RepID=Q5SI00_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005653561.1"
                     /db_xref="GI:384438837"
                     /db_xref="GeneID:12251794"
                     /translation="MQALGFRRPNQVREAVYGHLKALLLSGRFAPGERLSEPLLAQEL
                     GVSRTPVREALMRLAEEGLVELVPGKGARVRVFTLEEVEEVYGVRALLEGEAAREAAL
                     RATPWELAELEARLRAIDEAPAEDYPEQMRRDLEFHRGLVRLSGNKTLARLYEDLLSS
                     LALVRSALPTLSQDEATREEHRAILEALRRRDPEGAKRAVEAHVARFRDLVVEALRRR
                     V"
     misc_feature    458504..459157
                     /locus_tag="TCCBUS3UF1_4390"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    458543..458728
                     /locus_tag="TCCBUS3UF1_4390"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(458612..458617,458639..458653,458657..458662,
                     458669..458671,458699..458704,458708..458719)
                     /locus_tag="TCCBUS3UF1_4390"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    458753..459121
                     /locus_tag="TCCBUS3UF1_4390"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            459160..460083
                     /locus_tag="TCCBUS3UF1_4400"
                     /db_xref="GeneID:12251795"
     CDS             459160..460083
                     /locus_tag="TCCBUS3UF1_4400"
                     /note="similar to Proline
                     dehydrogenase/delta-1-pyrroline-5-carboxylate
                     dehydrogenase of Thermaceae UniRef RepID=Q72IB8_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Proline
                     dehydrogenase/delta-1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /protein_id="YP_005653562.1"
                     /db_xref="GI:384438838"
                     /db_xref="GeneID:12251795"
                     /translation="MNLDLLYRQAVLSVAGNPRVEGLIKTRARSLVRRYVAGESLEEA
                     LRAAEGLERQGVHAILDLLGEMVRSEAEARAFQAGILELVRRVAERPWPKYVSLKPTQ
                     LGLDLSEGLALELLREILREAEPRGVFVRMDMEDSPRVEATLRLYRALREEGFSGVGI
                     VLQSYLFRTEKDLLDLLPYRPNLRLVKGAYREPKEVAFQDKRLIDAQFLHLGKLALRE
                     GLYVAFATHDPRLIAEVKRYAEAMGFPKTAFEFQLLYGVRPEEQRRLAQEGYTVRAYV
                     PYGRDWYPYLSRRIAERPENLFLVLRSLLGG"
     misc_feature    459265..460065
                     /locus_tag="TCCBUS3UF1_4400"
                     /note="Proline dehydrogenase; Region: Pro_dh; pfam01619"
                     /db_xref="CDD:250750"
     gene            460094..461644
                     /locus_tag="TCCBUS3UF1_4410"
                     /db_xref="GeneID:12251796"
     CDS             460094..461644
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="similar to 1-pyrroline-5-carboxylate dehydrogenase
                     PRK03137;
                     similar to Delta-1-pyrroline-5-carboxylate dehydrogenase 2
                     of Bacteria UniRef RepID=Q1J032_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Delta-1-pyrroline-5-carboxylate dehydrogenase 2"
                     /protein_id="YP_005653563.1"
                     /db_xref="GI:384438839"
                     /db_xref="GeneID:12251796"
                     /translation="MTVEPFRNQPIETFASEEARREMKEALRRVRAEFGRHWGLYVDG
                     AWVDTGETILSLNPSAPSEVVGSTAKAGKAEADAALEAAWRAFRTWKDWPQEDRSRLL
                     LKAAAIMRRRRRELEATLVYEIGKNWVEASAEVAEAIDFLEYYARQALRYKYPSVEVV
                     PYPGEDNESFYIPLGAGVVIAPWNFPLAIFTGMIAGPVAVGNTVVAKPAEDTVVIAAK
                     AFEIFHEAGFPPGVVNLLPGEGRDVGAYLVEHPRTRFINFTGSLEVGLWIHQAAARLA
                     PGQRWIKRVFLELGGKDAILVDETADLEAATEGILVSAYGFQGQKCSAASRLIVTEGA
                     FEPLMERLLPRAQRLVVGPAEENPDLGPVASKAQEEKILSYIEIGKGEGQLVLGGVRL
                     EGEGYFIAPTVFTGVPPTAKIAQEEIFGPVLSVIRVGDFAEALEVANSTVYGLTGGVY
                     SRKREHLEWARREFHVGNLYFNRKITGALVGVQPFGGFNLSGTNTKAGGPDYLLHFLE
                     MKSVAERF"
     misc_feature    460109..461641
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="Delta(1)-pyrroline-5-carboxylate dehydrogenase,
                     RocA; Region: ALDH_PutA-P5CDH-RocA; cd07124"
                     /db_xref="CDD:143442"
     misc_feature    order(460502..460504,460643..460648,460658..460660,
                     460955..460957,461051..461062,461501..461503,
                     461516..461518,461522..461527,461546..461548)
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="Glutamate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143442"
     misc_feature    order(460571..460573,460577..460579,460592..460600,
                     460604..460606,460898..460903,460910..460912,
                     460940..460942,461453..461455,461474..461476,
                     461483..461485,461489..461506,461510..461512,
                     461528..461530,461534..461545,461555..461560,
                     461573..461575,461579..461581,461594..461596,
                     461603..461605,461615..461638)
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143442"
     misc_feature    order(460631..460636,460712..460714,460718..460723,
                     460811..460813,460865..460867,460874..460876,
                     460883..460885)
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143442"
     misc_feature    order(460643..460645,460955..460957,461048..461050,
                     461057..461059)
                     /locus_tag="TCCBUS3UF1_4410"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143442"
     gene            461784..463172
                     /locus_tag="TCCBUS3UF1_4420"
                     /db_xref="GeneID:12251797"
     CDS             461784..463172
                     /locus_tag="TCCBUS3UF1_4420"
                     /note="similar to anthranilate synthase component I
                     PRK13565;
                     similar to Anthranilate synthase component 1 of Deinococci
                     UniRef RepID=TRPE_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Anthranilate synthase component 1"
                     /protein_id="YP_005653564.1"
                     /db_xref="GI:384438840"
                     /db_xref="GeneID:12251797"
                     /translation="MEPIRPFRKTLLADLETPVTAYLKLSEKAPVSFLLESVERGRQS
                     RFSIVGVGSRRTFRLKDGVFTVNGKPVPTQDPLRTLYEAVHAPLERHPDLPPFFGGVV
                     GYAAYDLIRHYERLPSLKPDDLGLPDLLFVEPEVVLVFDHLKSLLHLVAPGRDPEEAE
                     ARLRWAEGRLKGPLPGVPGERAGGRARFRADLAREAYLEAVERALAYIRAGDIFQVVL
                     SLRLSSPLTVHPFALYRALRSVNPSPYMGYLDLGEVVLVSASPESLLRSDGRKVVTRP
                     IAGTRPRGKDEEEDQRLAEELLRDEKERAEHVMLLDLSRNDLGRVAAFGSVRVVEPMH
                     VEMYSHVMHLVSTVEGVLAEGKTPLDALASVLPMGTVSGAPKIRAMEIIEELEPHRRG
                     PYGGSFGYLAYDGAMDVALTLRTFVIAQGQMHVQAGAGIVADSVPEREYEECGNKARA
                     LLRAVEMAEEGL"
     misc_feature    461799..463166
                     /locus_tag="TCCBUS3UF1_4420"
                     /note="Anthranilate/para-aminobenzoate synthases component
                     I [Amino acid transport and metabolism / Coenzyme
                     metabolism]; Region: TrpE; COG0147"
                     /db_xref="CDD:223225"
     misc_feature    461823..462230
                     /locus_tag="TCCBUS3UF1_4420"
                     /note="Anthranilate synthase component I, N terminal
                     region; Region: Anth_synt_I_N; pfam04715"
                     /db_xref="CDD:252755"
     misc_feature    462363..463124
                     /locus_tag="TCCBUS3UF1_4420"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     pfam00425"
                     /db_xref="CDD:249850"
     gene            463174..463755
                     /locus_tag="TCCBUS3UF1_4430"
                     /db_xref="GeneID:12251798"
     CDS             463174..463755
                     /locus_tag="TCCBUS3UF1_4430"
                     /note="similar to anthranilate synthase component II
                     PRK05670;
                     similar to Anthranilate synthase component II of cellular
                     organisms UniRef RepID=TRPG_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Anthranilate synthase component II"
                     /protein_id="YP_005653565.1"
                     /db_xref="GI:384438841"
                     /db_xref="GeneID:12251798"
                     /translation="MRVLVIDNYDSFTYNLVQYLGELGANPIVWRNDQFALEEVEALD
                     PDRILISPGPCTPLEAGLSLPLIARYAPRYPILGVCLGHQAIGMAFGGKVVPAPLLMH
                     GKVSAIHHDGTGVFRGLPNPFPATRYHSLVVEAVPEALEVNAWVEEAGGRTVMGFRHR
                     DLPTHGVQFHPESYLTEAGKRLLKNFLEDPWTR"
     misc_feature    463180..463734
                     /locus_tag="TCCBUS3UF1_4430"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Anthranilate synthase; Region:
                     GATase1_Anthranilate_Synthase; cd01743"
                     /db_xref="CDD:153214"
     misc_feature    463180..463734
                     /locus_tag="TCCBUS3UF1_4430"
                     /note="para-aminobenzoate synthase component II;
                     Provisional; Region: PRK08857"
                     /db_xref="CDD:181566"
     misc_feature    order(463327..463332,463336..463338,463411..463416,
                     463423..463425,463555..463566)
                     /locus_tag="TCCBUS3UF1_4430"
                     /note="glutamine binding [chemical binding]; other site"
                     /db_xref="CDD:153214"
     misc_feature    order(463411..463413,463681..463683,463687..463689)
                     /locus_tag="TCCBUS3UF1_4430"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153214"
     gene            463743..464732
                     /locus_tag="TCCBUS3UF1_4440"
                     /db_xref="GeneID:12251799"
     CDS             463743..464732
                     /locus_tag="TCCBUS3UF1_4440"
                     /note="similar to anthranilate phosphoribosyltransferase
                     PRK00188;
                     similar to Anthranilate phosphoribosyltransferase of
                     Thermus aquaticus Y51MC23 UniRef RepID=B7AC10_THEAQ"
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="YP_005653566.1"
                     /db_xref="GI:384438842"
                     /db_xref="GeneID:12251799"
                     /translation="MDAVRKALLGQVLSEEEAYGLMGAMMRGEVSPVQTAGVLTAMAL
                     RGETPGEIAAMARAMREAARPLRVGRRPLLDLVGTGGDHQGLLNLSTLGALVAAAGGV
                     AVAKHGNRAASSKAGSADLLEALGVDLEAPPERVGEAIEALGFGFLFARVFHPAMRHV
                     APVRAELGIRTVFNLLGPLTNPAGADRYVLGVYSPRWLSPMADALERLGARGLVVHGQ
                     GADELVLGETQVVEVGKGAYTLTPEAVGLSQHPLAALRGGSPAENAQLARRLLKGEER
                     GPLAEAVALAAGAGLYAAGKAESLEKGVRLAQEVLASGEAYLLLERYVAFLKG"
     misc_feature    463743..464729
                     /locus_tag="TCCBUS3UF1_4440"
                     /note="anthranilate phosphoribosyltransferase;
                     Provisional; Region: trpD; PRK00188"
                     /db_xref="CDD:234682"
     misc_feature    463746..463910
                     /locus_tag="TCCBUS3UF1_4440"
                     /note="Glycosyl transferase family, helical bundle domain;
                     Region: Glycos_trans_3N; pfam02885"
                     /db_xref="CDD:251593"
     misc_feature    463956..464693
                     /locus_tag="TCCBUS3UF1_4440"
                     /note="Glycosyl transferase family, a/b domain; Region:
                     Glycos_transf_3; pfam00591"
                     /db_xref="CDD:249986"
     gene            complement(464740..465966)
                     /locus_tag="TCCBUS3UF1_4450"
                     /db_xref="GeneID:12251800"
     CDS             complement(464740..465966)
                     /locus_tag="TCCBUS3UF1_4450"
                     /note="similar to adenylosuccinate synthetase PRK13788;
                     similar to Adenylosuccinate synthetase of Deinococci
                     UniRef RepID=PURA_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="YP_005653567.1"
                     /db_xref="GI:384438843"
                     /db_xref="GeneID:12251800"
                     /translation="MPGIAIIGAQWGDEGKGKVVDALAKEADYVIRYQGGANAGHTVV
                     AEGRVFKLNLLPSGVIHPHAVNVLGDGMVIDPFRLQEELLALEREGFRPKVLVSERAH
                     LVLPHHKHVESRHNFVGTTGRGIGPAYSDRARRVGIRAGDLLDEGVLQERVRRLLLEK
                     PNSTREAGWDTETKALEDLRRMREILAPYVADTGSLLREAVRKGKRLLFEGAQATLLD
                     LNYGTYPYVTSSHPTVGGILVGTGLSHKALTKVYGVAKAYATRVGEGPFPTEIHGDLA
                     HHLREKGGEYGTTTGRPRRVGWLDLVALKYACEVNGFDGLALTKLDVLSGLPRVKVAV
                     EYLDGARPGEARPEAVRYLELPGWGELSGIRGREDLPKSLLRYLELIEEHTGIPVVLF
                     STSPRREDTFGAVSWV"
     misc_feature    complement(464779..465960)
                     /locus_tag="TCCBUS3UF1_4450"
                     /note="Adenylosuccinate synthetase (AdSS) catalyzes the
                     first step in the de novo biosynthesis of AMP. IMP and
                     L-aspartate are conjugated in a two-step reaction
                     accompanied by the hydrolysis of GTP to GDP in the
                     presence of Mg2+. In the first step, the...; Region: AdSS;
                     cd03108"
                     /db_xref="CDD:239382"
     misc_feature    complement(order(464779..464784,465001..465003,
                     465007..465009,465835..465837,465841..465849,
                     465916..465924,465928..465930))
                     /locus_tag="TCCBUS3UF1_4450"
                     /note="GDP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239382"
     misc_feature    complement(order(465844..465846,465913..465915,
                     465922..465924))
                     /locus_tag="TCCBUS3UF1_4450"
                     /note="ACT binding site; other site"
                     /db_xref="CDD:239382"
     misc_feature    complement(order(465283..465285,465328..465330,
                     465604..465606,465613..465615,465853..465855))
                     /locus_tag="TCCBUS3UF1_4450"
                     /note="IMP binding site; other site"
                     /db_xref="CDD:239382"
     gene            complement(465978..466865)
                     /locus_tag="TCCBUS3UF1_4460"
                     /db_xref="GeneID:12251801"
     CDS             complement(465978..466865)
                     /locus_tag="TCCBUS3UF1_4460"
                     /note="similar to 2,5-diketo-D-gluconate reductase A
                     PRK11565;
                     similar to Aldo/keto reductase of Meiothermus UniRef
                     RepID=D3PMU4_MEIRD"
                     /codon_start=1
                     /transl_table=11
                     /product="Aldo/keto reductase"
                     /protein_id="YP_005653568.1"
                     /db_xref="GI:384438844"
                     /db_xref="GeneID:12251801"
                     /translation="MNPLFSHFMGVGTWAWGDRLFWGYGRDYGEGDLREAFRESLLAG
                     VGLWDTAEFYGFGLSERLLGQFMREAGVRPYLVTKFFPYPWRLSRKDLLRALRGSLGR
                     LGVEAVDLYLLHWPWPPVPLRVWAEALAEAHERGLARGVGVANASMAQLETVKGVLDR
                     HRVPLLANQVEYSLLQRGWEAHLPALRREGIALMAYSPLAMGWLTGKLDPDRPPKGYR
                     GAKYRPLLAGVRRLLPLLRELAEAKGVSPSAIALRYLVEKGALPIPGAKNALQARQNA
                     EALRIALSPEEVARLEGAS"
     misc_feature    complement(465984..466841)
                     /locus_tag="TCCBUS3UF1_4460"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    complement(465990..466841)
                     /locus_tag="TCCBUS3UF1_4460"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    complement(order(466041..466046,466053..466055,
                     466068..466079,466122..466124,466263..466280,
                     466359..466361,466431..466436,466521..466526,
                     466629..466631,466704..466706,466719..466721,
                     466824..466832))
                     /locus_tag="TCCBUS3UF1_4460"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    complement(order(466524..466526,466629..466631,
                     466704..466706,466719..466721))
                     /locus_tag="TCCBUS3UF1_4460"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(466862..467530)
                     /locus_tag="TCCBUS3UF1_4470"
                     /db_xref="GeneID:12251802"
     CDS             complement(466862..467530)
                     /locus_tag="TCCBUS3UF1_4470"
                     /note="similar to Transporter of Bacteria UniRef
                     RepID=Q72GT3_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="Transporter"
                     /protein_id="YP_005653569.1"
                     /db_xref="GI:384438845"
                     /db_xref="GeneID:12251802"
                     /translation="MRYLDLITALFATVLLVSNVASTKLVVLGPFTFDGGTLLFPLAY
                     IFGDVLTEVYGYRKSRRVIWTGFLALLLATLTFQAVAALPAPPDGESQRYGQAFTLLL
                     GLTPRIVLGSLLAYFAGEFANAYVLARLKVRTAGRLFWLRALASTLVGQGLDTALFLL
                     VAFYGVLPPEVLLAVFLSNYAFKLGVEALMLPLTYLVVGFLKRAEGLDVYDRDTDFNP
                     FRLA"
     misc_feature    complement(466982..467431)
                     /locus_tag="TCCBUS3UF1_4470"
                     /note="Uncharacterized ACR, YhhQ family COG1738; Region:
                     DUF165; pfam02592"
                     /db_xref="CDD:251400"
     gene            complement(467527..468072)
                     /locus_tag="TCCBUS3UF1_4480"
                     /db_xref="GeneID:12251803"
     CDS             complement(467527..468072)
                     /locus_tag="TCCBUS3UF1_4480"
                     /note="similar to Hypoxanthine-guanine
                     phosphoribosyltransferase of Deinococci UniRef
                     RepID=Q5SLS3_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="YP_005653570.1"
                     /db_xref="GI:384438846"
                     /db_xref="GeneID:12251803"
                     /translation="MKGMFTAGNGPVQISAEAIGKRVAELGQEIARDYQGKTPHLICV
                     LNGAFIFMADLVRAIPLPLTLDFISISSYGNAYRTSGEVELIKDLRLPIHGRDVIVVE
                     DIVDSGLTLAYLLDYLEARKPASVRVAALLSKPSRRQVEVPIHYLGFEIQDAYVYGYG
                     LDRAQFDRNLPFITSIRPEEE"
     misc_feature    complement(467632..468006)
                     /locus_tag="TCCBUS3UF1_4480"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(467671..467673,467743..467757,
                     467761..467769,467932..467934,467938..467940))
                     /locus_tag="TCCBUS3UF1_4480"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(468069..468770)
                     /locus_tag="TCCBUS3UF1_4490"
                     /db_xref="GeneID:12251804"
     CDS             complement(468069..468770)
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="similar to 16S rRNA uridine-516 pseudouridylate
                     synthase and related pseudouridylate synthases COG1187;
                     similar to RNA-binding S4 domain protein of Meiothermus
                     UniRef RepID=D7BDM3_9DEIN"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding S4 domain-containing protein"
                     /protein_id="YP_005653571.1"
                     /db_xref="GI:384438847"
                     /db_xref="GeneID:12251804"
                     /translation="MMRLQAYLARAGVASRRKAEALIRQGRVRVNGAVAVLGQKVGPE
                     DLVEVDGKRVPPPGERVVLALHKPRGYTTTRADPHARRTVYELLPPIPGLQAAGRLDR
                     DSEGLLLFTNDGHLALRLTHPRYGVRKVYRVWTEGGTLPPGVCRKLLEGVELEDGPAR
                     ALACRPAPGGGFLTLAEGRKREVRRMLQAVGYPVKRLLRVQVGPIRLGDLPPGKWRRL
                     SEAEVAALLGESPVE"
     misc_feature    complement(468090..468770)
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    complement(468573..468767)
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(order(468645..468647,468651..468662,
                     468663..468671,468690..468692,468696..468701,
                     468708..468713,468717..468722,468726..468731,
                     468762..468764))
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    complement(468165..468587)
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="Pseudouridine synthases, RsuA subfamily; Region:
                     PseudoU_synth_RsuA_like; cd02870"
                     /db_xref="CDD:211347"
     misc_feature    complement(order(468219..468221,468468..468479))
                     /locus_tag="TCCBUS3UF1_4490"
                     /note="active site"
                     /db_xref="CDD:211347"
     gene            complement(468767..469555)
                     /locus_tag="TCCBUS3UF1_4500"
                     /db_xref="GeneID:12251805"
     CDS             complement(468767..469555)
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="similar to enoyl-CoA hydratase PRK07327;
                     similar to Enoyl-CoA hydratase of Bacteria UniRef
                     RepID=Q5SLS5_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase"
                     /protein_id="YP_005653572.1"
                     /db_xref="GI:384438848"
                     /db_xref="GeneID:12251805"
                     /translation="MDLEARYPSLRFAWPRPGVLEVGFRGEKLNALGPQAHRELAQVW
                     RDLESLGEVRAVLLRGEGGVFSAGGSFALIEEIQASHQARMRVFWEARELVLGPLNFP
                     RPVVAAVEGVAVGAGLALALAADVAVVGKGARLLDGHLRLGVAAGDHAVLLWPLLVGM
                     AKAKYHLLLGKPLTGEEAERLGLVALAVEDGEVYGKALEVAERLARGPKEALHHTKHA
                     LNGWLRAFLPQFEVSLALEFLGFTGEEVQAGLRALKEKREPEFP"
     misc_feature    complement(468773..469516)
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    complement(468944..469510)
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(469130..469132,469139..469144,
                     469343..469357,469367..469369,469463..469465,
                     469469..469471))
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    complement(469349..469351)
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(order(468944..468949,468956..468958,
                     469001..469003,469010..469012,469043..469045,
                     469052..469057,469061..469066,469070..469075,
                     469088..469093,469097..469105,469109..469111,
                     469127..469138,469244..469246,469268..469270))
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     misc_feature    complement(468773..>469084)
                     /locus_tag="TCCBUS3UF1_4500"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cl18948"
                     /db_xref="CDD:267301"
     gene            469601..470539
                     /locus_tag="TCCBUS3UF1_4510"
                     /db_xref="GeneID:12251806"
     CDS             469601..470539
                     /locus_tag="TCCBUS3UF1_4510"
                     /note="similar to tRNA pseudouridine synthase B PRK14122;
                     similar to tRNA pseudouridine synthase B of Thermaceae
                     UniRef RepID=TRUB_THET2"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="YP_005653573.1"
                     /db_xref="GI:384438849"
                     /db_xref="GeneID:12251806"
                     /translation="MALYAVDKPLHLTSHDAVEEARRRLGTRRVGHTGTLDPLATGLL
                     LLVSEESTKLVPFLSGEEKEYLAWVSFGATTPTLDAEGPVSEEAPVRFDRRDLESVLP
                     SFLGLKEQVPPLYSAIKVGGKRAYEAAREGRPLELGPRPVRYVEVELLALDPEPIPHP
                     IAPSARGWRLAEKGGRRVELPRPLGAYPTAVIRLVVGPGTYVRAFARDLGEKLKTKAF
                     LSGLVRTRIGKVGLERSVRLAELSPEKAIPEPDVLPFPVVELSHTEARRVLEGIPLPI
                     PALGYVTLVDSRRRLLAIAEGDGFKLKIRRVFVKEA"
     misc_feature    469601..470530
                     /locus_tag="TCCBUS3UF1_4510"
                     /note="tRNA pseudouridine synthase B; Provisional; Region:
                     PRK14122"
                     /db_xref="CDD:184521"
     misc_feature    469607..470332
                     /locus_tag="TCCBUS3UF1_4510"
                     /note="Pseudouridine synthase, Escherichia coli TruB like;
                     Region: PseudoU_synth_EcTruB; cd02573"
                     /db_xref="CDD:211339"
     misc_feature    order(469637..469639,469643..469645,469652..469654,
                     469688..469696,469700..469714,469754..469756,
                     469763..469768,469775..469777,469787..469789,
                     469793..469795,469943..469957,470018..470020,
                     470192..470209,470270..470272)
                     /locus_tag="TCCBUS3UF1_4510"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:211339"
     misc_feature    order(469700..469711,470207..470209)
                     /locus_tag="TCCBUS3UF1_4510"
                     /note="active site"
                     /db_xref="CDD:211339"
     gene            470542..471651
                     /locus_tag="TCCBUS3UF1_4520"
                     /db_xref="GeneID:12251807"
     CDS             470542..471651
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="similar to Alanine dehydrogenase COG0686;
                     similar to Alanine dehydrogenase of cellular organisms
                     UniRef RepID=DHA_STAHJ"
                     /codon_start=1
                     /transl_table=11
                     /product="Alanine dehydrogenase"
                     /protein_id="YP_005653574.1"
                     /db_xref="GI:384438850"
                     /db_xref="GeneID:12251807"
                     /translation="MVIGVPKEIKTLENRVALTPGGVESLVKRGHTVLVERGAGVGSG
                     LSDAEYERAGAELVSREEAWGAGMVVKVKEPLPEEYSFLREGLILFTYLHLAADRTLT
                     EAMLRSGVTGVAYETVQLPDGSLPLLVPMSEVAGRMAPQVGAQFLEKPHGGRGVLLGG
                     VPGVAPASVVILGGGTVGTNAAKIALGMGAQVTILDVNHRRLQYLDDVFGGRVVTLTA
                     TEANIKKSIQHADLLIGAVLVPGAKAPKLVTREMLPLMKEGSVIVDVAVDQGGCVETI
                     RPTTHAEPTYVVDGVVHYGVANMPGAVPRTSTFALTNQTLPYVLRLAERGLEALREDE
                     ALLKGLNTHKGFLTHPGVAEAFGLPYTPPEEALRR"
     misc_feature    470542..471642
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="Alanine dehydrogenase [Amino acid transport and
                     metabolism]; Region: Ald; COG0686"
                     /db_xref="CDD:223758"
     misc_feature    470542..471609
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="Alanine dehydrogenase NAD-binding and catalytic
                     domains; Region: L-AlaDH; cd05305"
                     /db_xref="CDD:240630"
     misc_feature    order(470575..470577,470581..470583,470599..470604,
                     470665..470667,470671..470673,470938..470943,
                     470950..470955,470962..470964,470971..470979,
                     470983..470985,471001..471033,471037..471039,
                     471076..471078,471088..471093,471100..471105,
                     471112..471114,471136..471138,471145..471150,
                     471157..471171,471175..471177,471181..471192,
                     471382..471384,471445..471459,471466..471471,
                     471478..471480,471487..471492)
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240630"
     misc_feature    order(470584..470586,470758..470760,470815..470817,
                     471433..471435)
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     misc_feature    order(470821..470823,471343..471345)
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="putative active site [active]"
                     /db_xref="CDD:240630"
     misc_feature    order(470923..470925,470932..470937,470944..470946,
                     471055..471060,471064..471072,471124..471132,
                     471142..471144,471193..471195,471247..471255,
                     471280..471282,471334..471336,471343..471348,
                     471427..471441)
                     /locus_tag="TCCBUS3UF1_4520"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240630"
     gene            471653..471994
                     /locus_tag="TCCBUS3UF1_4530"
                     /db_xref="GeneID:12251808"
     CDS             471653..471994
                     /locus_tag="TCCBUS3UF1_4530"
                     /note="similar to Alkaline shock protein of Deinococci
                     UniRef RepID=Q5SLS8_THET8"
                     /codon_start=1
                     /transl_table=11
                     /product="Alkaline shock protein"
                     /protein_id="YP_005653575.1"
                     /db_xref="GI:384438851"
                     /db_xref="GeneID:12251808"
                     /translation="MQGRVTITESALASLLGLAAHEVPGVVGMAPAGLKDQVVRILGR
                     QEASEGVVVRQDPMNPGRYTADFYVVVAVGTRIPTVVESLAERVAFAAKKLAGVEFSQ
                     VRVHVVGVGRG"
     misc_feature    471659..471967
                     /locus_tag="TCCBUS3UF1_4530"
                     /note="Asp23 family; Region: Asp23; cl00574"
                     /db_xref="CDD:260510"
     gene            471987..473552
                     /locus_tag="TCCBUS3UF1_4540"
                     /db_xref="GeneID:12251809"
     CDS             471987..473552
                     /locus_tag="TCCBUS3UF1_4540"
                     /note="similar to Dak phosphatase related protein of
                     Deinococci UniRef RepID=Q1IXL7_DEIGD"
                     /codon_start=1
                     /transl_table=11
                     /product="Dak phosphatase protein"
                     /protein_id="YP_005653576.1"
                     /db_xref="GI:384438852"
                     /db_xref="GeneID:12251809"
                     /translation="MGSWTPVELAEAFRYATDWFRVYVEELNALNVYPVPDGDTGTNM
                     HLTLQSARRELDLADTRKMPEVARAIAYGSLLGARGNSGVILSQILKGFTEAIRKREA
                     LDAKALAEALRQGAETGYRAVMKPVEGTILTVARAAAEGAHGNTLEEVLESALIAAQA
                     ALARTPELLPVLKQAGVVDAGGAGYVRFLEGIRGYALKLPLPEPPKVERYAQTAFATE
                     EFGYCTEFLMEGVEVPIERIREAVAPFGDSLLVVGAEGYVKGHIHTDDPDGLLSTVAR
                     FGRMVRTKVEDMTEQHTEILAMAGLLEEAPPPTGLVAVALGHGLSKAFRSLGARVVAG
                     GQTQNPSVEDLLSAVRSLPNPKVILLPNNPNVFLAAEEAARLAKEAGKEVYVLKTRTL
                     GQGLAAAVRYLPEAEPETLLPEMEEAAQGARTLEVTWASRDAEVEGLKVLKDKPIGLL
                     DGKLVLVGESPEEVLEGLIRLAQEGKEVLTLFLGPNTPREKAEAVAQNFPHLVVEILP
                     GGPDLYAYLGVLE"
     misc_feature    472011..473549
                     /locus_tag="TCCBUS3UF1_4540"
                     /note="DAK2 domain fusion protein YloV; Region: YloV;
                     TIGR03599"
                     /db_xref="CDD:234275"
     misc_feature    472086..472565
                     /locus_tag="TCCBUS3UF1_4540"
                     /note="D