GenomeNet

Database: RefSeq
Entry: NC_017503
LinkDB: NC_017503
Original site: NC_017503 
LOCUS       NC_017503             977612 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Mycoplasma gallisepticum str. F, complete genome.
ACCESSION   NC_017503
VERSION     NC_017503.1  GI:385325853
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604155
            Assembly: GCF_000025385.1
KEYWORDS    RefSeq.
SOURCE      Mycoplasma gallisepticum str. F
  ORGANISM  Mycoplasma gallisepticum str. F
            Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
REFERENCE   1  (bases 1 to 977612)
  AUTHORS   Szczepanek,S.M., Tulman,E.R., Gorton,T.S., Liao,X., Lu,Z.,
            Zinski,J., Aziz,F., Frasca,S. Jr., Kutish,G.F. and Geary,S.J.
  TITLE     Comparative genomic analyses of attenuated strains of Mycoplasma
            gallisepticum
  JOURNAL   Infect. Immun. 78 (4), 1760-1771 (2010)
   PUBMED   20123709
REFERENCE   2  (bases 1 to 977612)
  AUTHORS   Szczepanek,S.M., Tulman,E.R., Gorton,T.S., Liao,X., Lu,Z.,
            Zinski,J., Aziz,F., Frasca,S. Jr., Kutish,G.F. and Geary,S.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2010) Pathobiology and Veterinary Science, and
            Center of Excellence for Vaccine Research, University of
            Connecticut, 61 North Eagleville Rd., U-3089, Storrs, CT
            06269-3089, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Bacteria available from Steven J. Geary (steven.geary@uconn.edu).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/05/2014 22:51:12
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 791
            CDS                          :: 721
            Pseudo Genes                 :: 31
            CRISPR Arrays                :: 1
            rRNAs                        :: 6 ( 5S, 16S, 23S )
            tRNAs                        :: 32
            ncRNA                        :: 1
            Frameshifted Genes           :: 23
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..977612
                     /organism="Mycoplasma gallisepticum str. F"
                     /mol_type="genomic DNA"
                     /strain="F"
                     /db_xref="taxon:708616"
                     /clone="1"
     rep_origin      1..1882
                     /note="putative oriC"
     protein_bind    complement(24..32)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     pulmonis consensus ttatcMaMa"
                     /bound_moiety="DnaA"
     protein_bind    complement(36..44)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     pulmonis consensus ttatcMaMa"
                     /bound_moiety="DnaA"
     protein_bind    114..122
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach"
                     /bound_moiety="DnaA"
     repeat_region   209..217
                     /note="oriC imperfect repeat"
     protein_bind    complement(254..262)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     mycoides consensus YtWtMHaMR"
                     /bound_moiety="DnaA"
     protein_bind    298..306
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     mycoides consensus YtWtMHaMR"
                     /bound_moiety="DnaA"
     repeat_region   complement(396..445)
                     /note="oriC imperfect repeat"
     repeat_region   complement(457..505)
                     /note="oriC imperfect repeat"
     repeat_region   complement(570..618)
                     /note="oriC imperfect repeat"
     repeat_region   complement(708..756)
                     /note="oriC imperfect repeat"
     repeat_region   complement(758..806)
                     /note="oriC imperfect repeat"
     repeat_region   complement(816..864)
                     /note="oriC imperfect repeat"
     repeat_region   867..915
                     /note="oriC imperfect repeat"
     repeat_region   984..997
                     /note="oriC imperfect repeat"
     repeat_region   1054..1102
                     /note="oriC imperfect repeat"
     repeat_region   1140..1188
                     /note="oriC imperfect repeat"
     protein_bind    complement(1178..1185)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     capricolum consensus ttWtMHaa"
                     /bound_moiety="DnaA"
     repeat_region   complement(1223..1271)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1543..1552)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1601..1649)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1824..1872)
                     /note="oriC imperfect repeat"
     gene            1886..2674
                     /locus_tag="MGF_RS00005"
                     /old_locus_tag="MGF_0005"
     CDS             1886..2674
                     /locus_tag="MGF_RS00005"
                     /old_locus_tag="MGF_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_011883597.1"
                     /db_xref="GI:500213422"
                     /translation="MIISFINNKGGVLKTTLATNICGVFSKFFPKSRSVIVDLDGQGN
                     VSATFGQHPERLKNTLIDIFRGEKDIDDCVLNVFPSIDILPSNHELSFVDMDVARKEY
                     KLSVIKNLIEKLEEMYDFVFLDTPPAMSTIVSVSMHISDMIVIPFEPDQYSILGLLRV
                     IDTIETFRERNEDLKVLVVPTKVNARTRLHNDVLNIVKTKLSKKNIPLSKNIVSFTTK
                     SSASVGYEKLPIVLINQRSKYQEEYIEITKEIINLLKDNKNNGK"
     gene            2664..3143
                     /locus_tag="MGF_RS00010"
                     /old_locus_tag="MGF_0007"
     CDS             2664..3143
                     /locus_tag="MGF_RS00010"
                     /old_locus_tag="MGF_0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574348.1"
                     /db_xref="GI:504387246"
                     /translation="MENKKAKKKERRFTDLSADLDEEVEKVDPEYEDFKEIKIEKNKD
                     NQVIDKNDPFFYSESFEEARIQLIKDKKVEVKKEEEKVQETTVKNKISEAKKEEVAKD
                     VYIDSSLEIASQEPLTKGMHFYTNSRIIRKVRECAKNKGLSISRLITMILDKSIKEE"
     gene            3159..4544
                     /locus_tag="MGF_RS00015"
                     /old_locus_tag="MGF_0010"
     CDS             3159..4544
                     /locus_tag="MGF_RS00015"
                     /old_locus_tag="MGF_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_014574349.1"
                     /db_xref="GI:504387247"
                     /translation="MKTKLKRFLEEISVHFNEANSELLDAFVHSIDFVFEENDNIYIY
                     FESPYFFNEFKNKLNHLINVENTVVFNDYLSLEWKKIIKENKRVNLLDKKEADTLKEK
                     LATLKKQEKYKINPLSKGIKEKYNFGNYLVFEFNKEAVYLAKQIANKTTHSNWNPIII
                     EGKPGYGKSHLLQAIANERQKLFPEEKICVLSSDDFGSEFLKSVIAPDPTHIESFKSK
                     YKDYDLLMIDDVQIISNRPKTNETFFTIFNSLVDQKKTIVITLDCKIEEIQDKLTARM
                     ISRFQKGINVRINQPNKNEIIQIFKQKFKENNLEKYMDDHVIEEISDFDEGDIRKIEG
                     SVSTLVFMNQMYGSTKTKDQILKSFIEKVTNRKNLILSKDPKYVFDKIKYHFNVSEDA
                     LKSSKRKKEIVQARHICMYILKNVYNKNLSQIGKLLRKDHTTVRHGIDKVEEELENDP
                     NLKSFLDLFKN"
     gene            4669..6384
                     /locus_tag="MGF_RS00020"
                     /old_locus_tag="MGF_0017"
     CDS             4669..6384
                     /locus_tag="MGF_RS00020"
                     /old_locus_tag="MGF_0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter component domain protein"
                     /protein_id="WP_014574350.1"
                     /db_xref="GI:504387248"
                     /translation="MLKILFYNTTKSFRLHMSIVPIFLLIESLTTVLVPYFISDLINF
                     GIIGRDKNALTQYSLILLGVAAVGFTFGYLGGRSIIIASVEFAKQLRVNIFERYQSFS
                     VKNTDKFEKASILTRMTTDINFIQQSIQSGRMAIRGMSVFLFSLVLMFVTSWKLGIAS
                     VAIMPVIIGGILLVYRFVIGNYKKLFKQYDQLNNLAKESIAGARVVKSYHQQDNEIQK
                     FNRVAGFIYKNFTKIERITALISPIVLFCIYVLAIAIAWISTNNIVDGKLDIGSLASV
                     FAYAFQMLINLLLLSVVYVTIITAKPSKDRIIEVLTEKIDIKDKKYAIDNVSDYEVEY
                     KDVSFKYVDTSPHHNLEKINIKIKKGQTIGIIGPTGSGKTSIVNLLTRLYECNEGQVL
                     LNNIQLNNYSLKALRDAIAIVPQKSILYSGTIKDNILMGRNYSDEEVEKAITQGQAAE
                     FINKLPNKLDSIVEQNGTNFSGGQRQRICIARAMIRKSKILIFDDSTWALDTKTDALI
                     QSSFNNDLKESSKILISQRVSSIKNADLIYVLNNGQIVASGNHDYLIEHSELYREINQ
                     SQTEQ"
     gene            6644..8290
                     /locus_tag="MGF_RS00025"
                     /note="multidrug ABC transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            8385..8534
                     /locus_tag="MGF_RS00030"
                     /old_locus_tag="MGF_0042"
     CDS             8385..8534
                     /locus_tag="MGF_RS00030"
                     /old_locus_tag="MGF_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NC71.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_011113236.1"
                     /db_xref="GI:499425772"
                     /translation="MKRTYQPNKRKRAKTHGFRARMATASGRAVLAARKRKGRHILTV
                     SDEAR"
     gene            8546..8893
                     /locus_tag="MGF_RS00035"
                     /old_locus_tag="MGF_0045"
     CDS             8546..8893
                     /locus_tag="MGF_RS00035"
                     /old_locus_tag="MGF_0045"
                     /EC_number="3.1.26.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease P"
                     /protein_id="WP_014574354.1"
                     /db_xref="GI:504387252"
                     /translation="MKRENSLKKITNFLELVKSKNKYYSNNYVIYAEKNRENKIKIGI
                     SVPKKLFAKAVIRNKIKREVRSFFDDFTDWSKSLNILIKINNVNYLTNSYLAKKKEFF
                     DTYKKVVQKFKII"
     gene            8898..10049
                     /locus_tag="MGF_RS00040"
                     /old_locus_tag="MGF_0047"
     CDS             8898..10049
                     /locus_tag="MGF_RS00040"
                     /old_locus_tag="MGF_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P60035.1"
                     /note="functions to insert inner membrane proteins into
                     the IM in Escherichia coli; interacts with transmembrane
                     segments; functions in both Sec-dependent and -independent
                     membrane insertion; similar to Oxa1p in mitochondria;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit YidC"
                     /protein_id="WP_014574355.1"
                     /db_xref="GI:504387253"
                     /translation="MNKVHSEIKTQSFNPFWNAATLKEKSRIDPNLKKALSYLWKFLK
                     ICVFLFLTVIGLWGCTQTYSEPWTVSNPRIGVGLEIGYNYGVTGDYRYDLISSNLGPY
                     FSFANYQLSYGPFLAWFVWPASQIILPILYQTRVPLTQGIDYGLNTILAILILLFIIR
                     LITIGITLNSTLNTERMGEVQGKIAEINAKYKNATDTQSKKMKQIEVMHIYKKHKIKP
                     AALFVQGFVTIPIFLIVYKMVSLTRPIKATILFGIWDLSVTPGTEIISDISRNWVYIF
                     FVLLVVPMQIVSQWLPQFWATRRNRNAKTTSQKGLEQLKKTRRIQWILIFVFALFPVI
                     TPSAVGLYWFLNSIFTILQSYITHVFIVKRRQRTKTISRLDQILNRELD"
     gene            10049..10855
                     /locus_tag="MGF_RS00045"
                     /old_locus_tag="MGF_0056"
     CDS             10049..10855
                     /locus_tag="MGF_RS00045"
                     /old_locus_tag="MGF_0056"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_014574356.1"
                     /db_xref="GI:504387254"
                     /translation="MINKINKFFKNNEFSPSKQRGQNFLIDQNIINKIVEAVIKINPS
                     KVLEIGPGLGAISEQLIKRFADNYYAIELDKKLFHHLNEELLKDHILHADALEIDWKS
                     IFDNLGDNPTMVGNLPYNISSKLIKKFILSTYRCAIIMVQKEMGLRLLAKINSKDYSA
                     FSALCQYSLNVSKIIEINETAFIPQPKVRSTLLFLEKKDIAFNEGYEKFLKLIFLSRR
                     KTILNNLKNNYDSKLVIQSLVSLGFKKTSRAQELSPTQLFSLYESLSKLC"
     gene            10770..11555
                     /locus_tag="MGF_RS00050"
                     /old_locus_tag="MGF_0062"
     CDS             10770..11555
                     /locus_tag="MGF_RS00050"
                     /old_locus_tag="MGF_0062"
                     /EC_number="2.7.1.148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="diphosphocytidyl-2C-methyl-D-erythritol
                     2-phosphate synthase"
                     /protein_id="WP_014574357.1"
                     /db_xref="GI:504387255"
                     /translation="MVLKKHPELKSYHLPNCLAYMNHYRSYAKVNFYLKIKEYCPKVK
                     KHKLESKLVLVKDLYDDLYLEKSNQTKIEYFDQNDNPLTFSDDILVRTKKFLEDKLNQ
                     NFEFKAKVIKRIPTLSGLGSAPSNAAVLINWIYQEYGILNPVSYYEIATELGSDIPFF
                     LSLHDCAIIKNFGDQVEQSILDGYEIEKIIFNKQKPSTKKIFELLDYSQIKKENLNDL
                     EQPFFSLFPELLPSFNQLKNDNNHVVLAGAGSCFVVFRKLNEI"
     gene            11568..13217
                     /locus_tag="MGF_RS00055"
                     /old_locus_tag="MGF_0066"
     CDS             11568..13217
                     /locus_tag="MGF_RS00055"
                     /old_locus_tag="MGF_0066"
                     /EC_number="6.1.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="arginyl-tRNA synthetase"
                     /protein_id="WP_014574358.1"
                     /db_xref="GI:504387256"
                     /translation="MVFKKIKTQIDHALKQLNLPTDIEYLIQQTKNIQFGDFSSNVAM
                     VLSKRQNKNPEEIAKQIIEQLNPNEFEKITFSKPGFINFFLSNQDKLVVLKRLQKTNY
                     SVEKLPKEEQESINIEFVSANPTGFLHLGHVRNSYTGDVLGNILRAVGHNVTKEYWIN
                     DLGNQVSLFALSTIIRYLQKLGINKYQLPDDSYHGKEPIFVAEEMIKDFGNKYQDIKI
                     EDNKIVDSKIANELTQYCTNKMLHFIKQDLESIGVKMDVWTSEKVVYQSNTLTELLNN
                     QLKDHIYEQDGAVWLRTTDGGDDKDRVIIKENKQPTYYGTDIANHYLKHKRGFDRLIN
                     VWGADHFGHILRTAYAAELTGIKKGKFVVVLIEMVKLLKDNKEIKFSKRLGNAISIPD
                     MLEFLSKDASRWFMLNQSWTSGIKIDVDLTNKKDSSNPVYYVQYAHARIHKLLTKAEH
                     IDLTKVNLSLLNSDVERTMVNYLASFEHYVHNVATTYEVNKLLNFVYTLTQSFHSWYN
                     SHEILNQKDEIKQTRLLLAKAIKNLINYLLSLFGIEAVEQM"
     gene            13226..14395
                     /locus_tag="MGF_RS00060"
                     /old_locus_tag="MGF_0074"
     CDS             13226..14395
                     /locus_tag="MGF_RS00060"
                     /old_locus_tag="MGF_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="nuclease"
                     /protein_id="WP_014574359.1"
                     /db_xref="GI:504387257"
                     /translation="MRNRVRDKQNQNTRKKQVNNKRWIMWVLLLLLIILGVSAYFVIN
                     KFFPPKNDVPNSKRTNDSQVTNPGTRNETVPPSEQYKKVGDLRLMSWNTLNFGSRSEP
                     TSNKFMNIIRTIQLSDADVVGLSEINYDDQLLAQRLNDALGSSWSYTFSGKNFNENYP
                     RSKESILILYKNQVVQPEVSKAINPNNIYTRPLWYTKFKIIGFDYSFITFFGHFDAPG
                     VNANNGETSAAGFSRQGSQEIKEAQAIATVFSDLKTQYPDTDIIGAADTNIRETNNRV
                     FTSDQYSLNYINFDNNRPYYRTTLSERNGYANSYDKWFIYDADSQNILKKSDIPYKID
                     IINAFTDKIWDKQKSLAAWLASRSGMRNPNPSDFQLISNVSDHAPILLDIDYKLK"
     gene            complement(14450..15181)
                     /locus_tag="MGF_RS00065"
                     /old_locus_tag="MGF_0082"
     CDS             complement(14450..15181)
                     /locus_tag="MGF_RS00065"
                     /old_locus_tag="MGF_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P52280.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol transporter"
                     /protein_id="WP_014574360.1"
                     /db_xref="GI:504387258"
                     /translation="MNTTVNILLGELIGIMVLIILGNGVCASVNYKNMFAKQVGANWL
                     LIAFGWGFAVFCGVVISIQVLKGNAHLNPAVTVYFMINQKGANIGLLFAMIAMQLLGA
                     MIAQIILNSLNWKHIIENDAEMLKASSCTGPSHRKAWFRNISYEMLGTMILLAGVMAG
                     DYHKLTGVFFVMAIVMTLGSVTGCAINPARDFGPRVIYFLTAKAFNKKLQNPVSADFR
                     YGLVPLLAPIAAGLIMGGFSLLINQ"
     gene            complement(15181..16707)
                     /gene="glpK"
                     /locus_tag="MGF_RS00070"
                     /old_locus_tag="MGF_0094"
     CDS             complement(15181..16707)
                     /gene="glpK"
                     /locus_tag="MGF_RS00070"
                     /old_locus_tag="MGF_0094"
                     /EC_number="2.7.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NC65.2"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol kinase"
                     /protein_id="WP_014574361.1"
                     /db_xref="GI:504387259"
                     /translation="MDKKKYIITLDEGTTSCRSIVFDKQAKIVSVAQNEFTQYFPQSG
                     WVEHDPLEIWNTQLSTMQSVKNKAQIKSVNVEAVGITNQRETVVLWNKETGLPVYNAI
                     VWQDRRTSEYCETLTKHVDKVREKTGLIINPYFSGTKIRWILKNVPLAQKTLKAGKLL
                     AGTIDSWLIWKLTGGKVHATDVSNASRTLLFNIHTMDWDQELLDLFEIPRSILPEVKS
                     SSEVYGYVEPSLWSQRATAKVPITGVAGDQQSALFGQLCLKPGMVKNTYGTGCFTLMN
                     IGEKPIMSKNKLLTTVAWKLGKKKPVYALEGSVFIAGAAVQWIRDGLRLIYDAAESDF
                     YANLASKEDTHQVYLVPSFTGLGAPYWDSYSRGAIFGLERGTKKEHIIKATLESIVFQ
                     TNDLIKAMSSDVGKKIEVVKVDGGATRSEYIMQFQSSISGVNVIRPKNIESTALGATF
                     LAGLAVGYWKDLKELEKLVKVDKEFKPKLDKEKVEKLVHGWNVAVKRTFNWMKEVDLK
                     "
     gene            complement(16747..17937)
                     /locus_tag="MGF_RS00075"
                     /old_locus_tag="MGF_0099"
     CDS             complement(16747..17937)
                     /locus_tag="MGF_RS00075"
                     /old_locus_tag="MGF_0099"
                     /EC_number="1.1.3.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_014574362.1"
                     /db_xref="GI:504387260"
                     /translation="MCRYRKAIKLQNMSILKTHFDVAIIGAGIIGASIAYELSRYNLE
                     VVVLEKNPKVANETSLGNSGLIHGGFDPEPHKLEAKLNLQGNLKWREWFKHLEFPRVE
                     IDSLILAFNEEEMKHVHMLYERGLTNGLNKKDLKVLTTQEVLKKEPNVNPAVKGGLLC
                     TSSVAIHPVEATRALLGAAKQNDTRLRVNSEVTNIKYEGDRFALTINNKYKIYARKVI
                     NAAGHYADKLANKFGFDDFKQTTRRGEYRILDNYDKNLINSVLFKVPTIHGKGIIIAP
                     TLDGHYLVGPTAQDGVPKEDISLVTKEKYDLIGKIGKDIVPSLKIERTIKTIAGSRPI
                     DVETNDFVIRKSKKNPNFILAAGMQSPALSSAPAIASEIANLLNLKLTPRENFKPDYK
                     IDIF"
     gene            complement(18180..20432)
                     /locus_tag="MGF_RS00080"
                     /old_locus_tag="MGF_0110"
     CDS             complement(18180..20432)
                     /locus_tag="MGF_RS00080"
                     /old_locus_tag="MGF_0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574363.1"
                     /db_xref="GI:504387261"
                     /translation="MIKKSAWFNLLCGLSSVSFVSASCQKMQAPATKSAEEIFRTLTK
                     GDITIAFNKNQDKTKILPSAINEKNYFNYFYFQISQSVDQKELDHINFDAKNFVPNNQ
                     SGTLSFDLDVSVVDRPKDIKNFDFRIDGLMTGSGASSGSGSSSASSGSGSGNSGSTTT
                     QPEHDPNDCPPDTSKANKTSSSEKTVNTTRPTESQRQPRDSSKPPSFPNGFPGFPGSN
                     ITKEFVQKQNSYPDYVASRYKTVDKQLIYKEIWDRTFSIRPGTFTSDNGTAHPIVDQG
                     TGWVLDYAKNSSNNNQLKLFIATNLHVIGNYGNTNSKELDDLLSYSDPTGVKPSGFAL
                     GKSNKTPSFAPQPNNQSVDQLKQNAGTMLYYSYKEGGGKIGIEEIKTTQAFRTPKIVF
                     AAVDYLDDHALNQYKSKIDEKWKAWKEETLNIINGSNSGHGTVFADEEKTRLKKLTEY
                     NGKISFYTDFGILELDVDLSKADEKLKEWINNSTKAVDSYVNRIKTTQHLPNYNPETG
                     NYFPTLDYISKNLGLASCKPSYAYGIDNAKDIYIAGYPKDLQSQTFWMQNNPAERYQD
                     ITQGSVNNQLRIPQQAWLPNKDLFNVPSYTRSTDSATSKTWSDINNIQIYTKLWNRPF
                     IDRYGFNYFTKFSSLYYGASGSVAYNDFGQIVGIYDGVASSTNFGDVSNLGTFAPLVQ
                     AANIKVQSDESITNYAYNLIDNKGFPHQTRSYRSNLSLFYPNGFTWPSTSGTPTQSNS
                     KVTAIFPNGF"
     gene            complement(20661..21173)
                     /locus_tag="MGF_RS00085"
                     /old_locus_tag="MGF_0113"
     CDS             complement(20661..21173)
                     /locus_tag="MGF_RS00085"
                     /old_locus_tag="MGF_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ferritin"
                     /protein_id="WP_011113247.1"
                     /db_xref="GI:499425783"
                     /translation="MHSNVRKLLNNQYNSEMAAATMMFEYSARIDEYGMDHFSALLYD
                     WAKEKLEHAQKLEWYLRLNEQWIRTNELATPKLVDSTEPLGILEAVSEYQRATAVAFD
                     EIAEVALINKDFGTYNFVGFFIENQLYQKKKCADLINTFKMSEDLLIIDEKIKQIKEE
                     HLANITKSHK"
     gene            21287..22114
                     /locus_tag="MGF_RS00090"
                     /old_locus_tag="MGF_0114"
     CDS             21287..22114
                     /locus_tag="MGF_RS00090"
                     /old_locus_tag="MGF_0114"
                     /EC_number="6.3.5.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GMP synthase"
                     /protein_id="WP_014574364.1"
                     /db_xref="GI:504387262"
                     /translation="MQARKLQDFLISTVTLLRDTIKNKKAIIPLNGGVFSFVLAKITK
                     IALNKNLTCIYIDNGMMRHNEVANKIHFFREKLDLEVWHIDAKELFLNNLKGHISYAD
                     KKKAIDDTFLEVVMQTIVDIGEKIDFALLGTCFDDLNQGLNISMALANDVYIFEPLKQ
                     LTIQQVIELGELLSIDPNFLKEPTLPLSGFGLMVEDEVTEEKIVILKKVYYLINMILN
                     QGLQNKFEILIRDDYKDKSAYNLYIEFNQPISDLLVKKVKDQINGLLSNIKKIFIKV"
     gene            complement(22111..23811)
                     /locus_tag="MGF_RS00095"
                     /old_locus_tag="MGF_0134"
     CDS             complement(22111..23811)
                     /locus_tag="MGF_RS00095"
                     /old_locus_tag="MGF_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease J"
                     /protein_id="WP_014574365.1"
                     /db_xref="GI:504387263"
                     /translation="MIKDFKDINPNKKPTKIFAFGGLEEVGKNMYGIEYDDELIIVDC
                     GIKFSSVELLGIDGIVPNFAYAKANQHKIKALVITHGHEDHIGGIPYLLREVSIPVIY
                     APLMATKLIEKKLHEHHNLNQYKIVSYNDKSQFSTKHFKIDFYRVCHSIPDAFGVCVQ
                     TPNGNIVESGDYRFDFNAGNEELDIHKVVEISRRGIDLFMTETTNAEIPGFSSSEKEI
                     YDNIRNIIKNANGRVILSTFASNVTRISEVIEIAIQHGRKICLLGKSMDNNVSISRDV
                     GYINLKDDDIVESRYVEQHPDNEIMIFCTGSQGEELAALNMLASGRHPWIQLKKTDSI
                     IMSSNPIPGNYAAVERLLNELSKEEGISIYENSPTLKLHASGHATMQEIQLMLSLLRP
                     KYLFPIHGEYKMFTSLKRIAKKCGFDPENVALHKNGQIVYLIDRELYYTKETIDAEPL
                     FIEGKSVSPNVKRIMNTRQVLSEEGIFAITVVIDKATKQIKTLPKLKSSGCFYLKESH
                     GLMTKIAYEIKTNANEYLAKNQNYSEHELKKIIHESCRFYIWRNKHRNPLVVSNIREI
                     "
     gene            24243..28328
                     /locus_tag="MGF_RS00100"
                     /old_locus_tag="MGF_0139"
     CDS             24243..28328
                     /locus_tag="MGF_RS00100"
                     /old_locus_tag="MGF_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574366.1"
                     /db_xref="GI:504387264"
                     /translation="MFNLIKSVIRSFKKAKVALISLTFLIFLSSLTYSLLDNTNKNLE
                     SSYAYVNQKGNAADLVINEKYDFGTLQFDSDPSIVNPNVDLTNTNKVHIFLSAESITP
                     YLNTIISNDSANIYTNLISYEINLNSNLSNQQRINLVQNEIITASNRLRNQLQSDPNA
                     KIDKILNDENIEFERYESLDVSEGDLQKKIVRTNSDYQVDKLVLYDGQMISNSGHNYQ
                     QILDQFMKLKADYNQLRIDQIPGFIKDNQDLKTILKVVLTGINPDTNNPNLANFVQSA
                     TKVVNNQPLNNNEQQRIQEFIDTETNPINNNWSINFQWKYQIVPLSVRLINPSSYFVI
                     VSASNWKHDQQTDGKMIFQDQEMIDQLMSLNGDAFLERFNTISDRYKIEIDQTSYLIL
                     GTGVSPEFVYPIYSFTNFIPNPVNQRIYYVNDYGYSRLREAFSTNPIETNIVGRFKDR
                     NLSQAQRQLALDKINQWASINMAWPPNLKSAYFANDISNILNLTAARTTFIPSLLNTI
                     KNTSLMLMAIIILLALMVGILIVKSYIDKNRQTLGILLANGFNKTKINLSMAIFSFIP
                     SLIGGMAGYILGYILQEVAINAFSSFWFIPVELRRFSATALVTSFFLPVIIFGFTSFL
                     VSVYLMRKNVVDSLKNDSEYKVSKISVYIKKPIAILSVMNRFRISIAFNSMWKLFLLC
                     ILSAATMVVLIFSLSTLNVYDKAKNDTFGANNYKYYVDLATPTQQSGLIMYQEFKDLG
                     KTDAALAGWEDHKNYFLANSRTDPNQSGWSNLHIVGLNDIIDQSSKVTYLKNYVQSKI
                     GLDYLIGLGVLSANPWSLSSSLMPSNQAAASEKSYEIFLQAIANNVYPNLKTPADNDP
                     SYYIRIVFNPQLNRNVYEINQDQALSGGVLKPEFIHFLIQQFENISNNTYGLVDYKIT
                     YNVIGLGAKTIGDIKDKESPKFAYTRIDTVTDNDQKFQIKGIKNWIKTTNLDEVDRKD
                     YLGPILIDNNNKVINQKLFNQTDDNPIIINEFVAKNNHWKVGDTIDFTITNRVDRISD
                     KLNIINHDEYLKNQKVKFKVIGISSSARDNDLYTSYDLANKLLGFSDFEIKHKLPFNG
                     YYSDDLDAFERSTPLFSESGLLPSTSNFSVDNKQLQKIIRNSILNYQSTLTTSTPYNQ
                     LSSTRQAYVDDYKALLVALGEVKNLDGNNFHQWTELKADNQSVSDYIKKLVNVYGSLP
                     YNTMINFLYNSSSNRTIFENISKTSLTIQNVIIAMIVPIVTLIVILISNMLIDELKKI
                     AIRMKALGFSDRAIIFSFLSIYIPVFIFGLLVGGPLSLILVNIYNLIILKSASIALFT
                     TISITHILGALIGVMGIFSISFFTNWYTLRKMKIAQEIKNY"
     gene            28332..29831
                     /locus_tag="MGF_RS00105"
                     /old_locus_tag="MGF_0155"
     CDS             28332..29831
                     /locus_tag="MGF_RS00105"
                     /old_locus_tag="MGF_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014574367.1"
                     /db_xref="GI:504387265"
                     /translation="MMMSNFQLTKQIEEVKIANELDYLSLDWDQPAVYFVDNFGDFNN
                     IYNSYIGNVIYYMRQKTEAVLLLRPNFRIQVNNFCNDLLYLKQTLDNTYGKMFASENY
                     QTKQKQYLVKKFIDHVNELSNRLIYHINDFIFELKQKKRPVERKLSVRTAQEYEVILN
                     QESAAIIDYFKKLENNISDDSYLDPSWLKKTEVSIKQREDKIKDFFKVLHLKNFARVK
                     LSNIYKKIDKFKQNLETAFWNLEVSKVEILNKPHKIRQTNPIRPDFVIDLRNVTKYYS
                     NGVTTTKVLKNVNLQIPWGEFVVILGPSGSGKTTLLNIISGMDRASSGITFVANKNLI
                     GFSDTQLTKFRQENIGYIFQQYGLLPNLNVKENIEVGAFLQRDASKRKDIDELLKNIG
                     MYEQRNKLPTELSGGQQQRVSIARAIAKNPTVIFGDEPTGALDGEMTQVVLEEFVQIN
                     KKNKTTLIIVTHNPLIADIATMVIRVGDGTIKSITRNENPKSVKEIHWG"
     gene            30203..30407
                     /locus_tag="MGF_RS00110"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            30392..30916
                     /locus_tag="MGF_RS00115"
     CDS             30392..30916
                     /locus_tag="MGF_RS00115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594426.1"
                     /db_xref="GI:753838809"
                     /translation="MYGVLNPSVLGRPDNQSDLTQHEDQNPLSASRPNINGVRSAQPN
                     QGGSDSQNQGNNGNTNSLIPDITQPAREQTPAPLCTVRVSSYELTNTGLLGADKSEVV
                     IDILDNKITLGSKIQNHFSTSLETSKLLEIFAKNASTYSPNFILTDKKPSDWQTYTST
                     NSFYVSNEQEQTEL"
     gene            31390..31857
                     /locus_tag="MGF_RS00120"
                     /old_locus_tag="MGF_0172"
     CDS             31390..31857
                     /locus_tag="MGF_RS00120"
                     /old_locus_tag="MGF_0172"
                     /EC_number="4.6.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
                     synthase"
                     /protein_id="WP_014574368.1"
                     /db_xref="GI:504387266"
                     /translation="MNIRIGQGFDSHKLKTKKNSRVFLGGIPVKTDQQLIANSDGDVV
                     LHALSDAVLGCGSFGDIGMYFDENDLSNKGLDSKTILNYCLKLIKKLKLEFVNIDLTI
                     FAQDIRIDPIRFEIKSSLMKLTGCNSVNVKAKSYEEPKNEIACSCVVLMNTNK"
     gene            31864..32409
                     /locus_tag="MGF_RS00125"
                     /old_locus_tag="MGF_0175"
     CDS             31864..32409
                     /locus_tag="MGF_RS00125"
                     /old_locus_tag="MGF_0175"
                     /EC_number="2.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_011113254.1"
                     /db_xref="GI:499425790"
                     /translation="MSKLNYTIEKILITNEQINEAAIKAANWINQTYKDDEIILVGIL
                     KGCIPFIGKIIDKIECEMILDFMTLSSFKGETKSQGTPKIVMDLAYDVMDKNVLLVED
                     IIDSGNTIKIVLDLLKQRGAKSVRLLTFLDKPSGREVDVKADYVCFEVPHGFLVGFGL
                     DYKDKLRNLPYVAHMVSNDKK"
     gene            32435..34732
                     /locus_tag="MGF_RS00130"
                     /old_locus_tag="MGF_0179"
     CDS             32435..34732
                     /locus_tag="MGF_RS00130"
                     /old_locus_tag="MGF_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein FtsH"
                     /protein_id="WP_014574369.1"
                     /db_xref="GI:504387267"
                     /translation="MSNTSNFNERVTENAKPPKNVKSIIWKTIGIIIVMAIIIGLILF
                     YVLPRNTIANISNIQYVDGNLVATATINGRSGRFILDLENSTYQTSYTSGLSLSISVF
                     LRNLNNANGQSFFVSLIRPATSSANDTVFNIANLSINQTRGVATLVTEGGSYSAVLTT
                     TLTALPLTGQKFLLEGFNLDTANADAYRAAGAIPGIQRLLAVGNVQLPNQSTAILTQF
                     LTSIIPFVILIVIYIVIARRFSRTMGAGGAIGEDGENVFTIGKSQAKLAKSTFKFTDV
                     AGIEEEKSELIELVDYLKRPGKYVQMGARTPRGVVLYGPPGTGKTLLAKAVAGEAGVP
                     FFQVTGSAFEDMLVGVGAKRVRNLFAKAKKAAPCIIFIDEIDSVGSKRGKYEISAGSA
                     TDQTLNQLLAEMDGFSTRTGIIVMAATNRLDVLDDALLRPGRFDRHIQVNLPDIKERE
                     AILKIHSRNKNISSKVNLLDIARRTPGFSGAQLENVLNEATLLAVRADRTSISLTDID
                     EAIDRVIAGPAKKSRVISDFEKNQVAHHEAGHALVGLHLKGADEVQKITIIPRGQAGG
                     YTLSTPKDAELNLKKKSDLLNMIAGALGGRASEELFFGKDAISTGASNDFYKATNIAK
                     TMVTQLGMSDLGITQFLPSEGGINPNARYYSENTAQRIDEAIAKILEEQYQVAYNIIK
                     DNQNELKLIVEALLIQETIVKNDIDYIHEHLKLPEAIIKLKEEQLKEKAAAQKEEQAE
                     KAKLDHQSDSAQPQEEPTASTASSN"
     gene            34778..35401
                     /locus_tag="MGF_RS00135"
                     /old_locus_tag="MGF_0194"
     CDS             34778..35401
                     /locus_tag="MGF_RS00135"
                     /old_locus_tag="MGF_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dihydroxyacetone kinase"
                     /protein_id="WP_011883648.1"
                     /db_xref="GI:500213473"
                     /translation="MENRSAFINLLIRIIDNFTYSEQFLNLIDKKGSNGDFVDSLTPF
                     INKISQFANREDNQISFYNSLKIIALYIKETIKTTLGAILYDLTHQAAHYLDQNKLSR
                     NHLIESFYRALLDCKNKYQLRIGAKSFYDILYPVLKYLYLNNDLSTQELMAQSQKILD
                     ENFNKSLLLKSKVGRASYHGKRSIGMYDPGTVFIYIILEGIIKIYDQ"
     gene            35391..36281
                     /locus_tag="MGF_RS00140"
                     /old_locus_tag="MGF_0195"
     CDS             35391..36281
                     /locus_tag="MGF_RS00140"
                     /old_locus_tag="MGF_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883650.1"
                     /db_xref="GI:500213475"
                     /translation="MISKILNPKLRRIVVITAWILMIIPLIATYFFINTPVVLYSLYF
                     SLYPISLILYVGHYYLHLRLRKKLNEQYQAKAIFEGLEKTKKLKIKRVNDQFLNKEMI
                     KQIIKLSDGEIQNLDKRFSQPNFYQEYQVNDHNDQLRISCLEFCKSKYSLNYPYKYDC
                     YYWFELKNLSDQPFVLLNKKEAQNPGFSKYLVNGLKPNFQDKFVLYTNQENFDLTKVI
                     DDEILNDLLFKKPDTNINLVNKNNKTFLLLRMSFNIFNLYYGSDYFDETTYHQLVIQR
                     VENIKLLIDLFYSLRECIND"
     gene            36339..36605
                     /locus_tag="MGF_RS00145"
                     /old_locus_tag="MGF_0199"
     CDS             36339..36605
                     /locus_tag="MGF_RS00145"
                     /old_locus_tag="MGF_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_011883651.1"
                     /db_xref="GI:500213476"
                     /translation="MKSFKATIIDPFGLHVRTATVLSSKMGGFKSKVTLKIVGGATAD
                     VKSIINLMSLAVKQNTAVEFIIEGEDEEKACEELQKALKDNKLI"
     gene            36670..38658
                     /locus_tag="MGF_RS00150"
                     /old_locus_tag="MGF_0202"
     CDS             36670..38658
                     /locus_tag="MGF_RS00150"
                     /old_locus_tag="MGF_0202"
                     /EC_number="2.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transketolase"
                     /protein_id="WP_014574370.1"
                     /db_xref="GI:504387268"
                     /translation="MNIQQQTINTIRVLGIEMINNAKSGHPGMVMSAAPMMYALFHDH
                     LNYDVSDPNYLNRDRFILSAGHGSALLYATMYVAGYKTLSTKDLKNFRKFSSKTPGHP
                     ESTMLAGVDFGTGPLGQGAATSVGFAIAEANLSARFDKIINHYTYCLIGDGDLQEGVC
                     QEALAVAGRYKLNKLIWLYDSNDVQLDGRVENSTNFDVEMLVKSYRWNYILIKDGNDY
                     QEISNAIAQAKKSDKPTFIEVKTKLGFASSVENTNKAHGSPFSDEEIKNIKAKFDYKN
                     KPFTVSAEVKNHFESAISRGLKAAEEFNQRLAKAKPELKEKFITQVKEEKINFPKSLI
                     NEFNVDQYDSTRNLFGKVFKELTKINDNILVVNCDLSSSTKVVTHNNARFDHGHYQNQ
                     FVDVGVREFLAGCIVNGIVAHKGLKAVSSTFMAFSDYNKPALRLGAINKLSSLYVYSH
                     DSFNVGEDGPTHQPIEQLSALRLIPDVLVYRPANFYELYIALKTAFDKKNHKPVVIST
                     SRSEFDLTKVNPKTFDEGYYYLNKTKSPKLRLIATGSDAGTALKLAKIFKQEGIDIDV
                     ISVVSFKKLKEKLADLEVLKEFKKYKNIVIESGVSNIWFEFVSLVIGVNDFGLSGNPN
                     EVATYFSMDLESLVKSLASILHKNYTQQKIEELIKNAN"
     gene            38648..41320
                     /locus_tag="MGF_RS00155"
                     /old_locus_tag="MGF_0213"
     CDS             38648..41320
                     /locus_tag="MGF_RS00155"
                     /old_locus_tag="MGF_0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_014574371.1"
                     /db_xref="GI:504387269"
                     /translation="MLINWFKLISPKNRILKRATLAAKQVDALKDEMRALSDEQLFNK
                     TEYFINELKNNKTTDDILVEAFAVIREVVYRETGNFAYLVQLIGAYVVHQGDFSEMMT
                     GEGKTLTLVLAAYLNMLEKKGVHIVTVNEYLAERDAEQARRIFARLNLTVGCNKANLA
                     PHLKKEAFDCDLTYTTNSELGFDYLRDNMVRNYRDKKIRGLHFAIVDEGDSILIDEAR
                     TPLIISGQPKKDFRMYFDADKFVETLSESDYKIDPESRSPSLTEKGITKAEKHFKINN
                     LFDLENSDLFHKIGNALTARKIFQNGKEYIVRDDKILIVDHFTGRILEGRSYNGGLHQ
                     AVQAKERVPIEAENVVVATVTYQSFFRMYKKLAAVSGTALTESEEFLKIYNMVVVPVP
                     TNRPVIRKDHPDFMFGNLKTKWEAVVNEIEKIHKTGQPILVGTGSVEDSETLHQMLLE
                     KNIMHEVLNAKNHAREAHIIAKAGEVGAVTISTNMAGRGTDIKLGKGAKELGGLYVIG
                     TERHESRRIDNQLRGRSGRQGDIGESRFFISFGDPLFKRFAQDRILKAQEKLASDYFD
                     SKFFSRFLTMTQKKVESVNFDMRKNLIDYDHVLANQRELIYKQRDKILIASDLTEVVD
                     RMAQNFVEGFVETFKDQANQTMVNPIELSIAVQKELLQGEEVAASQFYNQTLLAAKQT
                     VLKLVKDAISKKIEVMTVAIANNVFRDIIIQQMDDAWIHHLDQMLKLREGVSLRSLEQ
                     TSPLNIYVEESKKLFDLMLNKIAKNVILAVCAIINPTRNVDINVEQEHRRLEALKRLE
                     EIKKLEELQNNNNEPAKVLFKFPDQHGNMIEREVPVDNLIQLVDGQIIQAQVAEEPKQ
                     ELNQLEKVDQLDQTLIEAKLAEQREQKNNSATDK"
     gene            41602..43833
                     /locus_tag="MGF_RS00160"
                     /old_locus_tag="MGF_0229"
     CDS             41602..43833
                     /locus_tag="MGF_RS00160"
                     /old_locus_tag="MGF_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574372.1"
                     /db_xref="GI:504387270"
                     /translation="MKVKSFKKVIGALGIFASASLFVASCTKASTRFDQVDDGKLVLA
                     STFSSSSPIALSLNDVIEQYNKNKPAGNYPVEIFSIAGGYNGGLQTVNTKLAAKDKTQ
                     FFNMIFNYQAVTAQLVRHDLALELNKGAEPVDVSAFPDQFLQENYDILGNTDRAVYGV
                     PFTRSTEVLVTNVPVVYQLLSQATTNGDLKISDDEATQKLWAEWKMKAQTNLGNNTRS
                     NKPSRAAGEMAVTENGMQAEQPANQAPVSSEFIKKLWGDYTSVEGGLKGYTFSASALD
                     TTTSLLDLSTRIAKSYPNNLKPVNDRKPASPQGVIGIDSPSNYLFNATFSQVNGNKDN
                     FMIRKTANNRTYDYNALLSNQDNRNEQLKNAFNALSPLINANGLFLNNGGNYSSNWGK
                     YHQLGFFLSSTSGYYQSFVGNSAAFNLVFKGVDPSVGTYPFPNFTSNLYAPTKAEYDA
                     GALGAFTSSRKRWVIYKKDSLTDALKQTETNVAITDEANRAKAEEALSKNLEPIKDNL
                     STEKNKKLIGYIGTGFELDKFDSAVKNKVYQAGNLNNRNFMSAFVLTSDVDKKSVPSE
                     QSLQVSEADIRIAPTKFQASATKNTIITQGPSLIGIHANEKEDLQTKRFINWLIKGNI
                     NIPATTNAQGRETSSAYQGTPLNYLVAKASYILPTREFLNNPKNEQTNNPYQKIATHV
                     FKSILDDPNNYVPYTDAPDFRSGSFRQSLDSTLVSANSSKSNFDTFMNNLDKAVPTIV
                     KQN"
     gene            43898..44728
                     /locus_tag="MGF_RS00165"
                     /old_locus_tag="MGF_0241"
     CDS             43898..44728
                     /locus_tag="MGF_RS00165"
                     /old_locus_tag="MGF_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="nuclease"
                     /protein_id="WP_014574373.1"
                     /db_xref="GI:504387271"
                     /translation="MKFTKFLLVAGTLGLSVSFFSACTNSTSNIPADSKPFWENLSNQ
                     YSVTKFSDEQIKNNLQKAKLLRWTDGDTPVIQFYQADNPDQLSNETSSIRIEGIDTPE
                     KTRVADNNVRVPSGEPELKYAEAATQFAQRTVPEGSDVYFWYSGSKSFNRLVGTIYYG
                     FDPAKKTAINYGAQVVLNGLAIPLIKSVTSLLDQNSEIYVSTRPIGIAANLAILNKMN
                     IWSLDSDLNKSLKDIYNVRGVDSSWVSYLYPGTNNYKTYARKGPDANDYVQTIWPFYE
                     "
     gene            44792..46525
                     /locus_tag="MGF_RS00170"
                     /old_locus_tag="MGF_0247"
     CDS             44792..46525
                     /locus_tag="MGF_RS00170"
                     /old_locus_tag="MGF_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sn-glycerol-3-phosphate ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_014574374.1"
                     /db_xref="GI:504387272"
                     /translation="MKNSKSTLEIQIDNYQNKHQEYAKHKNETPAIVINNLVVDFGET
                     LALDNVSFEVKKGKLVTFLGPSGCGKTTTLNAIAGLLTPTSGQILFSGYDVTDKSPKD
                     RKLGLVFQNYALYPHLTVYENIAFPLYNDEAWKKKAAFKSLMSLTRAECVVFKANGAT
                     QEELDAWNKSGENRYYIPIQMRMDSDNKEINLNKKLRELNSQRRLLGVKKYIEISRLS
                     KDVAEKLTQAKKANDKQASDQLKKDYQKEVIEIKKKYKKLILENQQEIAKEKQLIKNS
                     PELVEIRKLKSQMFRIDRELTAIYKKLRQKLIEKYSLNLNKLSPEQKAEYDLQMKNNI
                     SLKEAVNQAVLEVANRVEITKNLAKFPTKLSGGQQQRVAIARSIVRHPKILLMDEPLS
                     NLDAKLRVQTRQWIRSIQSDLHITTIFVTHDQEEAMSISDEIVCMSNGSIQQIGTPTE
                     LFNKPKNEFVAKFLGLPEMNILTCELKNNKIYFNNNVIAQTNLPKDYPKIRVGFRDDT
                     MTIKPDGINQAIIKQIENLGKITVVKCEFYDQLINVKLNHPNYQIGEVINFDIDHNKL
                     HYFDAETTNRI"
     gene            46528..47517
                     /locus_tag="MGF_RS00175"
                     /old_locus_tag="MGF_0259"
     CDS             46528..47517
                     /locus_tag="MGF_RS00175"
                     /old_locus_tag="MGF_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574375.1"
                     /db_xref="GI:504387273"
                     /translation="MFFNWLLKKRQQKRNTELGILDKKVKIWVPLALLFPSFIAIFLF
                     TILPFLMVIEKAFTPLADIFNLKSATFGVRNFELLFTSRPFVIGLRNSFLYSIISLPV
                     TLMIALIISSAIVFVYNKVAKGFWQTIFFLPYVTSSVAISIAFIYILDSSTGVLNAII
                     GKNIPWLTSGEIDGYKALFGILIYGVWRNLAFNVLILSMAMLSVDKTLYKAASIDSAS
                     PIKQFFKITLPSIKKSINFLLTLGILGGLQVFPLAIFSNNPDAAISNGASTVLIFIFR
                     SIRSADYGIAGAATIILFVLGTLYGLFLRNTVNLFDAIILKVKIRNVRIKAKI"
     gene            47492..48469
                     /locus_tag="MGF_RS00180"
                     /old_locus_tag="MGF_0266"
     CDS             47492..48469
                     /locus_tag="MGF_RS00180"
                     /old_locus_tag="MGF_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885795.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574376.1"
                     /db_xref="GI:504387274"
                     /translation="MFALKLKFKNWISNLKIKKNYERVSLEIKDTTWRSIILGFIFKS
                     LILLFFGMIIIFPFYFMIVVALAPDAQVLDQRKPILWPDSFNFVNFARVLREADYWYA
                     LLVTSFITALSVILRLFFTMTFGYAFSLKNWKFKRAFWLLYLSILILPESALLIGQFR
                     TITLLQWNDRADPKILISLVTPYVASIFSGYMFKNAFEAIPSRIKESALIDGCSGAKY
                     FFKVAVPLVKPTIWTVTILTSFASWNSYLWPLLLLDSQSKVFNVINLWVIRQGIDPNS
                     DPSGQQIILTNLRMAATIVAIVPMFIVYFIFRKRIMTSVGRRGNNTIKG"
     gene            48664..49632
                     /locus_tag="MGF_RS00185"
                     /old_locus_tag="MGF_0272"
     CDS             48664..49632
                     /locus_tag="MGF_RS00185"
                     /old_locus_tag="MGF_0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="exopolyphosphatase-like protein"
                     /protein_id="WP_011883667.1"
                     /db_xref="GI:500213492"
                     /translation="MVKGNILQAVQTIEKYDYIVIFHHIRPDGDCLGSQFGLKELIET
                     NYPNKEVKVVGDKKDCFPFLEMNHDHIDHEWFKNKKVLGIVVDANFKERIECRSLIDD
                     QLFDAILRIDHHPNEDDLDAKAFFIDSSYIAAAEQVADIAYQSKWKVTPKAANYLYLG
                     IYTDSGRFLFKNTSARTYMLASFLADANADLFYINQNLSKVSLSDLKFKQYVFANYKT
                     KDQVIYFVCSKAVQKELNRTSFECARVNMLSNIEDFRIWLFFIEEDDNKWRIDFRSNG
                     PSVRTIALKWGGGGHEMASGAIINGEENIINVVNDCSEQIKSFLEH"
     gene            50551..52545
                     /locus_tag="MGF_RS00190"
                     /old_locus_tag="MGF_0283"
     CDS             50551..52545
                     /locus_tag="MGF_RS00190"
                     /old_locus_tag="MGF_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574377.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. The beta-hairpin of the
                     Uvr-B subunit is inserted between the strands, where it
                     probes for the presence of a lesion; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="excinuclease ABC subunit B"
                     /protein_id="WP_014574377.1"
                     /db_xref="GI:504387275"
                     /translation="MAEKKFKLVSKNKPAGHQPEAIKKLVDGINKNKKYQTLLGATGT
                     GKTFTIANVIEKTQKKTLILAHNKTLAAQLYLEFKELFPNNAVEYFVSYFDFYQPEAY
                     IPRTDMYIEKSSVTNDEIEMLRLASLNSLSTRNDVIVVASVACIYPAANPEDFDIYRI
                     ILKVGNTLKLSDLKENLIRLNYARSPECNEPGTFRIKGDVVDIFPGYVNDHIIRLSFF
                     GDELEEIRKIHPTDSSVIEKYTSYVLGPANEYILNFERKDTAIKRIQEELMFRVQEFK
                     NQQKLVEAQRLQQRTEYDIDAIKEFGFCNGIENYAFHLELREKGSTPWTLFDFFGNDW
                     LMVIDESHISVPQVKGMFNTDKSRKTTLVEYGFRLPSALENRPLNYDEFSNKSDQVIF
                     VSATPNDEEIKLSNNEIIEQIVRPTGLLDPTVEIRPRLDQINDLMNELKKQKDKNERT
                     FITVTTIKIAEDLTEYLKERNFKCAYIHNELKTLERSLILNDLRRGKYDCVVGINLLR
                     EGLDIPEVSLVCIFDADKPGYFRSDKALIQTIGRAARNQNGRVIMYADEMTKAMKIAV
                     DETNRRREIQEKFNKDHKITPKTIIKPIYNDLRNKASHKQIEEAMRKTKAKGDKFIKM
                     IEDLRNEMLEAAKNQNYEHAASLRDLIIELETQQLNKTNK"
     gene            52591..53748
                     /locus_tag="MGF_RS00195"
                     /old_locus_tag="MGF_0294"
     CDS             52591..53748
                     /locus_tag="MGF_RS00195"
                     /old_locus_tag="MGF_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014574378.1"
                     /db_xref="GI:504387276"
                     /translation="MKPLFRKKILLFFSVVSLSYLMSSCSLNFVVINTRGSSSVQPFM
                     DALSALYAKYEPVEISVQAGGSTSGISSVLDGTSNIGNASRSPRDQVLANPRTTQQWK
                     DLEIKTVALAKDAIAVIYKKPANASSNDFYVDANNISKLYDAFAGFNHVSLSDFYFGN
                     QKLPNDNIVPFARSGAASVSGTAEAFLHNSGLIKQDQLTKQTLEALQGRTDYGINTIT
                     TGESNVETYNFFKTNARLVGSMTYLSLGFILNNLEMIKNDGFDILNYKINDQLIIPSI
                     QTVTDGTYRWVRPYNAIFSLSNKDDNKLNSIKQFIKFTLFNQSADIKKQIDKVYELQG
                     LILLSDKELKQMFLLNDQLSNQSPQELIANHENLFWVSDFSFNPVKFGVEF"
     gene            53748..55706
                     /locus_tag="MGF_RS00200"
                     /old_locus_tag="MGF_0303"
     CDS             53748..55706
                     /locus_tag="MGF_RS00200"
                     /old_locus_tag="MGF_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_014574379.1"
                     /db_xref="GI:504387277"
                     /translation="MLNTNKFNQFKKARSKLFHSISFTAAWLFAITFVGIFAFIFYKS
                     IPGWESYGKSIFRLDFNLVQNKAGIWAPLSVTLFVTFVSLLIAAPIGVNTAIFIKFRL
                     KEKWRKTFRIIINILAGIPSVVFGLFAANSLGFLVQAIFDTRTSWNLITAIIMLTFMI
                     IPTIVAMSYNSLDSVDMSILSASIALGTTKTKSIYKIFKKEAKNGIYVSLLTAFSRAI
                     SESMALNFILTSQNYNIVGHTPFNDFIQSGLKTIGAIISYNFFAENGSENLRSVLYLF
                     GIILFIFTIIINILVLFINKSSTKKKYPWAIKVETFIANIILFIPNKISQSIVYLINL
                     NKRSASYFKVHKNAIRVKAYDYWRQTVEFICMTICVGFILWILIYTFYHGFIAIFSPD
                     QTITSFAANSTGRATVNTLVIIFFGILIAFPISLFIAIYVNEYARNNKAKTTILFFID
                     ALSSTPSILFGIFGLTFFIQTLWLAIGGRSSNSMIAGILTISLVIMPAFIRMLQQALA
                     SVPNSTREASYALGISRSQTILKIILPQVIEHILSSIILSISRILAETAPLYITAGLS
                     SSNHFSLGLWGQTLTVRIYSQLFSTQANAQNIMFESAFMSIFLIFIFILISNLLIPYL
                     FKNKYKILIWWDKWKTKRKNKKDNLNYA"
     gene            55699..56676
                     /locus_tag="MGF_RS00205"
                     /old_locus_tag="MGF_0310"
     CDS             55699..56676
                     /locus_tag="MGF_RS00205"
                     /old_locus_tag="MGF_0310"
                     /EC_number="3.6.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883675.1"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="WP_014574380.1"
                     /db_xref="GI:504387278"
                     /translation="MHKKIDPQTKELYLQKKGEYKEKIKELVQKKKELLSIDNKDELI
                     KINEKIKRYKILYKNKDPNLIHFKDDYNFDNIFEIDNYNLWYSNKAKHALKDINLGIK
                     KNKVTALIGPSGCGKSTFIRSLNRMHDLTDGVSKTGSIFFLSKNIYSKTLPELELRSK
                     VGMVFQKPTPFSLSIYENIAYALKSHGIKDKTKIDQIVKESLEGAALWDDVKDILFQS
                     AYGLSGGQQQRLSIARAIALKPEVLLMDEPTSALDPIATNKIEQLIHQLKKSYSIVIV
                     THSMAQAQRVSDETVFFYEGRVLEHGTTKQIFTQPNNEKTKDYIDGRIG"
     gene            56679..57365
                     /locus_tag="MGF_RS00210"
                     /old_locus_tag="MGF_0316"
     CDS             56679..57365
                     /locus_tag="MGF_RS00210"
                     /old_locus_tag="MGF_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphate ABC transporter"
                     /protein_id="WP_011883677.1"
                     /db_xref="GI:500213503"
                     /translation="MSRNYKSLKYSEQELISKFYEYIDHGIKIHEKLLQALCNYKNHE
                     PYQEILDEIFKMEKHSNIKQADLLDDSTWIISKEQPQTSHLRFIIAIISSSNDIERIC
                     DYANNVAKFLLKNDNISPQKLDVIIDLQENSLNNYKDVVAHLKENDAEETYKFADIRQ
                     QEFESKYKRYLKNFKKYDLNSEDELQLNLLIDTILVIKNIERINDHLVNIVEYFVYIK
                     ESSFFFDKKI"
     gene            complement(57441..59609)
                     /locus_tag="MGF_RS00215"
                     /old_locus_tag="MGF_0334"
     CDS             complement(57441..59609)
                     /locus_tag="MGF_RS00215"
                     /old_locus_tag="MGF_0334"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574381.1"
                     /note="Catalyzes the rate-limiting step in dNTP synthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_014574381.1"
                     /db_xref="GI:504387279"
                     /translation="MSDGFKEANGYLAYNAMSKLDEGKNSVLNDAKAVALYMQVHVKP
                     RTKKFNSIHERMDYLIKNDFYEKEVVENVSKEQLEELYGVIKEFDHEFPSFMGAFKFY
                     NSYCLKSNDGKEFYETYSERCLMNALFLGGKNFQNVKNILIEILSGRFQPATPTFLNA
                     GKKQRGEYVSCYLLRVEDNMESIGRAIVTSLQLSKRGGGVALCLTNLREFGAPIKNIE
                     GQASGVIPVMKILEDSFSYANQLGQRPGVGVAYLHAHHPDVMVFLDSKRENADEKIRI
                     KSLALGLVVPDITFELAKNNEQMALFSPYDVQREYGKPFSDIKVTEEYHNMVNNPRIK
                     KTYISARKFFQTIAELHFESGYPYLLFDDTVNNRNPNAGRIVMSNLCSEIVQSSTSTE
                     YNEDFSIKKLGQDISCNLGSVNIDKMMRSAERFEDSVYYAIKSLDHVSKSANLDCAPS
                     VKNGNANNHALGLGAMNLHGFLATHEIYYDSPEALEFTDFFFYTLAYYAFKASNRLAV
                     EQKQTYANFKTSKYADGSYFDKYTKCDPNTYVIKNPKIKEIFSNYKIKVPTQADWQAL
                     TEEIKKTGLANAHLLAIAPTGSISYLSSCTPSIQPVVAPVEVRKEGKIGRVYSLAYKL
                     NEHNYKYYKDGAYELGPNPYIDICAQAQKHVDQAISLTLFMNDTATTRDLNKAYIRAY
                     KSKCASVYYVRVRQNVLEESENLDWAKDQASTVDCEACQI"
     gene            complement(59706..60161)
                     /locus_tag="MGF_RS00220"
                     /old_locus_tag="MGF_0337"
     CDS             complement(59706..60161)
                     /locus_tag="MGF_RS00220"
                     /old_locus_tag="MGF_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonucleotide reductase"
                     /protein_id="WP_011883682.1"
                     /db_xref="GI:500213508"
                     /translation="MENTPKLNVPKRKPTGEMRVVYFSSTTENTKKFCDKLGLPATRI
                     PIKPSEEIEVDYDYVLICPTYAGGLDDFKGSVPRQVIKFLNKVQNREHCVGVVASGNT
                     NFGETFGLAGHVLRAKLHVPLLHVFELIGTKYDEELVRERIHKLWNWEE"
     gene            complement(60164..61183)
                     /locus_tag="MGF_RS00225"
                     /old_locus_tag="MGF_0346"
     CDS             complement(60164..61183)
                     /locus_tag="MGF_RS00225"
                     /old_locus_tag="MGF_0346"
                     /EC_number="1.17.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9XC20.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonucleoside-diphosphate reductase"
                     /protein_id="WP_014574382.1"
                     /db_xref="GI:504387280"
                     /translation="MSNNNKYYDKSFSPLGYVANGQKGVMRSINWNVINDPKDLEVWT
                     RVTQNFWLPEKIPVSNDLKSWNELTPEWKQLVTRTFTGLTLLDTIQCTLGDIAQIPNS
                     LTDHEQFVYANFSFMVGVHARSYGTIFSTLNTSDEIEEAHEWVINNEKLQARAKFLVP
                     YYTSDDPLKSKIAAALMPGFLLYGGFYLPFYLAARGKLPNTSDIIRLILRDKVIHNYY
                     SGYKYRLKVQKLPKEKQEEYKKFVFEILDKLIELEKDFLRELYDGFGLADEAIAFSLY
                     NAGKFLQNCGYESPFTPEETKISPEVFAQLSARADENHDFFSGNGSSYIMGVTEETQD
                     DDWEF"
     gene            61730..62599
                     /locus_tag="MGF_RS00230"
                     /old_locus_tag="MGF_0350"
     CDS             61730..62599
                     /locus_tag="MGF_RS00230"
                     /old_locus_tag="MGF_0350"
                     /EC_number="2.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9XC19.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thymidylate synthase"
                     /protein_id="WP_011113275.1"
                     /db_xref="GI:499425811"
                     /translation="MKTYLDLLEKVMTKGEVKKDRTNTGTISYFGTQSRYDLREGFPL
                     LTTKKMAWKAICHELLWFLKGDTNIKYLVDHNVNIWNEWPYEAFKKSNDFKGESLQDF
                     VEKIKTDNQFAQQYGKLGPVYGKQWRDFNGVDQIEWVINEIKTNPFSRRLIVSAWNPG
                     EIKEMALPPCHSFFQFFVNEKYEISLQLYQRSGDLFLGVPFNIASYSLLLLMVAQVTG
                     LKPAEFIHTIGDTHIYSNHLEQVKIQLQREPKKLPKVTLNPDIKNIFDFRFEDISLEN
                     YEHHDPIKGKVAV"
     gene            62599..63552
                     /locus_tag="MGF_RS00235"
                     /old_locus_tag="MGF_0354"
     CDS             62599..63552
                     /locus_tag="MGF_RS00235"
                     /old_locus_tag="MGF_0354"
                     /EC_number="1.5.1.3"
                     /EC_number="3.5.4.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="deoxycytidylate deaminase"
                     /protein_id="WP_011113276.1"
                     /db_xref="GI:499425812"
                     /translation="MIKLIVAMDEANLIGKKDKMPWHIKEEFEHFRKTTIGHALLFGK
                     TTFLGLPGKLENRKHYVFSRKDQISNADETIRSEKELLELFKAYKDSQDILFIAGGKY
                     IYEHYYQYADELIISRIKNKYEGDVYLNLDLSNYFLMNVEENSKFTVEFWLKKSDNNK
                     TNANVISWDEYFMMLANVSAMRSKDPSTQVGACIVNKKKYVIGLGYNGMPKGLDNIFP
                     WDRTNQDSAKTKYPYVVHAEINAILNTSTVIEDCTLYTNLFPCSNCAKTIVQSGIVEV
                     VYEDNKYEHLPDNKISTHILKSSNIKLRQHKTRHKITEKDK"
     gene            complement(64452..64715)
                     /locus_tag="MGF_RS00240"
     CDS             complement(64452..64715)
                     /locus_tag="MGF_RS00240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_027333163.1"
                     /db_xref="GI:653082650"
                     /translation="MLDKKVKFDYIVLPKVESSAVLKEAINFLRTKRATQKLILIIES
                     ALGYYQITRIKFGKRTFKSYLWSICRNKWSFFWFKLRNWIWNS"
     gene            complement(65173..66054)
                     /locus_tag="MGF_RS00245"
                     /old_locus_tag="MGF_0374"
     CDS             complement(65173..66054)
                     /locus_tag="MGF_RS00245"
                     /old_locus_tag="MGF_0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574315.1"
                     /db_xref="GI:504387213"
                     /translation="MQLGTILMIIVSLWLLLIIATSKFFIRFENNYWFWFFIGGFMFF
                     YMIIGRQIQFLIPGWNAADDNSPFAVSIRHSRLLLLDICPFFAIFAGFGLMVTKNKLI
                     IRSAAPIALFGGLINLYGELFRLANQYTGKLEAYRFIFIGIGNDQLYFILHVMTTTVA
                     LMLICWTTKWTPRDILNQYLFIAIYACYVLSSIQLDRKITNNANGILIADWYIGGEYQ
                     SVSKILRVPFPTVIPVGVVITMVSITLIWAMRYGVQELNARIIYPSLAKKQTKFDLKY
                     MWKNLKYNYLKRRNKSR"
     gene            66370..66672
                     /locus_tag="MGF_RS00250"
                     /old_locus_tag="MGF_0376"
     CDS             66370..66672
                     /locus_tag="MGF_RS00250"
                     /old_locus_tag="MGF_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52331.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_036447306.1"
                     /db_xref="GI:738498374"
                     /translation="MTEIKIKLKSYDSRLLDQSVKKIFEIVKETGSKFCGPIPLPTKK
                     EVFTIIRSPHVDKASREQFERRTHKRLIIIKNLKNETIQKLKRFVIPSGVELRIYL"
     gene            66704..67414
                     /locus_tag="MGF_RS00255"
                     /old_locus_tag="MGF_0380"
     CDS             66704..67414
                     /locus_tag="MGF_RS00255"
                     /old_locus_tag="MGF_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_011113280.1"
                     /db_xref="GI:499425816"
                     /translation="MKGIFGTKVGMTQVFEENGRLIPVTLVRVEPNQVVSVKTKEKDG
                     YDAVQLGFNQTDEKNLNKPQLGHFKKANTNNYKYLEEVRGMVGYKIGDLLKVEELFQE
                     GQVVDVQARTKGRGFTGAIKRWNFKIGSKGHGAGYPHRFQGSVQAGRGGSQAQRVMKG
                     KKMSGHYGNELVTIQNLSIVGFLPEVSSVMISGAIPGANNSKVRITTSKKNPNTVLTY
                     KLIINKKASKPAGEQAQE"
     gene            67441..68070
                     /locus_tag="MGF_RS00260"
                     /old_locus_tag="MGF_0387"
     CDS             67441..68070
                     /locus_tag="MGF_RS00260"
                     /old_locus_tag="MGF_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_011113281.1"
                     /db_xref="GI:499425817"
                     /translation="MSKIKLFDLSGKVQEEIELNQKLLVSEVHKQAIFDAILAENLSQ
                     IQGTHSTLKKGEVSGGGKKPYQQKHTGRARQGSIRNPHYVGGGIAFGPKPNRNYKIKV
                     NKKVSSLAFKSAITSKVNNNEFLGLVDSIKQDKPSTKAIAKLLKELKVNKKVLIVAFE
                     KNENLEKSSANLPNVSYKLWNQVSVKDLIDANCVLAQKSAINNWVERLN"
     gene            68073..68399
                     /locus_tag="MGF_RS00265"
                     /old_locus_tag="MGF_0391"
     CDS             68073..68399
                     /locus_tag="MGF_RS00265"
                     /old_locus_tag="MGF_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_011113282.1"
                     /db_xref="GI:499425818"
                     /translation="MQITDVLIKPILTEKTYGIMMSEPRKYTFLVNAKANKNYIKQAF
                     KAIYGVTPIAVNTKIKKPARVRTGTQNPGYSRLEKIAIITVPFGVEVAITGEKPEPKE
                     ESSSKK"
     gene            68446..69297
                     /gene="rplB"
                     /locus_tag="MGF_RS00270"
                     /old_locus_tag="MGF_0395"
     CDS             68446..69297
                     /gene="rplB"
                     /locus_tag="MGF_RS00270"
                     /old_locus_tag="MGF_0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883703.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_011113283.1"
                     /db_xref="GI:499425819"
                     /translation="MPVKKIVNRSNSGIHHKISIDYSKVLTTNTPQKSLLAKKKKNSG
                     RNNQGKITVRHRGGGSKRKYRIIDFKRNLHDDKIALVKSIEYDPNRSAFISLIAYENG
                     YRSYILTPQGIKVGDKVVSSSQAIDIKVGNCMPLEFIPEGTMVHNIEMTPGKGAQIAR
                     SAGAYAQILGKDDTGKYINLKLGSKEVRKFLKNCRAVVGIASNVDHNLVLLGKAGTTR
                     HKGIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNNKKSSTQLI
                     IRRRNSK"
     gene            69318..69581
                     /locus_tag="MGF_RS00275"
                     /old_locus_tag="MGF_0403"
     CDS             69318..69581
                     /locus_tag="MGF_RS00275"
                     /old_locus_tag="MGF_0403"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_011113284.1"
                     /db_xref="GI:499425820"
                     /translation="MSRSSKKGAFVEASLYKKVLDMNAQQKKKIIKTWSRRSTIFPDF
                     VGHTFAVHNGKKFINVYVTEDMIGHKLGEFSPTRTFKGHSSNR"
     gene            69592..70026
                     /locus_tag="MGF_RS00280"
                     /old_locus_tag="MGF_0406"
     CDS             69592..70026
                     /locus_tag="MGF_RS00280"
                     /old_locus_tag="MGF_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_011113285.1"
                     /db_xref="GI:499425821"
                     /translation="MIAIARQNRVRISPQKARLVCQLIKNKSVIEAQNILVNTDKKGA
                     RIILKLLNSVIANATNNHAMLAEKLYVYEVVANQGPTLKRNLPRAKGSADMIRKRSTN
                     FVIKLSDDKNERKHEVEAIKTRLKKRVLGQNKRKQSVSGEKK"
     gene            70029..70820
                     /locus_tag="MGF_RS00285"
                     /old_locus_tag="MGF_0410"
     CDS             70029..70820
                     /locus_tag="MGF_RS00285"
                     /old_locus_tag="MGF_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52338.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_011113286.1"
                     /db_xref="GI:499425822"
                     /translation="MGQKVNSNGLRFGINKNWQSRWVAKTNQQTGDWIVQDEKIRNYL
                     FKKFHSAFISNVDIERTQTSIRVFIYASQPGIILGKEAANIKVILLAINKIVGRHIKV
                     DVDVLEVGNPSLSAKIVARELADAIENRTPLRTAMRQALKRVLKAGAKGIKVLVSGRL
                     NGVEIARDKMYIEGNVTLSTLRTDIDYALEEAQMSYGVIGVKVWINRGEIFGKDFYKK
                     QAHIVKPKGSEANHQRRNSNKSKDYRDNKNKQFNKNHQNQQPAKE"
     gene            70826..71242
                     /locus_tag="MGF_RS00290"
                     /old_locus_tag="MGF_0416"
     CDS             70826..71242
                     /locus_tag="MGF_RS00290"
                     /old_locus_tag="MGF_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52339.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_011113287.1"
                     /db_xref="GI:499425823"
                     /translation="MLQPKRTKYRKPHNVSYEGKAKGNSYVAFGEYGIMATNGAWIDA
                     RQIESARIAISKQLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKEGTV
                     MFEVANIPEAQMKEALTRAGHKLGVTWKIVARQGAQ"
     gene            71242..71703
                     /locus_tag="MGF_RS00295"
                     /old_locus_tag="MGF_0421"
     CDS             71242..71703
                     /locus_tag="MGF_RS00295"
                     /old_locus_tag="MGF_0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_011113288.1"
                     /db_xref="GI:499425824"
                     /translation="MNKELRAKTNEELIQLVTQLKGRLLEYRFKLAQGELDKTHIIKE
                     TRQTLARVLTILTERDVKVNVNAMVSSFVKEQTKQKEIQESVKKIKQLRVAKLKQNKE
                     KRLANAEKVKAAPKPEQKTKKVKKAPKKTETVKPTTNKNKKNVKAKTKKKG"
     gene            71709..71966
                     /locus_tag="MGF_RS00300"
                     /old_locus_tag="MGF_0424"
     CDS             71709..71966
                     /locus_tag="MGF_RS00300"
                     /old_locus_tag="MGF_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_011113289.1"
                     /db_xref="GI:499425825"
                     /translation="MRNSRKVLMGVVVSDKMQKTATVKVESKNRHPFYHKLVISHKKY
                     HVHNEEGENAAKVGDKVLIMETRPLSATKRWRIAKIIERAK"
     gene            71994..72368
                     /locus_tag="MGF_RS00305"
                     /old_locus_tag="MGF_0427"
     CDS             71994..72368
                     /locus_tag="MGF_RS00305"
                     /old_locus_tag="MGF_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_011113290.1"
                     /db_xref="GI:499425826"
                     /translation="MIQFMTRLNVADNTGAREVGVIKVLNGSKRRYASVGDIVVVSVK
                     DAIPSGTVKKGQVLFAVIVRTKKGAQRRDGTHLAFDDNACVIIKNREDFAPRGTRIFG
                     PVARELRDKGFNRIVSLASEVL"
     gene            72379..72708
                     /locus_tag="MGF_RS00310"
                     /old_locus_tag="MGF_0429"
     CDS             72379..72708
                     /locus_tag="MGF_RS00310"
                     /old_locus_tag="MGF_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_011113291.1"
                     /db_xref="GI:499425827"
                     /translation="MQRIKKGDKVVIIAGKHKQKTGIVLQVFVKEQRAIVEGINMVKR
                     HTKENAQNQKGGIIEKEAPIHLSNLALLDHKAKDVRPVKVKYGTDPKTNKKVRLSRKT
                     NNLVGGQ"
     gene            72708..73265
                     /locus_tag="MGF_RS00315"
                     /old_locus_tag="MGF_0434"
     CDS             72708..73265
                     /locus_tag="MGF_RS00315"
                     /old_locus_tag="MGF_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_011113292.1"
                     /db_xref="GI:499425828"
                     /translation="MNLKTKYKTKIVPLLQKEFGFSSVMQVPKIEKIVINMGVGDATK
                     DAKLLELAQAELQAISGQKPVITKAHSSNASFKIRQGQAIGCKVTLRGEKMWNFLEKL
                     INIALPRVRDFRGLSNRAFDARGNYTLGIKEQIIFPEIIYDNVKKIRGFDVTLVISSD
                     NAKYNHRLLLELGMPLIKTKEHANG"
     gene            73258..73443
                     /gene="rpsN"
                     /locus_tag="MGF_RS00320"
                     /old_locus_tag="MGF_0436"
     CDS             73258..73443
                     /gene="rpsN"
                     /locus_tag="MGF_RS00320"
                     /old_locus_tag="MGF_0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52345.1"
                     /note="located in the peptidyl transferase center and
                     involved in assembly of 30S ribosome subunit; similar to
                     what is observed with proteins L31 and L33, some proteins
                     in this family contain CXXC motifs that are involved in
                     zinc binding; if two copies are present in a genome, then
                     the duplicated copy appears to have lost the zinc-binding
                     motif and is instead regulated by zinc; the proteins in
                     this group appear to contain the zinc-binding motif;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_011113293.1"
                     /db_xref="GI:499425829"
                     /translation="MAKTSLKIKQARHAKFKVRAYTRCKRCGRPHAVYRKFGICRLCF
                     RHLAYNGSLPGVKKSSW"
     gene            73467..73868
                     /locus_tag="MGF_RS00325"
                     /old_locus_tag="MGF_0438"
     CDS             73467..73868
                     /locus_tag="MGF_RS00325"
                     /old_locus_tag="MGF_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011113294.1"
                     /db_xref="GI:499425830"
                     /translation="MHFDPVADIITKINNANRAKIVELQTEASKLKVAILNILLNEGY
                     IRGYEIYDNKEKTKSILKIKLKFDENRVSSLNGIKQISKPGLRIYVSAEKLPKVLNGL
                     GIAIVSTNEGLMTDKLARAKKIGGEVLAYVW"
     gene            73887..74438
                     /locus_tag="MGF_RS00330"
                     /old_locus_tag="MGF_0441"
     CDS             73887..74438
                     /locus_tag="MGF_RS00330"
                     /old_locus_tag="MGF_0441"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52347.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_011113295.1"
                     /db_xref="GI:499425831"
                     /translation="MSRIGNRVITVPSNVSVNQTKELLTVKGPLGQLDLKLKEGSKIK
                     VNVENNEIRLTRGDELKQTKMLHGTYNALIKNALEGVTVGFKKELRLVGVGYRASLKD
                     NVLNLQLGYSHPINLDIPKDLKVTVDKNTEITVSGIDKQKVGEFAIQIRKWRMPEPYK
                     GKGVLYLNEQIIRKAGKTAEGKK"
     gene            74445..74804
                     /locus_tag="MGF_RS00335"
                     /old_locus_tag="MGF_0445"
     CDS             74445..74804
                     /locus_tag="MGF_RS00335"
                     /old_locus_tag="MGF_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_014574383.1"
                     /db_xref="GI:504387281"
                     /translation="MKQVNMNRNERRQMRHKRVIKKIRRIDNDRPVMIVVKSNSHISA
                     QVWDFNQNKIIASSSSVSLDLVNGNKENAAVVGTDIANKLLKMKIDEITFGHGGSKYH
                     GRIAALADAARKAGLKF"
     gene            74818..75498
                     /locus_tag="MGF_RS00340"
                     /old_locus_tag="MGF_0448"
     CDS             74818..75498
                     /locus_tag="MGF_RS00340"
                     /old_locus_tag="MGF_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52349.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_011113297.1"
                     /db_xref="GI:499425833"
                     /translation="MEDIKHNKKPNTNNSAETKKASGANPQANHANPNNRSASVNNNS
                     VNNNKKNSSRSSDERNKRKNEKRTKSEFEEKIVKISRISKTTKGGRTMRFSALVVVGD
                     RKGRVGFGIAKALEVPNAIKKALKMAENNVQKIAMNKHGTLFHDVLGRSGAAKVLIKP
                     APSGTGIIAGGAIRAVVELAGFTDVYTKNMGKNTPINMVRATMDGITSQYTPRQIAKL
                     RSKSLKEL"
     gene            75514..75957
                     /locus_tag="MGF_RS00345"
                     /old_locus_tag="MGF_0455"
     CDS             75514..75957
                     /locus_tag="MGF_RS00345"
                     /old_locus_tag="MGF_0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52350.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_011113298.1"
                     /db_xref="GI:499425834"
                     /translation="MKLHELKSAPKSRNHKAKVVGRGHGSGLGKTSGRGQKGQKARKS
                     GRTRPGFEGGQTPLYRRLPKFGFQTVGFKKQTLSVSLDIIAKLNETTIDRELLVKHGI
                     ISSKTNEPIKVIGNKIDKKIHLKINKISEGAKKAIQSAGGSIELI"
     gene            75970..77466
                     /locus_tag="MGF_RS00350"
                     /old_locus_tag="MGF_0459"
     CDS             75970..77466
                     /locus_tag="MGF_RS00350"
                     /old_locus_tag="MGF_0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_014574384.1"
                     /db_xref="GI:504387282"
                     /translation="MAKTNSKNLLGQKIIKLLRNRDFVISVFVTLFLILLFRVISVIP
                     LPGITISQNKNNLNNGVSDFFDLFNLLGGGGLSQLSLFAVGISPYISAQIIMQLLSTD
                     LIPPLSKLAKSGELGRRRIELITRFVTLPFAVVQAFAIIALINNQRNGAIRFENGGIL
                     HQAFYIVTMTAGTYIGIFIGDIISKKGVGNGITLLILSGILARLPDGFIVMYRVLGGV
                     IISTNPILTSAINFSLYFLAFLVLLLAITFVNSSTRRIPIQQTGEGMVLGNEKLPYLP
                     IKLNAAGVIPVIFASSIMSIPITIAEFQPQSEARWFVEDYLSLRTPVGISLYVVLIII
                     FTFFYSYIQINPEQLAENFNKSHKFIPGVRPGLDTEKHITKVLMRINFIGAPFLAIVA
                     VIPYIISLVLNVPTTLSLGGTGIIIMVSASMELYRSLRSAATTTSYQRLRKDIANRIE
                     VELSLNDYMNKPNLEHDQYGLLGKHKKVEPTQDKKKNPSDPLEVSQLW"
     gene            77460..78104
                     /locus_tag="MGF_RS00355"
                     /old_locus_tag="MGF_0467"
     CDS             77460..78104
                     /locus_tag="MGF_RS00355"
                     /old_locus_tag="MGF_0467"
                     /EC_number="2.7.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="adenylate kinase"
                     /protein_id="WP_014574385.1"
                     /db_xref="GI:504387283"
                     /translation="MIRLIFLGAPGTGKGTISSYLKEQHGFFHISSGDLFRFYAKEEK
                     TALAEEIKSYINNGLYVPDELTNRTVADFYHKNQSQDKIIFDGYPRTLNQCEYIDEII
                     KFTHVILLQPTDWDMIINRLSSRRSCPQCKRIYNINSVDFKPKVANLCDLCKVELIHR
                     KDDDPSVVSTRINVYNEQTKPVIEYYKKKNLLHAVDANKSFEELYKLVLEIVNK"
     gene            78115..78867
                     /locus_tag="MGF_RS00360"
                     /old_locus_tag="MGF_0474"
     CDS             78115..78867
                     /locus_tag="MGF_RS00360"
                     /old_locus_tag="MGF_0474"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methionine aminopeptidase"
                     /protein_id="WP_014574386.1"
                     /db_xref="GI:504387284"
                     /translation="MIYIKNPNEIQKIKNAAQIYKKIVKQFNFDYIKNKSLKEIDQML
                     RDFVSQHHANSCYHGYLGFKGYHCLSLNQTIIHGLANDDIFTSKDKLTIDIGIELDNY
                     YCDSAFTILGPDVNLRQKLLSEVTHNCIFDLVKKIVPNQTTTNDLGIWTEEYAKKHGY
                     NVIKDFGGHGCGIKIHEDPIILNYGTKKPGELLTPNMVICIEPMFFEKDNRYYIDPVD
                     SWSVKPVNKNQYVCHWEHMVLIKEDQAEILTL"
     gene            79047..80018
                     /locus_tag="MGF_RS00365"
                     /old_locus_tag="MGF_0480"
     CDS             79047..80018
                     /locus_tag="MGF_RS00365"
                     /old_locus_tag="MGF_0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O52354.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="lactate dehydrogenase"
                     /protein_id="WP_011883724.1"
                     /db_xref="GI:500213550"
                     /translation="MKKIAVIGCGFVGSTYILDLLQQGVQADYLLVDKNTNLADGHVR
                     DLRDSKSLKSHNGSTFNVGTYDDLKDADVVAITASIPTVPTADGEVFTDRLQLMTANV
                     KILNEIALELKRVGFKGLSIIPTNPCDVMAGVYQKVTGFDPHKIISTGCQLETMRTRK
                     MISEALGVNSDSVEGFVVGEHGSGAIVPWSVFRVGNVPMKQLIAEGKIKEEYVKDIFP
                     RVVKEAFEIIKFKKATYFGIAESMSLITRAYIYNLNMVLGVGVQLDDKYVASGIYFTV
                     PAVVGKHGWKLHSKLQLSQEEQAAFDKSALNIQKVTKDALDLIGFKN"
     gene            80465..83377
                     /locus_tag="MGF_RS00370"
                     /old_locus_tag="MGF_r01"
     rRNA            80465..83377
                     /locus_tag="MGF_RS00370"
                     /old_locus_tag="MGF_r01"
                     /product="23S ribosomal RNA"
     gene            83448..83552
                     /locus_tag="MGF_RS00375"
                     /old_locus_tag="MGF_r02"
     rRNA            83448..83552
                     /locus_tag="MGF_RS00375"
                     /old_locus_tag="MGF_r02"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(83613..86996)
                     /locus_tag="MGF_RS00380"
                     /old_locus_tag="MGF_0543"
     CDS             complement(83613..86996)
                     /locus_tag="MGF_RS00380"
                     /old_locus_tag="MGF_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574387.1"
                     /db_xref="GI:504387285"
                     /translation="MLFSVFWHILIRMKKAYLLLSALALPLTSFQGGFSYKAAVNEFK
                     LVNHNSNNSTVSLTTRSSPVNLTFTLNPDRSKNTVESIKEQIVNLADQQFQKYFREVQ
                     SWIDEFKEEFRQLYQIDSVEYVESRLYNIDRDTRSFQDILDNSWFVRSNDERTDKSRS
                     AYGEINNFGTYSDSNSANYDFAGKYNPTFKSYVEIIHNYSRVTKQIEIPKYDVKKLPL
                     SDLQLTNGFVKYKANRSLNGAFDPIPNTNNQYYAFTNVDISSDKFTIREKKYTGWEPT
                     LSDLNTNFEKRKNLTSVKLLRWKIHPVDAATYERFTIKPNKNIFPDASNYTEYNKRRL
                     FFWKHPSGKWRIVNDRDLVNATNNWYYGSGYRIIQTRPQDFDRLYDLKDAPKTLNINI
                     DQRSKLISSKYNIFADYFVLPDNFTYKTLNFNITNKTVFNGYRNLINLFLNNLKLVND
                     AIELRENYIYSKLDSNLRFGFWYNDRLIKLIDHIRKIKKYTVNSTQNKYKNLALDYAD
                     ITSLERNTSKEFFNNLISGKGRNYVSNFQRELFYFLGVTTNEIDDYQYNFIMSLPQLF
                     DDFNRATKLVADIYVGSNKISDRVLISNNDIKMIDINLEEIRNQIPQLDLNRNRLQLK
                     LDNLRFVSQEIDDNNGKISNFLNIQNDHLIFKIDDVSVKLNLNYRYDFLNIKYKNSIA
                     QLNDFNVNTFEPLYASDFNHKIGVERSLNISDILIDSYKSIYLNSNSIYINQDGVYSP
                     DQGIWTGDDLTIMSRLADRYSLNFVPNDVTGEFWSIIRVLNGNDFAIPGTEMNPELIP
                     NRLYFLKNDENFKAKFYLVKFKAFNKVIDVNKSRVSFVHEIVPIIKLNYLNNDFEIRL
                     LTDYDNNLLSDQTINLRINQEFSIRKEDSMKLIKVIEPVLAANGLRILNNSIEVNERA
                     NQLNFTLYSLDKVEKTAFNPITNFDLVFEKENNNIFKIIGKFDNNTIFNLNYQVTISD
                     DKITLELLTPDLWNLTPVINSKAKITELIKNELNKYNLTVRSWDNFDVVNKTNEIELI
                     NTSATSFDENEGDIPREEILRNNQQNDQIPTKDNATSNNHQKDKIETKEASSISFDLS
                     DKRNLIIFIVSVSLISLGIIGGVGYGIIKLMKKNKRMVQ"
     gene            87053..88531
                     /locus_tag="MGF_RS00385"
                     /old_locus_tag="MGF_0544"
     CDS             87053..88531
                     /locus_tag="MGF_RS00385"
                     /old_locus_tag="MGF_0544"
                     /EC_number="6.1.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NC34.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_014574388.1"
                     /db_xref="GI:504387286"
                     /translation="MSKKLNDQELVRLDKLNRLIESKQNPYEVTKVANTHNTKSLKEK
                     YDQFSKEQLAEMQMDKPITVSGRVILIRRTFILIQDFYSELQLYINKNKQPDLFKYFN
                     DYLDLGDVVCATGKPMKTNTNELSLDLESLKIISKSLRVPPEKFHGIADEEIRSRKRY
                     LDLVYNKESKERFVYRSKIIAAMRQYFNENGFLEVETPFLHAQIGGAAAKPFITRYNA
                     LDRDYYLRIAPELPLKKLIVGSFEKIYEIGKCFRNEGMDSTHNPEFTSVETYVAYVDY
                     IYMMELTEALIKYIAKTIGISHTNIKNETVDWNKPFKRIKMTELVKQETGIDFTQVKK
                     LDEALDLAKKHKVHVKEHEKTIGHIINLFFEEFCEKKLVEPTFVTHHPVEISPLSKLD
                     YSDPRYTERFELFAFGKELANGFSELNDPIDQRQRFEKQLEEKQKGNDEASEMDEDFL
                     EALENGLPPTGGLGIGVDRLVMMLTGTTSIRDILFFPHVREE"
     gene            88568..89698
                     /locus_tag="MGF_RS00390"
                     /old_locus_tag="MGF_0554"
     CDS             88568..89698
                     /locus_tag="MGF_RS00390"
                     /old_locus_tag="MGF_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014574389.1"
                     /db_xref="GI:504387287"
                     /translation="MRWLVKEQNYYEILGVSTKASSSDIKKAFRKLAKKYHPDVNSDP
                     QSLELFQKINEAYEVLSDEKARRDYDEFELDLYDSDDDVDDWTEFVDTKDVFSKIFTN
                     IKSNQQTTSKANKPPFSSQASDTPPSSSNKTTTKTDPNTPKNLYTILGANKKTSVDEL
                     KRLYSILKLKYSTNPKTEANEWLKKEIKCAYTVLSNRESKAKYDKTGIFNFEGVSHLG
                     GVFSRTRHLQELEKRQKKSKATTQSTGTRKVNNKKSSIHNVPYSSPKDRYASFTKFST
                     PQAQKKSAWQAAKFDINIEDYYTNVNIADDELLSLREEVLEEKKKKEEKHNQDPNVKK
                     QTGLARFKENHPILSSVITGLLISVILTVIIVVIIAKTGITK"
     STS             89201..89298
                     /locus_tag="MGF_RS00390"
                     /old_locus_tag="MGF_0554"
                     /standard_name="RH36804"
                     /db_xref="UniSTS:85629"
     gene            89720..90469
                     /locus_tag="MGF_RS00395"
                     /old_locus_tag="MGF_0563"
     CDS             89720..90469
                     /locus_tag="MGF_RS00395"
                     /old_locus_tag="MGF_0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574390.1"
                     /db_xref="GI:504387288"
                     /translation="MNKQDIIEHVNNDHLDTLNIIYRHYVKNQAVQTIKLIDLDLEKM
                     IVLVNDQKIEIPFERKIKELSEIKYVMIEMHERAQYLLNLDSVQEEYNQFLKSNFRSI
                     HLATRNKDNELTCSTTVLYRKNNQLYVYLAKVAQHYQNISFNNQNLGVLLIEDSAIGR
                     SEYLRKTAQYVADFEQVNDQNLVNELLDNLAKNPVETRVANMLKKFAGFVLFEVKLKK
                     GRVNLGFGKAYDVVDHKLVPINMTEEHKMVD"
     gene            90627..91682
                     /locus_tag="MGF_RS00400"
                     /old_locus_tag="MGF_0568"
     CDS             90627..91682
                     /locus_tag="MGF_RS00400"
                     /old_locus_tag="MGF_0568"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574391.1"
                     /db_xref="GI:504387289"
                     /translation="MNNIFITPQAVGDNTNLAIFINLLIYVAFLLTVPTLLIFCLMFI
                     KPKLKQNQMFNLYAFSSALLLSIGTLGLLFEATDGATGFVNNTLSSYTEVNQTLIKIA
                     IIVGGAILGLTLVISFRFLYIHFTKQDHCNHTHDHSLHIMNEGEDVQHKMKEHKPNVK
                     AAWLVIILLLSHRTIDGFILGGTVSLLTLDPTQINLGFIITFNLHILVEVVIIHYRQI
                     QYGEKRFKAALYNFYTTLLIIPIMIVGAYLNRFLRNVGWIIPLVNASGGVIITFLAVI
                     ELVPEFIHNRSMKTADWYKMLISFAFGLVFAILILSVHNLSHTEHHHGGMMDHGHDHD
                     HGPIAHLISRTKNLLLY"
     gene            complement(91668..92483)
                     /locus_tag="MGF_RS00405"
                     /old_locus_tag="MGF_0574"
     CDS             complement(91668..92483)
                     /locus_tag="MGF_RS00405"
                     /old_locus_tag="MGF_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574392.1"
                     /db_xref="GI:504387290"
                     /translation="MTLTTVLYLRNCANNLQRTLDYLKNEKLIVLLDQSVDLTNEIVE
                     KNNLDPTIVLKQKFNNLANGLNYLFKENLITTNFYYILDVRNELDEQLISVLKQNLGE
                     QKLYFWNLKRYQKLYKPVKFKNLICENLDFVNTVFYKKDITPLSVSPHGELAYFDLLF
                     QHLNQDRAYQYLKFLSSINEPELFDPKLRRYKVELEDQNIAFLNKMIAHNHQEYLWYY
                     FEHNLEFVKRIVKRGITFEINRKSSFFKTNGFNPLSFYKLTKKYKELFKLVKQ"
     gene            92569..94305
                     /locus_tag="MGF_RS00410"
                     /old_locus_tag="MGF_0575"
     CDS             92569..94305
                     /locus_tag="MGF_RS00410"
                     /old_locus_tag="MGF_0575"
                     /EC_number="2.7.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574393.1"
                     /note="Phosphotransferase system, enzyme I; transfers the
                     phosphoryl group from phosphoenolpyruvate (PEP) to the
                     phosphoryl carrier protein; part of the
                     phosphoenolpyruvate-dependent sugar phosphotransferase
                     system (PTS), a major carbohydrate active-transport
                     system; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_014574393.1"
                     /db_xref="GI:504387291"
                     /translation="MKKYEGIGASNGVAIAKAYVLKAPVFNFDNNKIKPTEVEDTITK
                     IKQAFHKSSEQLRELRTIALKNLGEEIAVVFDGHINIVNDPMLFDQISQEVKEHLANA
                     PTAVSKIYDQTKAMFEGIQDAYLRERASDIGDVKKRILSNLLNVALPDLLAINHEVII
                     IADDLTPSETSLLNKQYVKGFATNIGGRTSHSAIMARTLEIPAVLSLKTITETLKHDQ
                     LICIDGNKGVVYSDLSEADITSLKQDQQRYNESQAKLKKYLPPKAVTLDGHETIVAVN
                     IGKPIDLLKGNDYGAKGVGLFRTEFLYMDSANWPDEETQFNAYKQALDYANNETVIIR
                     TLDIGGDKKLNYYQFPEEMNPFLGFRAIRFTNQNPDIFKAQLRALLRAAKFGSLGIMF
                     PMIANLEELFKAKEILEEAKKELDQRKVEYGKPLVGIMIEIPSAAVMSDVLAKYVDFF
                     SIGTNDMIQYSFAVDRMSKDVNYLYQPLNPALLRIVKMTIDGGLKHNVWTGMCGEMAG
                     EPLAIPILLGMGLKEFSMSASSMLKAKELINNLKYSDCKELVNQVINLESQEEVVKKV
                     KEFLAKNNLSVA"
     gene            94386..94931
                     /locus_tag="MGF_RS00415"
                     /old_locus_tag="MGF_0586"
     CDS             94386..94931
                     /locus_tag="MGF_RS00415"
                     /old_locus_tag="MGF_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sigma factor"
                     /protein_id="WP_014574394.1"
                     /db_xref="GI:504387292"
                     /translation="MINLLDINKVIDKYYWYAFKVASKVFYNYYSSLPFESADLHQIS
                     ALAIMDGYNRFDSKKNDNFDGYIKKYVSLYIISTFKKETTNKRKLLNNSSEKDNTTPI
                     CHKTPEYYLKLDEFRTEIKKVLRKFSPNQRKIIMEFLQGSRICDIVKELKTNKHKVSY
                     VITKFKNEIIKNDLIKNSLNY"
     gene            95365..95637
                     /locus_tag="MGF_RS00420"
                     /old_locus_tag="MGF_0592"
     CDS             95365..95637
                     /locus_tag="MGF_RS00420"
                     /old_locus_tag="MGF_0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NC27.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_011113311.1"
                     /db_xref="GI:499425847"
                     /translation="MALSKDKKTEIIKKFQKNDADVGSVFVQVAVLTEEIKLLTEHLL
                     KNKKDFISKRGLYTKVSKRKNLLNYLKQNDLNAYRNLISELELRHS"
     gene            95719..97449
                     /locus_tag="MGF_RS00425"
                     /old_locus_tag="MGF_0594"
     CDS             95719..97449
                     /locus_tag="MGF_RS00425"
                     /old_locus_tag="MGF_0594"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="putative hydrolase"
                     /protein_id="WP_011883745.1"
                     /db_xref="GI:500213571"
                     /translation="MAKINFFTLGGQDEQGKNCSVLEVNDDIYLFNAGSLVPINSLLG
                     VEQLIPDYSYIVNHKKKVKGLFIGYPSQSNLGSLLYLLKSLKPQTLTVYTSLIGKTII
                     ESIMDKQRDFEPYKKHVNIVVLNPLKEFKINDSVSVIPFRVFSSIPYSYGFCLSTQDG
                     MIVYIDDFILVNDKNKTFSSDLMDLRMLINNKKVLLLIVGAGQVGKHISNTSPNHRSK
                     QAIEKFINDCKGRSIIACYDDNVYAMFTAATIARKQQRPFIVYSQASINLFNTIIKKN
                     MFNSRDLQTMPISEMNNVKDAIIVVANTPHNLYNQLAKIATGEDKRLKLDSEDRFILL
                     TPKIAGFESYEAKILDEIARCDVIYKRLNSEVLPIKASNEDHKFLVNLLRPQYAVPIQ
                     GLYKEFVKYLEVVNQTGNFKEHQKPILLYNGEILSFVNGKLTNKHEELHLNSKCIDTA
                     GVQDVKSMILSERFQMGCNGVVVLAMYFSTKKMEFLDAIDIQTYGVSDESVKLNEAIQ
                     KCKTQIKTMQITFITDIKDRIEKNMKKRITMNDYTQFKKTIRKLVGKIFEKSLFKNAA
                     VITSVVELEN"
     gene            97469..99451
                     /locus_tag="MGF_RS00430"
                     /old_locus_tag="MGF_0607"
     CDS             97469..99451
                     /locus_tag="MGF_RS00430"
                     /old_locus_tag="MGF_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein FtsK"
                     /protein_id="WP_011883747.1"
                     /db_xref="GI:500213573"
                     /translation="MNRELRDKKTNPKVMMADRNYIIRLTIVVFLGIVLFLSFLRAPY
                     FGEFLDGLIFDLMFFGTAKYIFYLASFIVLIILAFPHPIVYKIHRSKMFWLFILLVDL
                     FILLIFGLVHYSLYLTNSQITLPTYVNKFFTEWKDSLWIHGKWLWQNNASQNNASQNN
                     APLLISGGLINSLFIAINAFFPALIAVELALIVLTIIILFIGIYYNIKGFVKLKNKFI
                     KVLGGVINKNFTPFYERWKTNNNSALVVSNNVEENKETFVKEKQIDDLYYENQNSQTN
                     QPSFSKLTQHHQEKEKLPEIRQKSVNERKLNESLLEVIVEKLEQLFKKENFEVELIEK
                     KCGPTEVYLAYEFSDRKQIKRIKNLDKQFVDIFESNVVSINQKGNIVYFYTKAFNESK
                     ISLADVMIKPDETTKNQLNCAIGIDQDFNPINFDLKKEKSFLFIGGLGSGKLACTVSS
                     LISLAISKPTTDLQLAIIDLPDSKLSKLDVLGHLVHPPINSIEEANRFFEKIMTEMKY
                     RNKILDENNVETIDEYNNKNPNQKIKNFVICINDLNDLLDYDFSNIFKIISYIYKVAN
                     KINVYLILVANSITKALIDDDLLTYYGKIINLKVDTPEESDLLVNNKELYKLHKNGDF
                     YIVDPKSRNTLVRGLSCFVEDYVLEDLRRHYSIKEY"
     gene            99455..99784
                     /locus_tag="MGF_RS00435"
                     /old_locus_tag="MGF_0619"
     CDS             99455..99784
                     /locus_tag="MGF_RS00435"
                     /old_locus_tag="MGF_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thioredoxin"
                     /protein_id="WP_011113314.1"
                     /db_xref="GI:499425850"
                     /translation="MKSISLKELEQVIQTSKKPIFVKFSWADCGVCKMNAPIIENAAN
                     QRKDQYDWYEIDVDKEQIWAEDQPNHQWAIKIVPVYMIFKNKQKVFEHVNFLAQDKLN
                     TELDKHI"
     gene            99793..102408
                     /locus_tag="MGF_RS00440"
                     /old_locus_tag="MGF_0623"
     CDS             99793..102408
                     /locus_tag="MGF_RS00440"
                     /old_locus_tag="MGF_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574396.1"
                     /db_xref="GI:504387294"
                     /translation="MDLMNGFFSFEHEPVFFEIHYLFYYTWTKEGLKKLEEIGQISFH
                     HYDKIQIEQEKANSWYQLFLILNKTNKPIAGQVYLDNLKYLSNTTAFSKKKAKLLVVN
                     VQQEDYDKFFDNNKNIITTLFNNFYNELLIKDVKDQFVNKWRSKFSFHKKVLAARLFD
                     AFLEKHNKFLELQKSIKLYNDQFYNAKDINLSHFNLLKRNYDELVDSLTYYDEDFKTI
                     NEKNVALINAQKTSEKISHIYFLEDQIKNLKQRIVNLKINKKYGPYSVEQLAEIKRAT
                     NEVKQLVIQNKKQKRDLKMILRSYIKGLKKQCSFNQSRAFIESNYADKIYYLSEWFKA
                     NELVKVIKKIRWITHLDLDNLNQFINQSKKLIIKRTEHIHDFEKTIKLKEKRQLGFLY
                     SDLRYKFKKIAKISLHKSDQEINNLIVDLVEKNKLNYGRYLNELFQKRLYLSRLKLNF
                     KESIKLYRLHLNGYDFYKLFNNKYQAKVYSDDTKKLFNKNVLDKIYQLSINSYQRLYH
                     YYLNLSKTSRNEIQAIIFYINAFSFKLTLAFMDSYKMNPLVSFYSNLMNIHWATRLIW
                     NQTKRFIDEIEIETDSLTNFPKINFDVKNYSKNLKAKFELQYKKYLDNNRKINAKINA
                     RYDEYIVQHSTDVKQKLNTNAYLKFNSESYKKEIESKIVDIKELIILNKARQEQYKLD
                     YLSNNVINDQRFAFDRFNKLKTTIKTLYRNLKLVNKILYKKKLLKTKKAIDIRTISSK
                     LNYYLAIINRWEYLYDLFIDWKPIKYRSKKLRKILTELYLYRSYKDVGINEEINYSYL
                     SFLSSSDAITVYLLSKFAKAPKLLFVENFNLNNKHEYNVFKGLLLKYQNKSQTAIVLN
                     DSDQKLMNDLGIRKF"
     gene            102408..105266
                     /locus_tag="MGF_RS00445"
                     /old_locus_tag="MGF_0633"
     CDS             102408..105266
                     /locus_tag="MGF_RS00445"
                     /old_locus_tag="MGF_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_011883749.1"
                     /db_xref="GI:500213575"
                     /translation="MKKIKKDSANYISIVGARQNNLKNISLDIPKNQLVVITGLSGSG
                     KSSLAFKTIYAEGQRRYLESLSPYARQFLGNNDKPDVDSIEGLSPSISIDQKSTSHNP
                     RSTVGTVTEVYDFLRLLWSRVGDAYCINGHGMIKTTTIKQIIDHVLELEDDSKLQILA
                     PVIKLQKGTFKNEFEKFYKQGFMRVLVDGVVYSLDDKIELDKNQKHDISIVIDRLILN
                     KDNQTKLRITDAIETALTVSNGLIQIIANDQAKYEFSLNHSCDQCGFFIPELEPRLFS
                     FNSPIGACDYCKGLGFTYEPDVDKIIPNKDLTINEGAIDYFKNRINTSSQDWQRFYSI
                     IRHYQIDLNTPIKNLSKKEINYLLEGSDEPIEIVIESANRNGISSRLDYVEGIAKLIQ
                     RRHLETKSSAARDNYSKYTSEQKCKTCDGKKLSPAALSVKIGGLDIIEFTNLNVNKAL
                     DFILGLEFNEEKTKIAKFVLKEILDRLHFLVNVGLEYLTLSRNASTLSGGESQRIRLA
                     TQIGSRLSGVLYVLDEPSIGLHQKDNDKLIKTLLSMRDLGNSLIVVEHDEETMMSADY
                     LIDIGPGAGTYGGKVVAAGTVEEVMKNPASLTGQYLSKKLEIEQPKKLHPGNGQKIVL
                     KGASANNLKNINVEFPLNKLVVVTGVSGSGKSTLINQTLVNGIEKALFNKHVEVGKYK
                     SLIGINNIDKVIKVSQDPIGRTPRSNPATYVSVFDDIREVFANVFEAKARGYTKSRFS
                     FNVSGGRCDDCQGDGVKCIEMHFLPDVYVKCSSCNGKKYNEATLEIKYKNKSIYDVLE
                     MSCQEALEFFKVIPAINRKLQLMCDVGLGYMKLSTNATELSGGEAQRIKLAKYLQRKA
                     TGNTIYVLDEPTTGLHAHDIKKLLSVLNRLVDNGDSVIVIEHNLELIKVADHIIDLGP
                     NGGDDGGYLICAGTPQELVKNYTDSSYTARYLAKIMKS"
     gene            105314..106192
                     /locus_tag="MGF_RS00450"
                     /old_locus_tag="MGF_0646"
     CDS             105314..106192
                     /locus_tag="MGF_RS00450"
                     /old_locus_tag="MGF_0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor Ts"
                     /protein_id="WP_011883750.1"
                     /db_xref="GI:500213576"
                     /translation="MASITELIKQLRASTQAGFMDCKKALEATNNDIDQAIKWLRENG
                     IAKAAKKVDNVASEGVIKLKLADQKATILEINSQTDFVTKNDQFVAFSNELVDLVHKH
                     EITDVAKIEQLKLASGSTVAETQIHLTAIIGEKISLRRVGFVKEEANSSLATYLHSNS
                     RIGVIVKTSKTDDKEFLKHLAMHIAASNPKFVSQNDVSADFIAKEREIAAAQAQSENK
                     PKEFIDRIVDGRINKVLEEVCLVNQKFLVNQEQTVQQAAQAKKVEILNFIRYEVGEGI
                     EKQVTNFADEVKAQMK"
     gene            106216..106926
                     /locus_tag="MGF_RS00455"
                     /old_locus_tag="MGF_0651"
     CDS             106216..106926
                     /locus_tag="MGF_RS00455"
                     /old_locus_tag="MGF_0651"
                     /EC_number="2.7.4.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="uridylate kinase"
                     /protein_id="WP_011113318.1"
                     /db_xref="GI:499425854"
                     /translation="MQKPNIIIKISGASLQDKNSNDCYSYQRINSLADQLKSLAKKYN
                     IGLIVGGGNIFRGKLAKDFGVEINKADYIGMLATVINSTLLESKLQSLGLKTKVLSAL
                     EVKGLTNEINPKSLAEVFSDCQIAFFSGGTGNSHFTTDTATVLRAIQINAQLVLIGKD
                     GVDGVYTDDPKKNKKAKFIEQITYQQALNDQLRVMDLTAFSLAKDHNLKLLIFNIEAE
                     QSIIKTIENKNKHTKITN"
     gene            106939..107490
                     /locus_tag="MGF_RS00460"
                     /old_locus_tag="MGF_0657"
     CDS             106939..107490
                     /locus_tag="MGF_RS00460"
                     /old_locus_tag="MGF_0657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribosome recycling factor"
                     /protein_id="WP_011883751.1"
                     /db_xref="GI:500213577"
                     /translation="MEFKTYSDFFDKNANSIINWFEGELAKVRSGRANLKILDNVRAE
                     YYGEQTPLIEMASLSIPEPREILIKPYEKSSVNPIQAALLKANLNLTPVVDGDKIRIK
                     LPLLTEENRKENVKKVKAVGEKAKQEVRFIRRDTLNKIKSDKIADKDLNKYFEEQVDK
                     ITKKYIDLIDSILAKKEKDLLSL"
     gene            107490..108608
                     /locus_tag="MGF_RS00465"
                     /old_locus_tag="MGF_0658"
     CDS             107490..108608
                     /locus_tag="MGF_RS00465"
                     /old_locus_tag="MGF_0658"
                     /EC_number="2.7.7.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_011113320.1"
                     /db_xref="GI:499425856"
                     /translation="MRIGTQLKDKQPTKNGRLVSTIVIVGVYLLLFIFNSLSDFFNNW
                     SPLRPIVNQDQLVDTLVNASVRTLFSAIVLLIISTVFFLGLKEIANLFFQQNKWTFVL
                     LNSAYFLVSNLVNIVLIQFSIVKPELTLIVYHDKFSNNMIFLIIVGIILLLNLIINPI
                     FLKLNQRLNKINLLHLFSLSIIFSLGFYGINYVLLNKGWTTFLYLIGIIVMIDSFAYI
                     YGKRFGKIKMVPEISPNKTWAGAIYGIITTIFLMVVVSILYAIPIIIGMVTKSNQPLE
                     VIDPHNLLVNIYYITFYQETNNFIIFWWVFCGFAILVLATIAILGDLYFSYVKRQYQI
                     KDYSNVLRGHGGILDRFDGFCFVFIAFIVYQIIISSVR"
     gene            108613..109719
                     /locus_tag="MGF_RS00470"
                     /old_locus_tag="MGF_0665"
     CDS             108613..109719
                     /locus_tag="MGF_RS00470"
                     /old_locus_tag="MGF_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NC17.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="WP_011883753.1"
                     /db_xref="GI:500213579"
                     /translation="MKILVLGATGSIGKQTIDVICQLKYQLVGFSYYQNHSEANNILK
                     QLNPNYVLCHSDPKYNKNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDL
                     LLANKESLVIAGSQLEAIRKDTKTTVYPIDSEHSALYDLLKDKKKNQIKQLIITASGA
                     GYFNKDKSELKKLTYNDLLNHPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIP
                     VVERSSTIHAGVIYQDNSIHFHATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQF
                     EKIDFEQYPIFKIAYDILKNPYTTRGAVLTCINEHVVKLFQKQKINFLQITELISNFY
                     WNYQHKKIDDIWQINDLIFKIKAAISSKYAYLDK"
     gene            109722..110537
                     /locus_tag="MGF_RS00475"
                     /old_locus_tag="MGF_0670"
     CDS             109722..110537
                     /locus_tag="MGF_RS00475"
                     /old_locus_tag="MGF_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="protease"
                     /protein_id="WP_014574398.1"
                     /db_xref="GI:504387296"
                     /translation="MNLSYYTNLTLLILILVFSIITTLTVHEFGHYIFARIYKVHVKE
                     FSIGIGPTLFSFYLHKKKIIVSFRAILAGAFVMLESTKLRQIYIDDPNAKTYNFYLMP
                     KPKNTHALEEVGYWKQILIMIGGIFTNFLCFGIFLGIYAAIYSNAVLDLSKFFRDIFI
                     NLGKGFVLYEAWKPKDMGEIIPGGGAGMRFGSRSASVQQLLITLISINGATAIFNFIP
                     VAPLDGSKIVQYTYEKITRKQINEKLWTWTTIIGVVLVLWVSLGSVINTIIIG"
     gene            110560..115044
                     /locus_tag="MGF_RS00480"
                     /old_locus_tag="MGF_0676"
     CDS             110560..115044
                     /locus_tag="MGF_RS00480"
                     /old_locus_tag="MGF_0676"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_014574399.1"
                     /db_xref="GI:504387297"
                     /translation="MNKKELKSFFENLNNKLAIPNPLLTFLKKSTVRTIKKIGDNKKT
                     LDLSFILNQPLTVDLYQTYLDYVANFNNKSKDPYFQFNFILDSSLWTSELIQSAIQEI
                     YKSDKNQSFYAEAIELVNEKFYQIVFSNKELQHQSDQQLEWLVTQLENLGFYQINLAT
                     KLDLNLVAINRNKADEEPKKPKARRVVKEDGFSLEECLEKNKILDTSVITPIKDFDPN
                     QPTSLTTLWAKIYHLDYRKNGTNKALRLGLADKNSAVTIFSWITRSKHLTSEHLENFK
                     VGNWIKIQLRVTSSKDDKKYTEILRIDHAELPEWLKPTPEEFTNRHEFFFHTKMSVHD
                     GLNDVDDLKKFCEENKLKDIAITDSGVVQAFADLASWKEKTNSETKVHYGLEVDLFDD
                     RNFIVKNNKDLKLDKLSFVIFDIETTGLNAYYEQIIEIAAVRVKAELNETNHQLEFVQ
                     LGKFEKLIKNEKPLSKFTTQLTGLKDSDLKDAQDEKTVLEEFANFIQKDDVLVAHNGI
                     DFDFIWINTKLDKYKLKPLDNPMLDSLRLAYQLYQFKRYTLENLSLKLGYEYDKTLAH
                     RANYDTELLAKCLMIMLSQIYAKNWRSLLDLNDQEKLLNYLSEKSLKKAANLKINDED
                     NLDQITQSNENLFNRIRLRKAIVYAKNAQGLKALYKLVSLASTKQFYGSPKLFWSDLE
                     KYQNDLLISSHPINGHIVHAAKYDTNENLRKLIKKHSFVLVPLPSLFKQDLYKKNIEL
                     THVHDLINRIISICEQEKILYTFSSAAHYLKQEQKRFYDCLITAEITGKKLHHFYDRD
                     LSTNQNVPDLHIRKNNEVYHDFSFIQDQEILEKLIYRNGEKIANLFNDEGLLPFPKKL
                     HPPKIEGSDDKLIELVWNKAKELFGDEIDPIIKSRIEYELNAIIKNGYGIIYWLAHLL
                     VKKSNDDGYLVGSRGSVGSSIVALLAGISEVNPLQPYYYCKKCKKTKFVDNVDDGHDL
                     VNKPCEFLDCDGEMRGEGHNIPFASFMGFKGEKTPDIDLNFSSFYQAKAHDYVRELFG
                     ESHTTRCGTISTMQDKTAYKIAKDYLEITIGEEESERLAGWYASEMSEIKRTTGQHPG
                     GILVFPKDKEIEDFCPVNYPADDKSSKWKTSHFKFEYLHDTLLKLDILSQEDPTILKY
                     LYEITNVKPEEIPNNDPKVLSLFNLDHCLENVNNNPILKDSTGALGIPEFGTKITREI
                     LKIAKPASVADLIRVSGLSHGTDVWTNNAADLIVDKHYKLNEVIACRDDIMTYLSSLG
                     IENQIAFNIMEDVRKGKKLKPEYEKIMQEFNVSQDYIDSCNKIKYMFPKAHATAYVLM
                     AWKIAWFKVHYPEAFYAAIFSFKVKEHDIETCINGGIRAITKRYNEIKSLINKTKFAK
                     NKSELTLNKKDEDLMPTYELYLEMLERNIKLEQVSLEHSDALHFVVKNNKIYPPFNTI
                     NGLGDEIAKLIVKKRNEEGFKSQADLKTKCKLNKNIWNYFITYQVFGDLKEDEKIRLY
                     "
     gene            115066..118446
                     /locus_tag="MGF_RS00485"
                     /old_locus_tag="MGF_0698"
     CDS             115066..118446
                     /locus_tag="MGF_RS00485"
                     /old_locus_tag="MGF_0698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="heavy metal transporter CzcA"
                     /protein_id="WP_014574400.1"
                     /db_xref="GI:504387298"
                     /translation="MANDWTWLRTRLINNKTKSNTFWIRTRGSSVMDIGVLLKLTSNI
                     YDLSIKGILSYLNSNDTLELDLRKLRELSDLEAFNLFGIETAKELYKEYTDQFSKIFK
                     KLVKEERVTGDTSLFIGLPIIEGCNQWGDSYRAPLLYVEVVLYPVNQYQKIVFKINRS
                     EFWINTTILAVEASKRGILFENKYDSSKLDFEQALEIFRTFDIGFKKPSTNELINFKE
                     MTKKTFLENWEQNGGINNIVNNVVLGNFDIKGDKLLKDFTEILDKEPDTVDEVFNNKK
                     DLLFNYEKFANEYSLSDIYLTSHLDFFQQLAVKHALEGDVVIEGPPGTGKSETILNIL
                     INIALKGKTALFVSEKTTATEVVYNRLGKFKHLALYIPSLNKEPGKFYRQFSDYENYF
                     SENYYDQVHKTPNAKFDPDYLKRYLEQSYIIHKIYNYEINSGDNVYSFLNLILNYKPM
                     DVDHINIDDYTRFDEWLKIYTNQDWMTKHQEYIALFNEIDTKWKASTFATFLKIHQKD
                     PNDIKTLLYAIHLYAKKGIVKDEYRVPFFFRPHEKVIESAKLVTEQINKFIELEQYKS
                     ETKKRTILKNLEVDIKRYHKQYFNSWFVQNHSGAFLSKLNSAQSALDNLTDNYSSDVD
                     VYIQSCKRNLKAEIIKNFYELYRHDKRGLLDVCRQGRNKSFKNIAWWFNLNREIIKKM
                     FKIHIMSFETASILLENKKDLYDYVIVDEASQVFLERAIPALYRAKKYIIAGDTKQLQ
                     PSSFFSSRSDYDDVALDKLADEEILEVEESVNAVSLIHYLKERSRINVVLRYHYRSNF
                     GDLIAFTNDHVYDNELIFMNKAIKQKESFVVHDIIDGKWKDRKNIPEAQAIVSRIQRL
                     TKTADYQKSLGIVAFNRSQADLIELMLDKLNDPLVNEWRERNNDNGEYIGLFVKSVEN
                     VQGDERDIIIFSVAYDKSVVSYGPISSITNGVNRLNVAITRAKDRIELFKTNKASEYN
                     GWGSSSAGTRLFVEYLSYCENVANHSDYTTYDRQTTEIEEKLKDKSLIFDDVKSTLEK
                     AFGQYFTIKRNVDNGSYNFDFVIYHEEVPFLVIDLDIKPFKGMADFNESFIYRNIFLK
                     NRGWKHFIIWSTEWKLNKRKVLLAIKDILDKRIQMNQK"
     gene            complement(119205..120692)
                     /locus_tag="MGF_RS00490"
                     /old_locus_tag="MGF_0721"
     CDS             complement(119205..120692)
                     /locus_tag="MGF_RS00490"
                     /old_locus_tag="MGF_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574401.1"
                     /db_xref="GI:504387299"
                     /translation="MKKYFKIINVTRRQLALFLVYLATIFLASAGIISLMTNAIVSPG
                     GNNFVIYSENLYTISLILPLVFFVIFAITGLAILLTGKESYKFDNKLIQQTYKFKTLL
                     AFIEFVQLIAWLFFLIILIAYFYPINKTIAQIYQEQIATADFTNRSIQTGLLSFISIN
                     NNFFADLKLSVLKYAATLPYFFNKDVFSLSNIIYFALYITLFIPFLKLSLFKPKQRAL
                     ALIPFSGLVLSYLRSTRFNHEELITENNENLKWYQKILLSNKTVFQIKLTSTVVYLSF
                     FFLVGVLTFTAFASYFILTDGYGYTLIPSDTYVAAYSIDFLNYSISEKEILLSLFWWA
                     AAIIMLIVFIVFSMGIILDDNPFVFPKAIRKNKYTLSLTLVVIEIAQWAFLLLVWIFF
                     LSNASWRIISSVEVVPAVYPTPEPVKPDLTNLIYSSSDLFTTTNLFFVALYLSWFLIY
                     AKAGTFSKRTRIFMYIPFATLFFVSKHVIEKRKRKQVNKFNCRLI"
     gene            complement(121271..122722)
                     /locus_tag="MGF_RS00495"
                     /old_locus_tag="MGF_0734"
     CDS             complement(121271..122722)
                     /locus_tag="MGF_RS00495"
                     /old_locus_tag="MGF_0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574403.1"
                     /db_xref="GI:504387301"
                     /translation="MNQNFRTIHVTERQLTLFIVYLLIALSASIGMLVLMSQAVSNDL
                     LSYFFYDQSKFNISLFLPLIFFILLVGITLPILLTGKEKYQFSARVINSPKKIYTAIT
                     FIEMAQLILWVFFLLILITYFFPINQTVDQIYQTKTTTVDFANDQIYSGLLAFIKIDN
                     NFFVDLKRSIIDYAAILPYFYNKNAFIFYNVVYLVFYLGLFLSYIKLALFKSKQRVLA
                     LIPFVGLVISLKSSNNLNEQALDNDSQVNLKWYQKILESNKSVFEIKLTKQLFKLLIF
                     YIFWIVVFTISAALITFLNQGEYKLNWSLENNKRYVIDLRSEVSIDQETLATIQGTIL
                     FLIPIPVFIGSIIFLVLNKNPYVFSAKLTKNKLKLSLVLIIMEIIQLLFIVAYPHLIA
                     AIPNLATFAVIRPTVFLQQPVNPLLSAQDMFTIGIGFLVVLYSIWFLIFIKSGVFAQR
                     AGVLSIVPFASLFFVNKYMVANNTNSNNNNDLP"
     gene            complement(122765..123022)
                     /locus_tag="MGF_RS00500"
                     /old_locus_tag="MGF_0737"
     CDS             complement(122765..123022)
                     /locus_tag="MGF_RS00500"
                     /old_locus_tag="MGF_0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Subtilisin-like serine protease domain protein"
                     /protein_id="WP_011883762.1"
                     /db_xref="GI:500213588"
                     /translation="MKIKKITSIVSLAMITPAVPLFAAFNNDKTGKPSDSKRTYNRNY
                     GLVNNSLEINKQDINPSEDLSGGSYDELYDFENNDYYQGLI"
     gene            complement(123327..123863)
                     /locus_tag="MGF_RS00505"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            124923..126755
                     /locus_tag="MGF_RS00510"
                     /note="ABC transporter; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            126755..127459
                     /locus_tag="MGF_RS00515"
                     /old_locus_tag="MGF_0758"
     CDS             126755..127459
                     /locus_tag="MGF_RS00515"
                     /old_locus_tag="MGF_0758"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_014574406.1"
                     /db_xref="GI:504387304"
                     /translation="MYILEVKRLNKIYQDKKSSRGVFDLNFSVEKGAFHAFIGENGAG
                     KTTTIKSIIGSYRQYEGEILINGISSREAASKSKLGYVPENTIFPKELTTWEYLFSLA
                     KLSGLSSTQAKTKINELLKKFDIVDLVNLKPYSFSSGQKKKVLLMQALINDPELIILD
                     EPAANLDPTARYQLFKLLSQLHNEGKTIFISSHNLSEIDKYVDSYTLIHKGKIVSSGK
                     KGKSLESIFYEEVINK"
     gene            127437..128450
                     /locus_tag="MGF_RS00520"
                     /old_locus_tag="MGF_0764"
     CDS             127437..128450
                     /locus_tag="MGF_RS00520"
                     /old_locus_tag="MGF_0764"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574407.1"
                     /db_xref="GI:504387305"
                     /translation="MKKSSINKIFVFIASFSIFPSILLSSCVNERKPKDQSEVTIKLK
                     QKQPLTTNEMFVENYLNQIQPDKKLADLYKRTQLTISNAFYDELKAALITASPSNINV
                     LSKSASENSLQVTNSINTIKNTLTKNWFWYLWNINQNTYVLNYFNDDYTDIKGNEETP
                     DNPKNTKSLFDYVQDKYKSYFYNLKNLTFEGIKTFELTNQKHDVYTAKTANYLKLGTD
                     AFIVFFRYTQDNKKEILFSPDVFVKNVENLDLNTLIDAFNTNYILAYENIIKQMINYY
                     TALGEENPEDLAYKEHADNVFFSLYTRNNYASVFNRALDLVNNDQLKLLRYRWGDINE
                     IKN"
     gene            128434..129447
                     /locus_tag="MGF_RS00525"
                     /old_locus_tag="MGF_0766"
     CDS             128434..129447
                     /locus_tag="MGF_RS00525"
                     /old_locus_tag="MGF_0766"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574408.1"
                     /db_xref="GI:504387306"
                     /translation="MKLKTKLTKLSLIIPFAFSATSCADYDQRSKLSSHIDHSKDISL
                     RTTSKEELVHKNIIDSLLNLIYKNTPEAQNAKEVYIHQQETNADNIKAQFKQIEEDFN
                     KQFKILEITNWEEELKQKREELIFSRFNPEKAAEIRTRIQELQDLIASARNDDNPIDF
                     FAQYQDFVSKNWFFILNNLNIFDWNFITWALNPYYPESKKILVSEEYQNKVKRLTQFN
                     SLKFSNTYLDDIKLGDESREIGDNDVYYLKKDKLVLRFLIRTVSAPISGVVLSYLPIY
                     FGASRAKNISLNLISSVIHSGFIHRYETGLQQYEVDMPIKQRYGYPAFVFNFLKKDKT
                     NEN"
     gene            129437..130318
                     /locus_tag="MGF_RS00530"
                     /old_locus_tag="MGF_0769"
     CDS             129437..130318
                     /locus_tag="MGF_RS00530"
                     /old_locus_tag="MGF_0769"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574409.1"
                     /db_xref="GI:504387307"
                     /translation="MKIKKAFLKFIISSAFVSLALVTIPSYGIKSQVVSQNLDQINLT
                     SDLDLKWRNFLNQTAITNVLHEMFGDNNKAKDEYIKSQFDLINSPYAIKLKSALKYAN
                     LITRPSTAKFDFFSGISYPYPIEQAIKVIDEAQSQNWLWYLYNLTTLVFMQKSDFTRQ
                     NNESAASFAIRDNENKLLYSNFVTLKSNIFIQEVKQVDSDNNVTFYLLNKDGYILQIE
                     IRKDPGEPTSAIIFGYIRTYPKLLEANQINEIFNLNKYVNLYASFGLSSNNETAEVLY
                     KDFYGGVLLQYTAVDID"
     gene            130319..131245
                     /locus_tag="MGF_RS00535"
                     /old_locus_tag="MGF_0774"
     CDS             130319..131245
                     /locus_tag="MGF_RS00535"
                     /old_locus_tag="MGF_0774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574410.1"
                     /db_xref="GI:504387308"
                     /translation="MKKIFKLLNLGLLTALLPIVIASCTNDNSSEKIRMKSDDKVSYS
                     PLPRLFFPKAKYVDDLEAALAKYDLSFSDEQEQNFEKFDLAKFNKLDSQLTKNANEIY
                     RLQKQIAETSISAEVKAEKHQQILVLFDKNSALLSDNIMAFFKYIYNFRMKFYDYALL
                     TDSFKNNSENHSARYLHFALNVNNQFANDNLAAHIHFRYNRSITRVNIVGADLKTSML
                     VDSELREGYRVMYVSLSNVIFKLYVSNDNKILLDSRAIFFSGAIGNIDPQETLDAMEK
                     NPEKLTQFDIENFENKFTALPYVKYPQINSIF"
     gene            complement(131359..131637)
                     /locus_tag="MGF_RS00540"
     CDS             complement(131359..131637)
                     /locus_tag="MGF_RS00540"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883782.1"
                     /db_xref="GI:500213608"
                     /translation="MLTTDKVNDYLEFSRKMKVFVLYGNTSNQPVIVDIYEDGKLIKQ
                     NYKISSTYAMNGVKLFENRFASYDQHTIKIVNKSLTPLSIDCFGYEAN"
     gene            complement(131715..132108)
                     /locus_tag="MGF_RS00545"
                     /old_locus_tag="MGF_0783"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(132159..132718)
                     /locus_tag="MGF_RS00550"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            133753..135693
                     /locus_tag="MGF_RS00555"
                     /old_locus_tag="MGF_0795"
     CDS             133753..135693
                     /locus_tag="MGF_RS00555"
                     /old_locus_tag="MGF_0795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="serine protease"
                     /protein_id="WP_041594397.1"
                     /db_xref="GI:753838780"
                     /translation="MKLNKIISVISLGVTGAAFPLSVVFNSYKKTNTKSFINKTTNGV
                     INKDKTNTKVLNNETENPVYQSSDSFYDFEKNDYFKGFITFKGNFDIFNHDNILKLIR
                     QRPQVLYAKKSLAIKNYYLVTLSFKKNSDDKKQFDSFLNTYDLVGDFYEIENDEKIES
                     NPSIAIINGVEDSYVNGGGLSQNLNRYRNNFESNYYTDLDRNVIIQHVDHQVNYYGQK
                     RIGIAVLEVGQGDKHPERALIDANNSYYFDKKITNVYNRWDPYWNGLFHKPTYGNHST
                     EVASVISGINGVNPYHNLYGVKVNLFNSSLLYAFSGLDNEIDYIRRIDNLKIVNNSWG
                     IGKPKNANSNLFKYNYYSRFLDLLTANERDLIFVIAAGNEGNTNLPKLFGFDLSYNSI
                     LIGSNNDDKSLSWFSSRGSNTYSSPLILANGSSYPFKNSRKSGTSYSAPFVSGVLANT
                     LIQYKEKYKLGINSIIAKAALGVSSTNEKNDKTVEKNRLDPSQGVGILNYQKLWSAFN
                     NLKYIRWTDSSDVLVNNLWKSKNVDKSLAIERLQLKKGDNLRISLSWLFKPSSSTVYR
                     WEQNNKDLTSSINYDEQNFNLIFRKTDGSIFKRTESLNNFEFLQVPITEDGSYEIIVS
                     KPNQKPSKTETELALSWTKERI"
     gene            135709..137187
                     /locus_tag="MGF_RS00560"
                     /old_locus_tag="MGF_0805"
     CDS             135709..137187
                     /locus_tag="MGF_RS00560"
                     /old_locus_tag="MGF_0805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574413.1"
                     /db_xref="GI:504387311"
                     /translation="MENYLKIINITRRQLALFLVFLGTVIFASAGIISFMTYALSDQG
                     FYFVIYDQMKFNISLILPLIFFVIFAVAGLTILLTGKESYQFSNKLIKNPNWLKIVIL
                     FVEIIQLIIWALFIIILMTYFYPINKSIDEIYQAQTSTVDFNNNTIYSGLLSFVQINN
                     NFFADLKISILNYASILPYFYNKDSFTFWNIVYLTLYLSFFLAYVKLSLFKQKQRILS
                     LIPFVGLISYLKTPNKLEQNVFLEPDTTGLKWYQKILASNQTVFKIKLTKTTLSLSLF
                     YLASVLGFVIYAIAITFMYGIGFKLKPSVDVNNAYVYDFNRWNREFNESELRVVSDYR
                     KALPLFFIITFFVMSLGIIFDKNPYTFGVKVRKNQARLSLTLLAIDITQALFITLLIL
                     FLSANAYDKINPTVENKALPVDSDFNDPWSLYTGQDLFITSSLVFVLIYLSWFLAYAK
                     GGVFSRRTRILMYVPFASLFFVNYHVVNKEISNSKSYRCQTI"
     gene            137483..138967
                     /locus_tag="MGF_RS00565"
                     /old_locus_tag="MGF_0810"
     CDS             137483..138967
                     /locus_tag="MGF_RS00565"
                     /old_locus_tag="MGF_0810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_041594398.1"
                     /db_xref="GI:753838781"
                     /translation="MKFTKIINITRRQLALFLVFLGTVLFASAGIISLMTYALSDQGF
                     YFVIYDQMKFNISLILPLIFFVIFAVAGLTILLTGKESYQFSNKLIKNPNWLKIVILF
                     VEIIQLIIWALFIMILMTYFYPVNKSIDEIYQAQTSTVDFNNNTIYSGLLSFIQINNN
                     FFAHLKISILNYASILPYFYNKDSFTFWNIVYLTVYLSFFLAYVKLSLFKQKQRILSL
                     IPFVGLISYLKTPNKLEQNVFLEPDTTGLKWYQKILASNQTVFKIKLTKTTLSLSLFY
                     LASVLGFVIYAIAIIFMYGIGFKLKPSVDVNNAYVYDFNRWNREFNESELRLMTDFST
                     ALMTFFIITFVVMSLGIILDKNPYTFDAVVRKNQVRLSLTLLAIDITQSLFYTLIFYF
                     YVANAYDSLYPLVVPLDLALSGDTDHNNAGWLYGSQDLFITSSLVFVLTYLSWFLAYA
                     KGGVFSRRTRILMYVPFASLFFIKYHVGNPKIRNSNINRCRLLY"
     gene            139271..141139
                     /locus_tag="MGF_RS00570"
                     /old_locus_tag="MGF_0818"
     CDS             139271..141139
                     /locus_tag="MGF_RS00570"
                     /old_locus_tag="MGF_0818"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transcription termination factor NusA"
                     /protein_id="WP_014574415.1"
                     /db_xref="GI:504387313"
                     /translation="MSVDNKSFLEAIQTVAETKNISKKEISTILKDAIIRACAKEDPD
                     QRIDVMIDFDMGLLKIFKLYKVIDDSVGEEEFDEINEIHLRDALATNPTIKVGDDFLK
                     SLSIGDFSRVVATNISQYFRQKLSELVNKQAVSEWTPKLNKIVRGTVEKDENNPNVLL
                     VNLGGIYAYYYKRDWVPNEELQNDVEYDFVLTQIKEQSKSWPLVVSRSDALYVKHVLT
                     ENIPEIKEGIVEIKAIQRVAGQKTKVAVLSNNPDIDPVTLILGDGGIRIKSIAANLIE
                     HSSGVKVSNEVIDVFHWNDDVFKLIANACYPVDIIGVDVLEDSERDKSVDIIVEDQYL
                     PFLIGRAGINVRLLSYMTGWSIDFKSQSAAIEDNINVVPLNYSPVDNAVLVDQFKRNS
                     RRTKIASKQPFKKVETVQTPLIAYSTAVEGDDDIKVDFQKIYEEAKEPRYEMIDLTKY
                     QPKPVVQDDLEEYQPELGDGIEDELVVEQESEVVQEQPEVVEQEQEPSVNVTARYDDV
                     SEQIAHLDLSKPLIVEEEEQRDLVQKTVKTPKKEKKVQKEKEETVEFVNIDESAYDNV
                     QNENTSITELIRELDITQTPKKEVKKVVLIQDKKDKDKDKKKKKSQRQSLDSFENL"
     gene            141154..141423
                     /locus_tag="MGF_RS00575"
                     /old_locus_tag="MGF_0832"
     CDS             141154..141423
                     /locus_tag="MGF_RS00575"
                     /old_locus_tag="MGF_0832"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574416.1"
                     /db_xref="GI:504387314"
                     /translation="MKKITQRFDLITKKQLPIDQVYRIVFYQNQLTVDYHYKIKARGV
                     YLNKNEHFIIDKKVKALIQKSFKTKILDEEFNRLSDALRKRGQDE"
     gene            141416..143263
                     /locus_tag="MGF_RS00580"
                     /old_locus_tag="MGF_0834"
     CDS             141416..143263
                     /locus_tag="MGF_RS00580"
                     /old_locus_tag="MGF_0834"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_014574417.1"
                     /db_xref="GI:504387315"
                     /translation="MNKKPTRNKKPVDQRSKINIKSYLKEVQVGVKDGVFIYTDPLSI
                     DQFAKKVNQPVAKIIKHFFSKGINTINLNTILSLEQIGELCLDLGLDFKIEKSVTSEN
                     LLDNIEFKDKKEDLVKRPPIVTVMGHVDHGKTSLLDAIRSTNVTSNEAGGITQHIGAY
                     QVKKNDELITFIDTPGHEAFTEMRARGANLTDIVVLVVAGDDGIKPQTEEAIDHAKNA
                     NVPIIVFVNKMDKSGANFDRVIQQISKYDLSPEEYGGDTIFVQGSAIKKEGINELLDA
                     ILTLAEINEYKANPNADPYGIVVESKLEPGLGPQATVIIKRGTLKVGDYICIGAAYGK
                     VRIMQDENGNNLTEATPSRPVKISGLDAIPQAGEKFLGLATEKEAKELSDSYKLKQQK
                     QKHLSLQESHEKRTRINTNGIKCVDLIIKSDVQGSLEAIKYAISNINIEGVTTNIIRA
                     STGVISETDIKLAQASNSTVISFNLGVSKQIRDLANSDNVQILSYEIIYKMVEDLEKI
                     MKGELDPVYEESVIGQAVVRVLWKHSKIGTIAGSYVTSGKVVKNALCRVLRDDVIIYK
                     SKIASLKSKTTFVDKVEHNKECGIVVENYNDIKEDDIIEVYEIVKKRVY"
     gene            143263..143622
                     /locus_tag="MGF_RS00585"
                     /old_locus_tag="MGF_0846"
     CDS             143263..143622
                     /locus_tag="MGF_RS00585"
                     /old_locus_tag="MGF_0846"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBZ3.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribosome-binding factor A"
                     /protein_id="WP_014574418.1"
                     /db_xref="GI:504387316"
                     /translation="MSKIKTLRLEATIHKLLSQAISTEINNSLIKTSVITAIKLSDDK
                     SVAKIYIDCLIPNNIAKTLQAYKDATGVFRHVLSKHLTIRSIPQLVFYYDDSISKGAK
                     IDQILAEIKQEKKENHE"
     gene            complement(143943..144497)
                     /locus_tag="MGF_RS00590"
     CDS             complement(143943..144497)
                     /locus_tag="MGF_RS00590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_041594399.1"
                     /db_xref="GI:753838782"
                     /translation="MSETCIIVSDGLKGLKEVIENVYPKAMHITCTVHMIRNAAKYVS
                     HSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGGSNKRAVEVVRRAMDNIEKLFSF
                     SKASRTLVYTSNIVENYNSVIGSYLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQKS
                     NGLRNWYRIYEELMDVFPNLVKKN"
     gene            complement(144461..144736)
                     /locus_tag="MGF_RS00595"
     CDS             complement(144461..144736)
                     /locus_tag="MGF_RS00595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_041594400.1"
                     /db_xref="GI:753838783"
                     /translation="MRDWHEKPLENNYPIIMIDGKVFKIKTEESGWSKYVNKTLYVVV
                     GINADGQKELIALYVSNIESATEWMNILDNLKKNAACLKHVLLFQMV"
     gene            complement(144781..145182)
                     /locus_tag="MGF_RS00600"
     CDS             complement(144781..145182)
                     /locus_tag="MGF_RS00600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014885855.1"
                     /db_xref="GI:504698753"
                     /translation="MKQIQKLIVEFVKQFDPSSGKQLLNITDYIAKPVLQALVDGEHV
                     GKLELLRENADNDENVYQNGSYTRNVKWGQEEIPKKMKRIRGENQNSQIIPKYQRIIH
                     DKFILDVLSLASTRLSNNEIADQITSMYGSK"
     gene            complement(145498..147366)
                     /locus_tag="MGF_RS00605"
                     /old_locus_tag="MGF_0872"
     CDS             complement(145498..147366)
                     /locus_tag="MGF_RS00605"
                     /old_locus_tag="MGF_0872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574419.1"
                     /db_xref="GI:504387317"
                     /translation="MRKRTKFYMYSIATLSSLGIFLSSCTRASQPVQKGEFDDKVVIQ
                     TAQNQFYPLMSAFSQLVDLYNKQFANTPGFLPVELQQSEKTNATSELQLTNNVVGSIR
                     SNSPLVPNIILADLNAAYQINGFNRLLDLSNNPIINESYFDSDIYNNFNKISGSTQSS
                     DKVYAIPFNLTTTDSLVFNKPVMNLLFSLVEQGGGTVDKNSATYKELHMEDFMEKIPN
                     KKWKNLQVKSNEIYKGLTVDDKTFSNLESMFEFSKKFTEGLELKQTPTITGQQRDLKV
                     FMLNYGPTIYQKYLWSKLGNSRDSWLWNLKLQDNQFDLDFSNLKKTANQNTIGEAYDF
                     FKNNYTTLNLNDEQVLKSIYFGTGGKSDWAAWDIRNFDTAFGIASHVGWNQSVVSPFT
                     IRTFRSTEGDVTQQDINNAKNNFASADDVLWKTQLTKLDKNNLNKNTFWIGGSSLIGI
                     STSRQRDEQTKKFLEWLFNNDTRIAVPDSPFNNQSVSQILNSVSAYDLTSKQALSTTA
                     QQALTDTIAKEQAEVDKVKNNPTPETYNNSDWSRIYLNKGALASLTDWLTFKSELNKD
                     PANNSIAFIHTDEKANRILSILNGAVSGITRSADPTNLTKENLLRQINDALGSTDQ"
     gene            148416..148847
                     /locus_tag="MGF_RS00610"
                     /old_locus_tag="MGF_0877"
     CDS             148416..148847
                     /locus_tag="MGF_RS00610"
                     /old_locus_tag="MGF_0877"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113347.1"
                     /db_xref="GI:499425883"
                     /translation="MQKRNIFKSYKLDLNNDKLMRKKWYMISGITTVLIIFFAVILGI
                     MQRFVNLSGIQYPAVNNARSLNQAMRIMAIVYFAIFFLPYLYFIAAFFSGINQIYRSF
                     TLHMIIWLTIFVGILLMLTTCALLIAGYSNLDSYNLIRNFQ"
     gene            148856..149500
                     /locus_tag="MGF_RS00615"
                     /old_locus_tag="MGF_0879"
     CDS             148856..149500
                     /locus_tag="MGF_RS00615"
                     /old_locus_tag="MGF_0879"
                     /EC_number="5.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P59879.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="WP_011113348.1"
                     /db_xref="GI:499425884"
                     /translation="MDFNNKIVIIDKPKNISSAFCLNLFKKRFNIKKAGHNGTLDPLA
                     SGVLVVATNKRTKELSQLNQDDKQYLVKLKFNTHTDSYDRLGKVIRTTNYVPEIKQLN
                     DYLTSLDNHSFYQLPPNFSALKVNGVRAYQLARKAVDFELEKRPTTIYKAKLISYYDD
                     YAEILLDVKKGFYVRSFVVDLASQFNTTAMMVDLVRTRSGQYSLKDVIDYQFNK"
     gene            149472..151445
                     /locus_tag="MGF_RS00620"
                     /old_locus_tag="MGF_0881"
     CDS             149472..151445
                     /locus_tag="MGF_RS00620"
                     /old_locus_tag="MGF_0881"
                     /EC_number="2.7.7.2"
                     /EC_number="2.8.1.-"
                     /EC_number="2.7.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBZ0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="WP_014574420.1"
                     /db_xref="GI:504387318"
                     /translation="MLSIINLTSKTIKEVNKGVDLVIGFFDGIHKGHAKLFKQSDRFN
                     LLTFDHIPKKQRLLYPKVDEIEQLSALSGLEQLLVYDLLNNNLSAQEFIDNYIKLIQP
                     KRIIVGSDFKFGSDQVDYSLFTKNGYEVVVVKKDHCSTSEIKKLIINCDLDQANRLLV
                     APFYLKGTVIKNAQRGRTIGFATANIILDNQLIELTEGSYVCKIIVDNKTHQGICFIG
                     KPKTFDEKQRQCEAHIFDFDQDIYEKKIKVELHQFIRPTVKFNSINELKEAIENDKKT
                     ALSFFHKQEKPRVVVALSGGVDSAVCAYLLQQQGYDVVAAFMQNWDKDLNFELLSDHA
                     DDQIQGCDAKQDYEDAQKLCEQLKIKLYHFNFVEQYWNDVFLKVLEDYKKGLTPNPDV
                     LCNQFGKFGWFINALRKQFGNNIKIAFGHYAKLITKDDEVFLVHTKDHNKDQTYFLTM
                     LKKEQLKNIIFPLSELDKPTVREIAKQANLYVANKKDSTGICFIGERNFKQFLSNYLA
                     IKKGPIILIDENKKIGEHDGLYFYTIGQSRRLHVGGTKEKIFVCNKDYNNNTLYVCYE
                     SSKDQYLSSVSCELENFNWLTDTKDQLLNKKLWIRFRHRQKLQECEIVSYHDDKVIVK
                     YTKQIGVTPGQYGVIYDQNLWVVGGGKITKIIK"
     gene            complement(151447..152763)
                     /locus_tag="MGF_RS00625"
                     /old_locus_tag="MGF_0901"
     CDS             complement(151447..152763)
                     /locus_tag="MGF_RS00625"
                     /old_locus_tag="MGF_0901"
                     /EC_number="3.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="acetyl-CoA hydrolase"
                     /protein_id="WP_014574421.1"
                     /db_xref="GI:504387319"
                     /translation="MNYFEAYKNKLVSVNQAISLIKNNSNIWFDYLQPKLLLQGLKDT
                     LETNSYSNLNFYYYASSSDYEETIFLDKFNQIVKRHCFFYRANERNALKKYQNGILQN
                     NVEYYPFHFSESTKILNNFAIDTVILITTDIDENGYFNLGLSTCYDLDLIKKAKQVII
                     EVNKNMPHIMGDKHQIHINDVAAIVKSDYQLTEALSVDPSPEHLKIADYVASLIQDRS
                     TIQLGIGAIPNMVCKKLVNKKDLGIHTEILGTGMVELIKLGVVSNKYKEIDQGVSTFV
                     FAVGDQDMYKYLDHNSKFKIARFDYVNNPLNIAKFENFISVNSAIEIDLLGNVNAEQI
                     QHNQYSASGGQADFIRGASYSKNGKSIIAMKSTTSDCKISKIVTKLKGVTTTLRNDLD
                     YVITEYGIISLKAKSVKQRAKLLISIAHPKFRSYLTRVARSKLLID"
     gene            153251..155959
                     /locus_tag="MGF_RS00630"
                     /old_locus_tag="MGF_0904"
     CDS             153251..155959
                     /locus_tag="MGF_RS00630"
                     /old_locus_tag="MGF_0904"
                     /EC_number="6.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_014574422.1"
                     /db_xref="GI:504387320"
                     /translation="MNKHLSGSQIRQIWLDFFKSKKHEIIESKSLVPINDPSLLWINA
                     GVATLKKYFSGEENPINPRLANSQRCIRANDIENVGVTSRHHTVFEMLGNFSIGDYFK
                     KEAIEFGYELLTKFYGLNKDKLYITIYEDDNDAFNYWVDQGIDPHHIIRCDKKRNFWD
                     LGSGPCGPSTEIYYDRGEKYDPNKLGEKLFFEDIENDRYIEVWNIVFSQFNNTGNNNY
                     TELVRKNIDTGASLERFACILQDVPTNYDTDLYLPIIRTIEKHTNHKYVVDHYFSKDQ
                     SEQDVLRAFRVIADHLKCGVFAIADGVLPGAKDRDYIIRKLLRRAFVYAKKLNAKPEY
                     LVETINVIINTYSDFFKYLIPNKEIVIQAITNEANNFTKTLDYGFEIFNEAKTTNNIT
                     AEMIFKLVETYGFPLDLIKELSAEAKIKLDLDGFEELFKKHQEISKANNGEVGLKKQN
                     ENLLKFETQSKFYYDKNNIKTKVVAIFDDKFNPVDQIEVGSGWAVFESTPIYATSGGQ
                     RFDEGYCLKKGNLVVHFDNVIKAPNKQHLHHFKKASFWLNEKVELMHDENWRKLVRKN
                     HSLEHILHATLKNTINETIKQSGAFKSAAKATLDFNYPTKLTDEDLDKIETKMRQVIA
                     DKIPVTVHHVDYETSQKMNAIAYFEEEYKKHELLRVIKIGDYSVELCGGTHVDNTKEI
                     EECFITDLYSLGAGRWRIEIISSYETIYNYLVDKQNEIKQEKNHMFNELGNYDLTHYL
                     DFSKKLHSFNLPTSIKDLRKTLRAFEQIKEEYKAIKLELDKKKTKDRANQIKKLALDN
                     LEHKIVLLFFDKEEHKALSIAHSELVNEKPDHLFFFINKSDNKINYLIGIKNATDKLN
                     AKLLIDKVNVMFGAKGGGKQNFAQGGFSTDKDVGKLKADFVNICIT"
     gene            155947..156375
                     /locus_tag="MGF_RS00635"
                     /old_locus_tag="MGF_0918"
     CDS             155947..156375
                     /locus_tag="MGF_RS00635"
                     /old_locus_tag="MGF_0918"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBY7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Holliday junction resolvase"
                     /protein_id="WP_014574423.1"
                     /db_xref="GI:504387321"
                     /translation="MYYVALDVGSKTLGIATGDGEFKIASPYCVISFNQYDFKQCLAE
                     LKEKTASFFYDFKFVIGMPKNIDQTKSSTTEMVENFIELLKANYKNEVIIYDESYTSI
                     IADQLLIDNQIKAKKRKEKIDKLAAFVILQSFFDDDRYPK"
     gene            156350..156922
                     /locus_tag="MGF_RS00640"
                     /old_locus_tag="MGF_0919"
     CDS             156350..156922
                     /locus_tag="MGF_RS00640"
                     /old_locus_tag="MGF_0919"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014574424.1"
                     /db_xref="GI:504387322"
                     /translation="MMMTDILNKFKQLNLELKIPIMRDENLVNLVNQLSRRKISQLLE
                     IGTGIGFSSMYLSLHLPDLVIDTLEKDIQRYQIAKEWLVNFSKINCLLGDCYEFIPTK
                     KYQAIILDGPKAKQMELFNKYLNYLLPGGVMIIDNFFLRNIKPNNKLYHKNLVWQEFI
                     HNLDKKQFNVEIDQSGDGVVYVFSKPSTIA"
     gene            156891..157844
                     /locus_tag="MGF_RS00645"
                     /old_locus_tag="MGF_0921"
     CDS             156891..157844
                     /locus_tag="MGF_RS00645"
                     /old_locus_tag="MGF_0921"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase U32"
                     /protein_id="WP_014574425.1"
                     /db_xref="GI:504387323"
                     /translation="MFLVSQVQSLNQAKKFIDQAIDCILVGYENFALRCTKTLNHEEL
                     KELVDYRNTKKSKTKIFVLINSFIFENQLDDLTQKLVELDQLKVDKVYFQDYAIVQII
                     RENKLNLAVSYHSETMVTSYGQFDFFRENKINHLVIARELFMNEIKQMHEHKKALELE
                     MQIQGYAFFMHSRWKMISNFEAYAKISDKLSSKKQLWIREALRKYPNAIYEDEFGTHM
                     FTGYILCAIKQLKELHDYGLDYVRIDSIMIKEEDHEKVTLIYQDLINKLNNKKAVSDQ
                     LINKKYDEIAKISSPIEIASGFFGGMKEIKHLIKEEGKVKR"
     gene            157844..159073
                     /locus_tag="MGF_RS00650"
                     /old_locus_tag="MGF_0924"
     CDS             157844..159073
                     /locus_tag="MGF_RS00650"
                     /old_locus_tag="MGF_0924"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase U32"
                     /protein_id="WP_011113355.1"
                     /db_xref="GI:499425891"
                     /translation="MKYELLAPAGDVQKAMFAIDYGADAVFLGAKAYSLRSSASNFFF
                     KDIKQTVDYAHERNRKVYVAVNVVCHNPLVKGFAKFIANLEETGVDGLIVADPFIIDY
                     TKKHHPNLDLHLSTQQSVTNSKSALFWKSNGLSRVVLAREVTMDELSLLMPKVKDKVE
                     IEYFIHGAVCIAFSGRCMMSNNWSLRDANVGGCAQSCRWRYELKDDKQQHHSDSFTMS
                     PKDMALIDEIKQLMELGVASFKVEGRMKSINYVATVIRSYRYAMDYYLANGFNTNKED
                     EKVILDQVKQDLKSAENRPTNKGFAHNQPGIDAMLYHEEERKISQTFAFIVDEIQDDG
                     YIKVTCKNNFKKAQEYIIYGPNFKIDQVKITSLLNKNKEVVEVANDPMSTYYLKFDQH
                     YDLIKNSIGHIKKTLDY"
     gene            complement(159085..159339)
                     /locus_tag="MGF_RS00655"
                     /old_locus_tag="MGF_0935"
     CDS             complement(159085..159339)
                     /locus_tag="MGF_RS00655"
                     /old_locus_tag="MGF_0935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_014574426.1"
                     /db_xref="GI:504387324"
                     /translation="MANIKANEKSYRQNQKTNLLTKGFKTSLKNQLKKTKVSKDKKDV
                     EQVYSLADKLAKNNRISKNKARRLKSRAARWSNSATAASR"
     gene            159416..160075
                     /locus_tag="MGF_RS00660"
                     /old_locus_tag="MGF_0936"
     CDS             159416..160075
                     /locus_tag="MGF_RS00660"
                     /old_locus_tag="MGF_0936"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113357.1"
                     /db_xref="GI:499425893"
                     /translation="MNSSFLFIVLLVIIPIGLISYVIYKRKKSKEPGQFSGKTKEERR
                     NEVWKTIKRYLQDNEMYGREIMYSFVAKRPSPNDDRKLHKQFKEETKQYLLEHKLSKK
                     DKKQYLDNRKKEMARERYCIYFQTKDARTQATFDPAIIEAEVLTLPAKSKRDVPERKI
                     QINGLQDFQKEFSWIEPLKNKEDARLKKAEDERLRKLEIKERKKAAKLAKKEAKAKKK
                     I"
     gene            160082..161029
                     /locus_tag="MGF_RS00665"
                     /old_locus_tag="MGF_0941"
     CDS             160082..161029
                     /locus_tag="MGF_RS00665"
                     /old_locus_tag="MGF_0941"
                     /EC_number="2.1.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_014574427.1"
                     /db_xref="GI:504387325"
                     /translation="MNKKKVIFFGTTELSLACLKELLADNFFNVVAIICPPDRVNLNN
                     KKNKLNAVKQYCFDHRLTIYQPEKLSEFYDQLAQMEFDLGVCIAYGQFIPKKVIDLFS
                     DGILNVHPSKLPLLRGGAPIHHAIINGFESTAISIMKLDEKMDHGPVYDQLEIKINPE
                     WNHDDLNQEIIVKSPAFLIKTIKNIYETNLQPKEQNHERFTLGLNIKKEQEHLNLNLD
                     AKSFVNWQKGLWSTPGGYLDYDNQRVKIAACHLVENNREHNDDLVGTIYQIDSSGIYV
                     YLKQGSIAITKYLMPSKKVVDIKQAINGKVPFKLNSKFN"
     gene            161035..163185
                     /locus_tag="MGF_RS00670"
                     /old_locus_tag="MGF_0942"
     CDS             161035..163185
                     /locus_tag="MGF_RS00670"
                     /old_locus_tag="MGF_0942"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574428.1"
                     /db_xref="GI:504387326"
                     /translation="MEKKQIFKKTDFLNTFNRPKSLWKFSNTELLAIIQNELGLSKDD
                     YVDLIDQLENENSSVIDFDEIDFITDELNQEESKNIYLNEVSKIKVKAKEYIKRRVLF
                     QEIDYANLEEDNLKFVDGVFNESQIKYTDVFDLQEDKKALRIIDLADYQKTPLITAID
                     LHEIIKKHDYNEAKLLILDGIYFNEKSQYFLQANIDCCLFERHKNGKIKATVYSLKNS
                     TTTKRKDIVVFYYDYRVLAELGYEVVEWNVVLIKYTLSKKNGVEFTTTNTVCHSKNSA
                     AFPEKLKESNFFSKSLIENKASFKRSGYEKLALDYPELKPNNTSFGDLLDILLFNVKE
                     SDNKKTYNFVAEQMSVVKNAFDNVFDQMMQIKETNIGKIVLSNAYFNQFADNVHGTII
                     KYTLGKKVFEPFLLSGNVYKVAKFFNENNQLDFPLVNQNNEPFSITNFMNYVSNNADT
                     LKPVNYFNTLNKVYGSKPIDYFVFDEAKIAFSKLKPKKVYFDFESICHLFAPMDDLLP
                     NMQIVTQNSYIIDNNDSKKLECFNDVMDPCKLDVNWFAKIINDLHQGEDYSYVVYNKS
                     FEKSRLYEMAYYLERYKQYHPQQFLDQKNLDVDFLKKVKEINNNLFDLADFFNLSKKL
                     LVIRSLNGFYSIKKTLLLTSSEHRKKAKAVDYATLNVKRGDMAQNLTAKRFLGLLSDQ
                     EWEQIAIDLATYCENDVRSMIAVEYYIRDLLKAN"
     gene            163229..163717
                     /locus_tag="MGF_RS00675"
                     /old_locus_tag="MGF_0951"
     CDS             163229..163717
                     /locus_tag="MGF_RS00675"
                     /old_locus_tag="MGF_0951"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="beta-galactosidase"
                     /protein_id="WP_014574429.1"
                     /db_xref="GI:504387327"
                     /translation="MIYDKLENFDKYLSVNKYFPRIRAFLEQHNYDLSHLRVGIHEID
                     GMDLYLNVLDSIVYLNTEARYELHHKYGDVHLVFNPGEIYFSQHAEDAKNMKVEIPYN
                     ETKDVTFYISDTTKDGVSHNRLVPSKNSFVVFLPGDLHAPRVSEQPSNNIIKYIFKFR
                     CS"
     gene            163708..165738
                     /locus_tag="MGF_RS00680"
                     /old_locus_tag="MGF_0955"
     CDS             163708..165738
                     /locus_tag="MGF_RS00680"
                     /old_locus_tag="MGF_0955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574430.1"
                     /db_xref="GI:504387328"
                     /translation="MFIRKIFRLISFFFISLLGLFNLNIGLIKENKIVDYKQSLHAEN
                     LTNNADFFYDDLNQTAQAKTIKIFLTDSDYQSVLSSLMLTQYFLNDDIVDDKNSPVVF
                     LYQQQLVNDIDFSINVASNITNWFQNNYPQNQGLIETNNSTIFANNTNISYTSANVLT
                     FLDLIRIYFHNQYINDPQLVNKPLLFDIFISPQLLATIWDNQSLMLYNFLPYLNKFHV
                     IANTNYLKTVFFRNYAQLINNNLINFNPQQVLINYQDDFKKIFVNAKRHLESNTNNNN
                     GFNDDSRDQISLDTFKKTPLYQLVYNQEKFLFYDGVSYQLNNTQVSDTLRLNVRFYQK
                     IYELFFNAKRLMLDPTKVPLLIKQYLNIFLVTDQYNVSDYIYKNRTDFDINKKTFVFL
                     EPLAPSKLNLNELNSSNTITNTKFDEYKSILATFRKIYPHDRYNFIYLTNVNFDGFKN
                     RFDSFQQLLELNDAKIIYTKPISGYFFFYELWNEYQRNIRSNVDSSIILGGVDYNDDN
                     VLEAYDFLTTNTSTRTEQSNLIARNINNFPVPLTFLINDFEPGVLNPPAQYFLLNSSY
                     ITVVQGLINETLNTNQAVNLIGSKRFFDDNNYTSYDPIQAYNRIISQERREISNQATI
                     PIILVVFFVLLIGLVGIMMIFIIYNYKKLRRAQKSWSAYIAKFRKEEDNNHA"
     gene            165731..166435
                     /locus_tag="MGF_RS00685"
                     /old_locus_tag="MGF_0966"
     CDS             165731..166435
                     /locus_tag="MGF_RS00685"
                     /old_locus_tag="MGF_0966"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBX7.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883850.1"
                     /db_xref="GI:500213676"
                     /translation="MPRKHLIANQINKKQQSNAKLWQKLAKEIKAAVKVGGTDPETNY
                     RLKAAIDKALTYNLSKDSINRNIYGNSNKEDDQLIEAEYEIYGPGGLGIIVRTLSDNP
                     NRVISSLNGYISKLKGSLAKPNSVKINFQEQGIILTDLNNYHDEALLELLIDYELIDI
                     NSDEEGYEIITVPNAYYEVKKKLEAAGFKIHHSELKLIPLLYVQLTPEQNEMFERFSA
                     SCENDDDIQWIVANNQ"
     gene            166470..166544
                     /locus_tag="MGF_RS00690"
                     /old_locus_tag="MGF_tRNA01"
     tRNA            166470..166544
                     /locus_tag="MGF_RS00690"
                     /old_locus_tag="MGF_tRNA01"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:166502..166504,aa:Asn,seq:gtt)
     gene            166549..166625
                     /locus_tag="MGF_RS00695"
                     /old_locus_tag="MGF_tRNA02"
     tRNA            166549..166625
                     /locus_tag="MGF_RS00695"
                     /old_locus_tag="MGF_tRNA02"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:166583..166585,aa:Glu,seq:ttc)
     gene            166739..166814
                     /locus_tag="MGF_RS00700"
                     /old_locus_tag="MGF_tRNA03"
     tRNA            166739..166814
                     /locus_tag="MGF_RS00700"
                     /old_locus_tag="MGF_tRNA03"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:166772..166774,aa:Val,seq:tac)
     gene            166816..166891
                     /locus_tag="MGF_RS00705"
                     /old_locus_tag="MGF_tRNA04"
     tRNA            166816..166891
                     /locus_tag="MGF_RS00705"
                     /old_locus_tag="MGF_tRNA04"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:166849..166851,aa:Thr,seq:tgt)
     gene            166896..166971
                     /locus_tag="MGF_RS00710"
                     /old_locus_tag="MGF_tRNA05"
     tRNA            166896..166971
                     /locus_tag="MGF_RS00710"
                     /old_locus_tag="MGF_tRNA05"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:166929..166931,aa:Lys,seq:ctt)
     gene            166976..167061
                     /locus_tag="MGF_RS00715"
                     /old_locus_tag="MGF_tRNA06"
     tRNA            166976..167061
                     /locus_tag="MGF_RS00715"
                     /old_locus_tag="MGF_tRNA06"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:167010..167012,aa:Leu,seq:tag)
     gene            167511..167777
                     /locus_tag="MGF_RS00720"
                     /old_locus_tag="MGF_0977"
     CDS             167511..167777
                     /locus_tag="MGF_RS00720"
                     /old_locus_tag="MGF_0977"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113363.1"
                     /db_xref="GI:499425899"
                     /translation="MDTTRIVFITLSTLALVICLVFWGSSFYMFWKRYRIRRTTYDGA
                     FGKTISDKEMKLTWWQKNGGYLLFISGLMILLFSVAGFVSLTNL"
     gene            167835..170507
                     /locus_tag="MGF_RS00725"
                     /old_locus_tag="MGF_0979"
     CDS             167835..170507
                     /locus_tag="MGF_RS00725"
                     /old_locus_tag="MGF_0979"
                     /EC_number="2.7.1.69"
                     /EC_number="2.7.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="PTS sugar transporter"
                     /protein_id="WP_014574432.1"
                     /db_xref="GI:504387330"
                     /translation="MASTTNQVHSQKRSSERWKRFSGHFKEVVGKLSAGIMIPIALLP
                     IAGLLLGIFAAIQNNVSQATHPGVFAMAAFFKNGAEAVFGNLPTLFAIAIAVAFTNQS
                     GVAALSAFVGWLIFNATQTALIFPANSQTFTILYYNNVPATALAMNLGLRSLSTSVFG
                     GVIVGAITALLFNKFHTIQLPKVVGFFNGNRFVPIITLLTMLPVALVALMIWPAIGIG
                     LNALGQSLGVLSRNGNFNSLIFGYVERALVPFGLHHAFYAPLWFTSAGGSIANIIVNQ
                     AGSDAIAPLIVTDENGQRVIRSIVGVAANKDAVKPAGFTAQNWMYWGQVVTALNPNTQ
                     INTDSLSGDQRLWFTINSLFVNKSVYLSGSSDPYTFTFKSFADSTLNHPSLIQSITRN
                     GTVISGAQLLKMVNESSTGSVVLQANDTLNFAFPGVNPGQYEQGKHAFMIFGLPAAGA
                     AMIMAAPKDQRKYASSIIISAAFTSFLTGITEPIEFTFLFLAPYLFWGFHAVFCAISF
                     WLTSLLGGNIGQTFSGGIIDLTIYGFIPDALGAKTNSWLPLVIGLFYIPLYYFTFYFL
                     ITKRNIETPGRGTGTRLYTKADYQAKVASKNAASRSDGSANFKPIEITSYKLIKAFGG
                     RDNISAVNACATKLRVSVKTKEKVNFGEIGALGSLGTYAVSDTLVHAVYGGDADIIKS
                     YMQKMINKDYDSSAIEKVIGDPATKEIDPSMPKATPEVDHKLSDVVDVYSPVKGTVTD
                     LADLPDPSFAGKIMGDGVSIEPLDGMFYSPVDGKLELAYDTGHAYFFDVNGAKILIHI
                     GIDTVSLNSNNSDSNNLVGFKMFAKSGDNVSFKKSPVVQANLEMIKKKELSTNSPILA
                     LKETLANYDLKVVVKPGDKVNVGDLLFKLTKKNK"
     gene            170670..172082
                     /locus_tag="MGF_RS00730"
                     /old_locus_tag="MGF_0998"
     CDS             170670..172082
                     /locus_tag="MGF_RS00730"
                     /old_locus_tag="MGF_0998"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_041594427.1"
                     /db_xref="GI:753838810"
                     /translation="MKGLINNQEVGSSKLIEIKSPIDHELSGSFYGMTAEEIDDAYEK
                     ADIAFKSWSKAGYEYRKAKILKFAQLLDAHKEEFANLLTDNIAKAYNESLAEVTRSIQ
                     YIHDTISVYEEMIAHPLVMDEKIHHVKEKVGKFVREPLGVALNISPWNYPLNTPLSKM
                     IPTLIAGNTVVYKVATQAAIIGIRLAHLFKQAGFDPGVVQCVVGLGREIGDKLNTNKH
                     IKSISFTGSTPVGLSLLKQSAVGNISLELGGKDAALVLSDYDKQKTIKEIVKGAYSYS
                     GQRCTAIKRVFVKNEDADEFVQLLKKEVEKLHLGNPFNNPSLVPVIDQHAANFIKELF
                     DDAVAKKAVVLTGGDFEKNCVEAILLDHVTTDMRVAWEEPFGPILPIIRVKNEAEMVK
                     LHNQSEYGLQASIFTSDQTKFDELANQLEAGTINWNRSSSRGPDFFPFMGVKDSGVGV
                     QGIKDTILSVTRYKGFVYNR"
     gene            172151..172459
                     /locus_tag="MGF_RS00735"
                     /old_locus_tag="MGF_1010"
     CDS             172151..172459
                     /locus_tag="MGF_RS00735"
                     /old_locus_tag="MGF_1010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_011883863.1"
                     /db_xref="GI:500213689"
                     /translation="MKKDIHPTLNKVSFLCSSCNNKFILLSVIKAKEVHMDVCSKCHS
                     FYIGETTQQVVKGRAEKLSSKFNQGKAHISKKAEANSAKPQAKTTKRSNDKAKSLKDL
                     "
     gene            172541..173623
                     /locus_tag="MGF_RS00740"
                     /old_locus_tag="MGF_1014"
     CDS             172541..173623
                     /locus_tag="MGF_RS00740"
                     /old_locus_tag="MGF_1014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide chain release factor 1"
                     /protein_id="WP_011883865.1"
                     /db_xref="GI:500213691"
                     /translation="MEYNKQMYETLVAIRATAQKLNKELESLTNDFKRIHAINKELKQ
                     KKQLLEVFELYDKLVVSGLEAEKIINDNTMKEFHELAILDLDAAKEQIPDLEEKLKVL
                     LLPADPNDDKEVIVEMRPAAGGDESSIFVGNMFDLYKEYCSKHNWKINVIEMLPTSVG
                     YSFISFEINGEDVYSKMKFESGVHRVQRVPATEAKGRVHTSTITIAVLPQQDDVEIEI
                     NPADLRIDTYRASGAGGQHVNRTESAVRITHIPTGIVAACQEGKSQIANRETAMKMLR
                     SKLWEAAEKEKNDALSALRKNQVGSGDRAEKIRTYNYPQNRVTDHRINMSLNSLDRFM
                     MGEIDEMIDALRSKEQEEKMKLIMNE"
     gene            173628..174482
                     /locus_tag="MGF_RS00745"
                     /old_locus_tag="MGF_1025"
     CDS             173628..174482
                     /locus_tag="MGF_RS00745"
                     /old_locus_tag="MGF_1025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="modification methylase HemK"
                     /protein_id="WP_011883867.1"
                     /db_xref="GI:500213693"
                     /translation="MTFHELINYLTNNYSKYQEKYSWSFFLLIKHYSEKIENKTDLIT
                     LRNEEIDFNFDQFIKDCNRIYKDEYPVEYIINQIEINGLKLFVDETVLIPRIDTNAVI
                     EKFLEVINLRKDIVNVLDICTGTGLIALTIKKQFPKYQVFGSDISKSAVKIANFNAVN
                     NLLDARFYVADYLEVFEQVSEEIDALIINPPYLDEELKSNYIKEINYEPFNALFAKNG
                     GTFFYEEIFRYLTTNKTKIKVLCMEFSEPIYEKTVQLLKKYGLYDKTAFFNDANDKLR
                     GFIIEWKF"
     gene            174470..175018
                     /locus_tag="MGF_RS00750"
                     /old_locus_tag="MGF_1029"
     CDS             174470..175018
                     /locus_tag="MGF_RS00750"
                     /old_locus_tag="MGF_1029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="translation factor/ribosome maturation factor"
                     /protein_id="WP_011883869.1"
                     /db_xref="GI:500213696"
                     /translation="MKVLEFERDFDEIVKAINDDKLVILPTDTVFGVICKSKNKIYDF
                     KKRDLNKKLIYFCSDVEQTNINDKLFLDLANRFWPGKLTLIYNKESYRIPNSPYILKI
                     AKICGKIYSSSANISNLNPYKTWEQYYNDSYFNQNNDVVLIRGETTSEQGSTIYDLDS
                     NKILREGELSQSLKEFLANRSK"
     gene            175110..175580
                     /locus_tag="MGF_RS00755"
                     /old_locus_tag="MGF_1032"
     CDS             175110..175580
                     /locus_tag="MGF_RS00755"
                     /old_locus_tag="MGF_1032"
                     /EC_number="5.3.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="WP_011113370.1"
                     /db_xref="GI:499425906"
                     /translation="MDKRKIIFVADHTGVFLKQELISMLKTEYHNQYEVIDLGSDDEK
                     SADDYPDFAFMLEDYFKDENTRNIGVAICGTGVGICIAANKIKNVRAGLVTDVQYAEL
                     AIQHDNCNVLVLGARTTSIDVNKEILRKFLSAQFEGGRHQRRVDKISNYEKKQD"
     gene            175516..176064
                     /locus_tag="MGF_RS00760"
                     /old_locus_tag="MGF_1034"
     CDS             175516..176064
                     /locus_tag="MGF_RS00760"
                     /old_locus_tag="MGF_1034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574434.1"
                     /db_xref="GI:504387332"
                     /translation="MKVVDTKEEWIKLVTMKKNKIKDPLKANYFKLDLVPAEFKPSRK
                     KSYIYFGIAIAVLLLSLVFVGLSAAPYVEILNRDVTQAEFVNAVETNGFFTRIYTPDN
                     STIVQPGTVGLDITPLVRSSNVPNIVATIRIAIGAVSIFLFVLFIILIIVSYMYFLGS
                     IKAIDKPTKPYVTEPTIQTKKV"
     gene            176111..176635
                     /locus_tag="MGF_RS00765"
                     /old_locus_tag="MGF_1036"
     CDS             176111..176635
                     /locus_tag="MGF_RS00765"
                     /old_locus_tag="MGF_1036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Holliday junction resolvase"
                     /protein_id="WP_011883875.1"
                     /db_xref="GI:500213702"
                     /translation="MHQNRGMFLETLINNTIKHNELAHKGLIFKRHLPINVYNFANRR
                     VAGWLKEKTQTDYYGLYKGHFFDFDAKQSSKINYSLKNIKQHQLDHLRKIHQQGGIAF
                     ILLLIVPKEEFYMIPIEKIDFWLKNQESNTLKYEWIQKSSFKLELFYPGVIGIFEALQ
                     EWIDLITLRRSGGS"
     gene            complement(176607..176978)
                     /locus_tag="MGF_RS00770"
                     /old_locus_tag="MGF_1040"
     CDS             complement(176607..176978)
                     /locus_tag="MGF_RS00770"
                     /old_locus_tag="MGF_1040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_011883877.1"
                     /db_xref="GI:500213704"
                     /translation="MLTKSEICKIIAECTGVSPKLVKACFQVYSDLVKKEIKSQGQVR
                     LPELGTFRVTIGRERISVNPITGAQTRIPPKPKVKFRAAKPLKEVTATIKWKYVSEDD
                     ELLQPKRKAAGFFKNRQNDEE"
     gene            177118..177567
                     /locus_tag="MGF_RS00775"
                     /old_locus_tag="MGF_1041"
     CDS             177118..177567
                     /locus_tag="MGF_RS00775"
                     /old_locus_tag="MGF_1041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883879.1"
                     /db_xref="GI:500213706"
                     /translation="MSHKLSEEQKKETEYQANVEKAITAFNTLFTKEANKFDFIKSVY
                     ENDGVANMEYPRQKLNELMDLIINEPTKHYARNFFINTCLTKITAYEEIEDVLSLFKK
                     NKQILDKFCLYYLLFKQSFNFDDSERSKITKILSNIARELIEVLDLN"
     gene            177570..177779
                     /locus_tag="MGF_RS00780"
                     /old_locus_tag="MGF_1043"
     CDS             177570..177779
                     /locus_tag="MGF_RS00780"
                     /old_locus_tag="MGF_1043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113375.1"
                     /db_xref="GI:499425911"
                     /translation="MARRDKGINLIILIVLLILGIVPGILYALFKFFVPPFSWVIFAI
                     LLLLFVFPAIIYLLTCSDVVVFSRI"
     gene            177970..178461
                     /locus_tag="MGF_RS00785"
                     /old_locus_tag="MGF_1045"
     CDS             177970..178461
                     /locus_tag="MGF_RS00785"
                     /old_locus_tag="MGF_1045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_011883882.1"
                     /db_xref="GI:500213709"
                     /translation="MKAIIQKKIEHVNKIAGLLKEAKSFVVFEYSTMTAKAITALRRK
                     VKTSANQMFVLKNNILKRAIKEAGIDGFDDDIKNQIAVVIGLEDAFLPIKAVHEYVTA
                     NEKVKYVCGYLENKKLSAAELSEIAVLPSRDELYSMFLSVLQAPVGKFMYALKAVADT
                     KQQ"
     gene            178501..178866
                     /gene="rplL"
                     /locus_tag="MGF_RS00790"
                     /old_locus_tag="MGF_1048"
     CDS             178501..178866
                     /gene="rplL"
                     /locus_tag="MGF_RS00790"
                     /old_locus_tag="MGF_1048"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBW3.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_014574436.1"
                     /db_xref="GI:504387334"
                     /translation="MAKLTKEQFIESLKEMTIVEINDVIKAIEEAFGVSAAAPVAAAA
                     AAPAAAAPTEATVVLVSAGDKKVEVIKLVREVTGLGLMDAKKAVDTPPATIKENMNIE
                     EAKALKAKFEAVGAKVDLK"
     gene            178915..179088
                     /locus_tag="MGF_RS00795"
                     /old_locus_tag="MGF_1049"
     CDS             178915..179088
                     /locus_tag="MGF_RS00795"
                     /old_locus_tag="MGF_1049"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBW2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L32"
                     /protein_id="WP_011113378.1"
                     /db_xref="GI:499425914"
                     /translation="MAVQQRRSSKHRRDKRRSHDALAVNLINVCKHCGKFKRAHRACS
                     CGMYNELRITKAK"
     gene            179088..179279
                     /locus_tag="MGF_RS00800"
                     /old_locus_tag="MGF_1052"
     CDS             179088..179279
                     /locus_tag="MGF_RS00800"
                     /old_locus_tag="MGF_1052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113379.1"
                     /db_xref="GI:499425915"
                     /translation="MNDNLSHKSKDLNLTSVSEVSKYQNSKIKAGLDWFSATAIILLT
                     VIGVCLGICMACLVIIHAS"
     gene            complement(179426..180601)
                     /locus_tag="MGF_RS00805"
                     /old_locus_tag="MGF_1063"
     CDS             complement(179426..180601)
                     /locus_tag="MGF_RS00805"
                     /old_locus_tag="MGF_1063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_011883887.1"
                     /db_xref="GI:500213714"
                     /translation="MSSKRDYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNKDSDAE
                     EKFKEVNEAYEVLSDEEKRKLYDTYGHEGLNASGFHQGGFNPYDVFNSVFSGFDFEGG
                     FGDVFSQFFGGGGSGFHNQEYIEEVDVNLVHEIKINFLEAANGCIKNVKYTRQVTCPD
                     CNGSGSADGDVITCSDCNGEGFVVEQRRTLLGMFQTKKTCPSCKGEGQTIKNKCKKCK
                     SRRMVDEVVERKVSIDSNVFYQDVVIVRGEGHIYKNLVGDLFLRVKIEPSRVFELRDN
                     HVVVNVLVDPLVAITGGTILIPTLKEIKEINLKAGTKNGDIITIANGGINLKLDSRVY
                     GANYNQKGDLIVVINYARPSEYSKQEIAKLKEFIKPNKEVNLYETLMKKELNNKNSQ"
     gene            180956..182161
                     /locus_tag="MGF_RS00810"
                     /old_locus_tag="MGF_1065"
     CDS             180956..182161
                     /locus_tag="MGF_RS00810"
                     /old_locus_tag="MGF_1065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574437.1"
                     /db_xref="GI:504387335"
                     /translation="MLKKILKWFLLASFVAVPLSSCTNKNKKEMVSNSPPNMDPGNTS
                     GTNENNNPREPLPPINRSEGMKSEDKSGKMEADRSSDSSNETKSLQLSLKSKAVIASD
                     LVTQASGGYSLNWSKFMTNLNSEEQTNSRLLNLIVDDREGQISFDLQVGGNQKLSFKE
                     KVDFDFQFLKALTFNWTDTKPTTTNSSLTQLQKVTNAQGLSEFATPVLSVASDDSTNY
                     FTYLSDWFDVNLTYVSVDKKLEQNDLTFDYQLTINPNKRSFYQIENNSKQPQLWHSDE
                     DRTVLSYPSDLSKAAADVIINKTSELFDKPIDYFYDTTNHTVKTDQLEVTARNNGLIK
                     FSNSKYNDQFAITLVQNSASFNTDRNELTFTVEIKPKDSNEFNSMGGIGRTFTITTYR
                     WTISTLPMN"
     gene            182296..184428
                     /locus_tag="MGF_RS00815"
                     /old_locus_tag="MGF_1075"
     CDS             182296..184428
                     /locus_tag="MGF_RS00815"
                     /old_locus_tag="MGF_1075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113382.1"
                     /db_xref="GI:499425918"
                     /translation="MNTGYSQIDKQEKANKLFGKTAIAKAIWIVCLPGLLAAFFAGLY
                     SFFDQILIQKLVPEVWKLNDVYNGLHFSNINVYQRVFDQIFVNDAIVRVPNIYFFDNG
                     YYQASVSQPVPIGYFNSDFIKIFGEQVRSQPIITLDKNVLAQSINNYQILDNIVLLFK
                     NVYNSQIGAVGDNTSQLSNVSIIARQAVNSFQNILLIGNAAIYLVPIGAGVYYTKSIS
                     YKYEKTGRDIWVMSFWTTLILCLIASLICFIIVGAGVQRSLIGTANLSPRVISLLDHN
                     NANEIVSRINNVDLDSLNGVNFVNYPKVILTYDDAMADISALWADQYSWIYASGFFFI
                     GLFSLLSFMIRSEGRNIFVTVASIIANVTNVLLDFIFIKYFSLGLIGGATASVISWVV
                     NLILYVGFVMYFNKKQATWLSFHDLFKVKFNIKIIIPIMILGLSSFIRIVGLTVMFLV
                     YNLLLIRVSGQDFQNYHAGSTPLLILFFVALFGISDGGRPLIGYNYTNRHYKRVHSAF
                     WWSLFVTFTYAIISYIVVFFVAKTVLVNLFNFKDPSTTPMVQPIDNADMATSYIRITM
                     LRIVMFSITICGMMLFQGTNDVIRSYISSAIEGSFISYLVFGTVYGLSTVLPKTDNLN
                     IWVYVSGYAISPFITSVVVLILSILFLRRNLNVKNETIERKMNRLDLMQYNFFINEAK
                     KYNLLTPQQQHELVKLKKEKQELNTNQN"
     gene            complement(184495..185169)
                     /locus_tag="MGF_RS00820"
                     /old_locus_tag="MGF_1089"
     CDS             complement(184495..185169)
                     /locus_tag="MGF_RS00820"
                     /old_locus_tag="MGF_1089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA synthetase"
                     /protein_id="WP_011883893.1"
                     /db_xref="GI:500213720"
                     /translation="MSLSEVGKRLIQETINSDLINNLGNIVHKLIPMLESRQESTILP
                     YLAGNEVEDKYLADLQKLPAEFEKLVEENDIRSAIKLVLNISKEYSSVIEVRKPWELY
                     KNNKTQELANVLFAGTCAIRTVFVLLEPILTTKSKEVYEQMNFTPEQTQLKNINNFEQ
                     LLNHKINKSKKLFQKLDVTDPNVNLKPLEQQETKTKEVKDKKAKESSKQSPKEPTKEQ
                     AKEPTK"
     gene            complement(185211..185513)
                     /locus_tag="MGF_RS00825"
                     /old_locus_tag="MGF_1095"
     CDS             complement(185211..185513)
                     /locus_tag="MGF_RS00825"
                     /old_locus_tag="MGF_1095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883894.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_011883894.1"
                     /db_xref="GI:500213721"
                     /translation="MFQTKKTCYSCKGEGQTIKNKCKKCKSRRMVDEVVERKVSIDSN
                     VFYQDVVIVRGEEHIYKNLVGDLFLRVKIQPSRVFELRDNHVVVNVLVDPLVAVTR"
     gene            complement(185696..185824)
                     /locus_tag="MGF_RS00830"
                     /old_locus_tag="MGF_1099"
     CDS             complement(185696..185824)
                     /locus_tag="MGF_RS00830"
                     /old_locus_tag="MGF_1099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone domain-containing
                     protein"
                     /protein_id="WP_011883896.1"
                     /db_xref="GI:500213723"
                     /translation="MFNSVFSGFDFEGGFGDVFSQFFGGGGSGFHNQEYIEELMLI"
     gene            186426..187616
                     /locus_tag="MGF_RS00835"
                     /old_locus_tag="MGF_1102"
     CDS             186426..187616
                     /locus_tag="MGF_RS00835"
                     /old_locus_tag="MGF_1102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574438.1"
                     /db_xref="GI:504387336"
                     /translation="MRKKIFKLLALSSVLAVPLSSCMDKESKSGTKDEGSESNNKKED
                     DSLSDDKKDSGGGETGESGDKSGSGDSNLNEDQKPPATDESNDNAAIELTLKSTAVVA
                     SDLINQQNGTYSLNWTKFNTNISEQKQASATLSNLTVNDREGTISFNLATNDNRTFSF
                     NQTVDFSFENLKSLNFNWTDVKQTTNDASLEQIKAVTNSEQLSEFAMPALYTSSNDHT
                     NYFPYLSKWFIVNLTHQRHSKKLEENEITFQYQLSNHQKTDFYNIKNGSSERQIWFSN
                     ENTSFLVYPSDLSRAANSLVVNTSSELFNKPIDNFYDTTDGAVKTDELERSVKNGGFV
                     KFTNNDYGTKFDISLVNSTASYNADTRELSFTVQVRSVNDDYHNSRSIQKIFRVTLGK
                     NADE"
     gene            187734..189786
                     /locus_tag="MGF_RS00840"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(189855..190562)
                     /locus_tag="MGF_RS00845"
     CDS             complement(189855..190562)
                     /locus_tag="MGF_RS00845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA synthetase"
                     /protein_id="WP_041594428.1"
                     /db_xref="GI:753838811"
                     /translation="MSLSEDGKVGKRLIQETINSDLINNLGNLVHRLIPMLESRQEST
                     ILPYLAGNEVEDKYLADLQKLPAEFEKLVEENDIRSAIKLVLNISKEYSSVIEVRKPW
                     ELYKNNKTQELANVLFAGACAIRTVFVLLEPILTTKSKEVYEQMNFTPEQTQLKNINN
                     FEQLFNHKINKSKKLFQKLDVTDPNVKLKPLEQQETKTKEVKDKKAKESTKQANKESS
                     KQSPKQPINEQAKKTTK"
     gene            complement(191668..193038)
                     /gene="engA"
                     /locus_tag="MGF_RS00850"
                     /old_locus_tag="MGF_1143"
                     /gene_synonym="yfgK; yphC"
     CDS             complement(191668..193038)
                     /gene="engA"
                     /locus_tag="MGF_RS00850"
                     /old_locus_tag="MGF_1143"
                     /gene_synonym="yfgK; yphC"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBV2.2"
                     /note="EngA; essential Neisserial GTPase; synchronizes
                     cellular events by interacting with multiple targets with
                     tandem G-domains; overexpression in Escherichia coli
                     suppresses rrmJ mutation; structural analysis of the
                     Thermotoga maritima ortholog shows different nucleotide
                     binding affinities in the two binding domains; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribosome-associated GTPase EngA"
                     /protein_id="WP_014574443.1"
                     /db_xref="GI:504387341"
                     /translation="MLKVAIVGKPNVGKSTLFNRLIKNRIAIVDDTPGITRDRIFGDV
                     EWLTKRFQIIDTGGLTTESDIFQRAIEQQVQFAIDEADIILFVCSYKEGINADDHYAA
                     KLLKKHKNKKIIFVLNKIENQNKDQLNLSSYFSLGFGKPMIISAEHAIGIGDLLDEII
                     RLKNQFANKKEQELVATFCIIGKPNVGKSSLLNQLLKKERVLVSDIPGTTRDAIDATF
                     SYNKELYKVIDTAGIRRKGKIETRIEKFSVQRTQQAISRSKMILLMLDGSVDLSEQDE
                     VIGGLCYEANLPTIIVVNKWDLVKKDDKTMELFKKQIRSKFKYLPWSPIIFISAKANL
                     RIDTIFQTIKLIQAQLKIKISTSLLNDVVQKAHMINQPPIFNGNRLSITYTTQAQGQI
                     PTFVLFCNNPDYLHFSYARYLENKIREAFGLSYVPITLYFKSKNARNRKLSKDVKFKQ
                     TGYDLE"
     gene            complement(193031..193705)
                     /locus_tag="MGF_RS00855"
                     /old_locus_tag="MGF_1148"
     CDS             complement(193031..193705)
                     /locus_tag="MGF_RS00855"
                     /old_locus_tag="MGF_1148"
                     /EC_number="2.7.4.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytidylate kinase"
                     /protein_id="WP_014574444.1"
                     /db_xref="GI:504387342"
                     /translation="MTKQINSQQIAIDGPAGSGKSTVAKLVAQRLGFDYLSTGKIFRA
                     FYYLIKENNWSIDQLISNFNKYECAFNGDQVVINKENISQLLNDPTISKGASEIAQDP
                     KIRAFALSLQQDYANKKPVVMDGRDITSVVLPNAILKVFLTASAQQRAIRRIKQLNLE
                     LNKATLEQFTNEIQQRDDNDTNRKLAPLMIVKDAIVIDSDQLSIKQVVDKIISLYKQR
                     LGVNYA"
     gene            complement(193708..194349)
                     /locus_tag="MGF_RS00860"
                     /old_locus_tag="MGF_1151"
     CDS             complement(193708..194349)
                     /locus_tag="MGF_RS00860"
                     /old_locus_tag="MGF_1151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574445.1"
                     /db_xref="GI:504387343"
                     /translation="MSRLSQNKIIRETKKKQAQLNKIFNKEDESIVKYKQELDKISSN
                     ILIDYQTNKPRLLDLKVNYSDTNLKHINELKDLLSSFDSNDLINIIDQARFLNNYSSD
                     LTTNNQKKSWILNDPGLADINKIEENFENIKALSGNFVTNSHTDLDKLKKIIELAKEK
                     INDPDFFKPVEKIKIGTNRKKAKHFKILLGFIIGLISISIFFLFIIIGIFKVA"
     gene            194440..194991
                     /locus_tag="MGF_RS00865"
                     /old_locus_tag="MGF_1152"
     CDS             194440..194991
                     /locus_tag="MGF_RS00865"
                     /old_locus_tag="MGF_1152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glutamine amidotransferase"
                     /protein_id="WP_011883910.1"
                     /db_xref="GI:500213737"
                     /translation="MKLLVLTIKEFQDIELVSFASILTASGKFSKIDYYSPEEKDSVV
                     GQFNVAHIKTIKSFNVNDYDAIYVPGGMGAIHLRTNQKGLAAVHEFVKANKWVIAICD
                     SPNALSENKILSPEDKYISWSDGTMNHPNRIKDFNVQLNRSNKLITGRCSLTTLELAF
                     YTLEVLFSKEFSEELRAKLTGVA"
     gene            195039..195112
                     /locus_tag="MGF_RS00870"
                     /old_locus_tag="MGF_tRNA07"
     tRNA            195039..195112
                     /locus_tag="MGF_RS00870"
                     /old_locus_tag="MGF_tRNA07"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195071..195073,aa:Cys,seq:gca)
     gene            195190..195266
                     /locus_tag="MGF_RS00875"
                     /old_locus_tag="MGF_tRNA08"
     tRNA            195190..195266
                     /locus_tag="MGF_RS00875"
                     /old_locus_tag="MGF_tRNA08"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195224..195226,aa:Pro,seq:tgg)
     gene            195272..195348
                     /locus_tag="MGF_RS00880"
                     /old_locus_tag="MGF_tRNA09"
     tRNA            195272..195348
                     /locus_tag="MGF_RS00880"
                     /old_locus_tag="MGF_tRNA09"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195306..195308,aa:Met,seq:cat)
     gene            195353..195428
                     /locus_tag="MGF_RS00885"
                     /old_locus_tag="MGF_tRNA10"
     tRNA            195353..195428
                     /locus_tag="MGF_RS00885"
                     /old_locus_tag="MGF_tRNA10"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195386..195388,aa:Met,seq:cat)
     gene            195522..195612
                     /locus_tag="MGF_RS00890"
                     /old_locus_tag="MGF_tRNA11"
     tRNA            195522..195612
                     /locus_tag="MGF_RS00890"
                     /old_locus_tag="MGF_tRNA11"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195556..195558,aa:Ser,seq:tga)
     gene            195678..195754
                     /locus_tag="MGF_RS00895"
                     /old_locus_tag="MGF_tRNA12"
     tRNA            195678..195754
                     /locus_tag="MGF_RS00895"
                     /old_locus_tag="MGF_tRNA12"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195712..195714,aa:Met,seq:cat)
     gene            195756..195829
                     /locus_tag="MGF_RS00900"
                     /old_locus_tag="MGF_tRNA13"
     tRNA            195756..195829
                     /locus_tag="MGF_RS00900"
                     /old_locus_tag="MGF_tRNA13"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195788..195790,aa:Asp,seq:gtc)
     gene            195831..195906
                     /locus_tag="MGF_RS00905"
                     /old_locus_tag="MGF_tRNA14"
     tRNA            195831..195906
                     /locus_tag="MGF_RS00905"
                     /old_locus_tag="MGF_tRNA14"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:195864..195866,aa:Phe,seq:gaa)
     gene            196025..196101
                     /locus_tag="MGF_RS00910"
                     /old_locus_tag="MGF_tRNA15"
     tRNA            196025..196101
                     /locus_tag="MGF_RS00910"
                     /old_locus_tag="MGF_tRNA15"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:196059..196061,aa:Arg,seq:gcg)
     gene            196527..198485
                     /locus_tag="MGF_RS00915"
                     /old_locus_tag="MGF_1168"
     CDS             196527..198485
                     /locus_tag="MGF_RS00915"
                     /old_locus_tag="MGF_1168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase S8"
                     /protein_id="WP_014574446.1"
                     /db_xref="GI:504387344"
                     /translation="MRIKNLISFISLGIITTAVPFSAILNNNKSKVDHSKDLPSNQNS
                     VLVNNNVEIAKQAKDVSEESFVESNNSLYDFENNDYYDGFITFNGNVSIYDKNSILEL
                     IKKQPQVLDAKKSLALDNYYLVNFFFRKGSNDKERFDSFLKKYDLIGDFYIIDENKND
                     KNDLENNAIFNRNHTINNSSEKYENKYNRNFSSNGYTDDERNKAIAFTRNQITYGREK
                     RIGVAVLEVGESYDMRKALIDANDSYYFNPKVTNVWNRFDPYVFAIFPIWPLHGQHAT
                     EVGSVISGTNGVNPYHDLYGIKVNTEDFHAINGLGAARSGLENEIAYIKGLNNVKVVN
                     NSWAKKVSWNNNPNLFKYNYYSRYLDLLTANENEMIYVFAAGNEGNNKNEKFRHLYAY
                     QLSYNSIIVGSNTNYGYRSSFTTLGSDTHSPFILANGSEYPFYKGTGYGTSFASPFVS
                     GVLANTLHQYREKYKLGINSIIAKAVLGVSSSDVSGYPNTNQAGLHRDYGVGLLDYKK
                     INSAFNNLNYIRWNHSSQVILNNRWTHKNGGDGSLIVKSVPLKKGDKLRIGLSWLFKP
                     SNSISYNNNNKENADLTTTIDFTDQDFNLYLKKDGKVIYFSKTKNNFEFIKYGVVEDG
                     NYEIVVSKYTQILPNYSDTQLALSWTVE"
     gene            198507..199961
                     /locus_tag="MGF_RS00920"
                     /old_locus_tag="MGF_1183"
     CDS             198507..199961
                     /locus_tag="MGF_RS00920"
                     /old_locus_tag="MGF_1183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574447.1"
                     /db_xref="GI:504387345"
                     /translation="MKKYLKIINVTRRQLSLFIAYLLTTIFASIGILTLMNQSVLNNG
                     YWYIIYDQTKFNISLILPLVFFILFFAITLVILLTGKERYWFEEKLLNKPKRVKVIFS
                     LAETIQLILWAFFLIILITYFYPINQSTDQIYQTKISTADFNNDQIHSGLLSFVKINN
                     NFFADLKVSIINYAAIVPYFYNKSALIFWNVVYLVSYLSLFLVYLKLSVFKQKQRVLA
                     LIPFIGLFSYLRSTNKLIQQPLFNQEEANLKWYQKILQSNKTVFQIKLTSTITYLSLV
                     YLFSILGFAIFAISTAFIDANGYQLRSTNDNNAYVIDLSSTASANEESWVRIIGTSLL
                     LIPIVTLIGFTIGILLDKSPYLLSQKVRRNKLILSLTLIIIEITQLLSLIVLLYFFIF
                     IPNILFVSSVSSAVVQVEARGIMLSKLDLFMIGISFMLVLYLSWFLIYVKAGIFSKES
                     RILALIPFSSLFFIKKKVVESQEKINGTYKSNIA"
     gene            200085..200161
                     /locus_tag="MGF_RS00925"
                     /old_locus_tag="MGF_tRNA16"
     tRNA            200085..200161
                     /locus_tag="MGF_RS00925"
                     /old_locus_tag="MGF_tRNA16"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:200119..200121,aa:Arg,seq:gcg)
     gene            200581..202086
                     /locus_tag="MGF_RS00930"
                     /old_locus_tag="MGF_1196"
     CDS             200581..202086
                     /locus_tag="MGF_RS00930"
                     /old_locus_tag="MGF_1196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574448.1"
                     /db_xref="GI:504387346"
                     /translation="MMDQKRYFKIINVSRRQLALFLVYLATILFATAGIVSVMSYALV
                     SPGGNNFTVYSEKLFKTSLVLPLIFFISFAISGLVILLTGKEGYRFSDQLLRQRFKFR
                     ILLTLIEIIQVVAWAFFLVILIGYFYPINKSLSQVYQDQLASLNFGNGSIKTGLLPYI
                     HINNNFFADLKLSILNYAATVPFFFNKDMFSFANIIYFALYIALFIPYLKLSLFKKEE
                     RILSLVPFSGLLISLRLFYSENGDETLLKHNDAGLRWYQKILLSNRTVFQIKLTSTVV
                     YLSFFFLIAVLAFLTTAITLIIRTNENGYTLILSEKFINAYSINFLAIPSSEEYLLRY
                     FRLSSFIIMMIIFIVFSMGIILDDNPYVFPKTIRKSKIGLSLSLIGIEIAQWSFLILF
                     WGFFVANAEPQLVDLRDGYRILPQRFPYPIRTNPDYTYLLYSSSDLFSTTNLFFLALY
                     FSWFLIYAKAGMFSKKTRLLMYIPFASLLFVKHHALNTETETKNSYKCQIL"
     gene            complement(202372..203187)
                     /locus_tag="MGF_RS00935"
                     /old_locus_tag="MGF_1206"
     CDS             complement(202372..203187)
                     /locus_tag="MGF_RS00935"
                     /old_locus_tag="MGF_1206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574449.1"
                     /db_xref="GI:504387347"
                     /translation="MNKNKIVSKLTGLASLGFGISFALTSCTVITNSGLFKVITAADV
                     SSKKAYSTITDELTSPIQTAIYGTNLINNGNYVLTVLTNTDPEQNYFINGGDLSTGAN
                     WNGPYARAVERWQQDRTNPNYDRGILFLLYWDLFDNQRAPSNQLNPFSRVTSGTGFAR
                     NDQSAVQYRDIVDFIIKTYPTETSGWLNRTDGTTKIMNIAFSNDGTGKITPHFYMGST
                     SASPTPATPSTASSVRQSLALKSASIDNSQPSNHDLTIDDSFSTFLAGIYTRN"
     gene            203247..204167
                     /locus_tag="MGF_RS00940"
                     /old_locus_tag="MGF_1207"
     CDS             203247..204167
                     /locus_tag="MGF_RS00940"
                     /old_locus_tag="MGF_1207"
                     /EC_number="2.5.1.75"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBU2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA dimethylallyltransferase"
                     /protein_id="WP_014574450.1"
                     /db_xref="GI:504387348"
                     /translation="MIYSKRLILVVGPTGTKKSYLANMLAKKLNVPIISADAYQVYKE
                     LNAGVNKPSEKTLSEIKYHFISNISIFDEWSIAHFNKRAKEILEQAPDWTIVCGGSHL
                     YVNSLINDYQLEKQELDNELFDALDKLDNQEIFNQLCEYDCQEAIKIGKNNRKRLLRA
                     LYLFKKYGKKARNDSKKFDYVVVKCMSDKEKLFPYLSKRLDEMIHDLNWTKEIEYLDK
                     IITDKKLDKELIAMKALGYKEIYDAWKNNQPIDKEIINKKLKRLAKHQLTWTRNKFND
                     GMKQFTFNFFEDDANKTCDEIIQYIKSSHD"
     gene            204160..205206
                     /locus_tag="MGF_RS00945"
                     /old_locus_tag="MGF_1214"
     CDS             204160..205206
                     /locus_tag="MGF_RS00945"
                     /old_locus_tag="MGF_1214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_014574451.1"
                     /db_xref="GI:504387349"
                     /translation="MTKHLYIHLPLCQKICTFCDFKRELIDRHNPKKVVQDLVDEIER
                     KQFSDEQFSSIYLGGGTPNVFDDELLDYFLSKIKKYAAKTCEFTIECNPDLVTKSQAQ
                     ILKKNLVNRASVGIQIVNNKILKYLNRTHDINHCYEAMQNLYDAGITNINIDLMYALP
                     HMKKEDVLENIKFIKKTKPNHISFYGLDLKPGAYLTKTPYKIDLDQEAMQLRVMKAEL
                     NKINYKRYEVANWCRLKKYQSVHNKAYWLTKDYAAIGWGAHGFENKVEYYYDGSIQNW
                     QIKKNRLTDEQFYQRVLIMGLRLKDGVDITKEPYKTAYEKYQNKLKFVTVKNNHLRAD
                     NIDLLNNSIIDILE"
     gene            205314..208265
                     /locus_tag="MGF_RS00950"
                     /old_locus_tag="MGF_1220"
     CDS             205314..208265
                     /locus_tag="MGF_RS00950"
                     /old_locus_tag="MGF_1220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="chromosome segregation ATPase"
                     /protein_id="WP_014574452.1"
                     /db_xref="GI:504387350"
                     /translation="MLFLKKFHAQGFKSYADNISFTFDEHVTGIVGPNGSGKSNVVDA
                     LKWVLGERSMKNLRGKTSDDVIFFGSQEKPASKFAEVSLTFDNSQGYLHDKRKEITVT
                     RRVYRGSGVSEYLINNEPSSLKEINDIFLDSGLTKGSLCIISQNTVSSFIEAKPEDRR
                     QIFEDAAGIGRYAKKKQDAIRQIARTNDNLKEITTIVNELNRDLKKLNQQAEKAILYA
                     ETKEKLKDLEITLSVNEYLISQKEIEALSEQIAEIDERLLKNDPQLQINQEKLEAFKK
                     RYNSADQNVQKIQDELQKIYHEIVLLEKRNVFNDLQLKSDLDSNDKNKKINALEQLLK
                     SSEEQLKKYFELISTWEEELKEKDVDKTDLANELENLKKSLATFQVKRYEANLQVQFY
                     QNQKINQFAQDAGVRTVLNNKDAIGGVHGIVQDFIKVEPEYELAISTALNKAAKNIIV
                     DSNQDAINAVNFLKANKAGRATFLPLANLKDRDVKPEHLEVLEQVEGYLGIAANLVNY
                     HDQYDPAIRALLGQIIIASDLEAATKISKFTYQLYRVISLGGDIVNAGGAITGGAESK
                     QTHSLFNLDEKIDTLKNELLVAEKNINELNKKLEFLTADYTKKDKEFNEQKIAIQRYQ
                     DLIVIEQKKLDDYKIQYEQLTDKTFDGKDVKWDDKKIKDKLFSLETKKATLVQDLKIN
                     QEAKDMYQKQVNQLEKDVTLFYKEIDEDKNDKLKRREQLTKHENTIYLAKSKINESYN
                     MAIEFAIENYNKPLPISLSQARSEVVKLQSTLNNLGAINMEAIQELDIKKERYEKLYS
                     QQQELINARERINQAIIRLDEKAIFEFDQLINNLNKELPKTFYYLFGGGNCEIRYSNP
                     EEKLTSGIEVFASPPGKNIGNLNLLSGGEKALVALSVLFSILKVSSFPLVVLDEAESA
                     LDLANVERFANIIKNSSDQTQFLIITHREGTMVKCDKLIGATMQTKGVTKMLSVSLHQ
                     AKDMAEEIESQ"
     gene            208265..209311
                     /locus_tag="MGF_RS00955"
                     /old_locus_tag="MGF_1235"
     CDS             208265..209311
                     /locus_tag="MGF_RS00955"
                     /old_locus_tag="MGF_1235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein FtsY"
                     /protein_id="WP_014574453.1"
                     /db_xref="GI:504387351"
                     /translation="MSFIKRLFSKFKKKPDTVEEIKKKNQENSLFETTQEKFDDGLKK
                     SSNSFSDIINQLSTKYVSLNEAFYEDLFDAFVQLDIGYNATKKIVDAIVEEIKYQKVV
                     DPTLIKQIIIDKLFVYYIQDSEVNIDLNYQDHRQNVFLVVGVNGVGKTTSIAKLANYY
                     KKLNKKVLLIAADTFRAGAIQQLNIWAERLEVDIYKDESKKDPAAVIYEGLNFAKQRD
                     YDLVICDTSGRLQNKVNLMNELKKINNVIEKFIGRNVDETLLVLDATTGQSGLIQAKV
                     FHEVSKITGIILSKMDSSSKGGIILGIKDLFNIPVKLIGLGEQLDDLVSFDLQKYLIS
                     LTANLNLDYEKTSN"
     gene            209286..209612
                     /locus_tag="MGF_RS00960"
                     /old_locus_tag="MGF_1239"
     CDS             209286..209612
                     /locus_tag="MGF_RS00960"
                     /old_locus_tag="MGF_1239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113404.1"
                     /db_xref="GI:499425940"
                     /translation="MIMKKQVISFEQWNLLNELFSYYHKLLSDKIKLYLEEFLINNLS
                     YNEIATNYQISKYAVYDQIQKGIEQLKNYEQLLLLNQLSKQRLKLYEQISDPNLKQAL
                     LILEQK"
     gene            209675..210295
                     /locus_tag="MGF_RS00965"
                     /old_locus_tag="MGF_1242"
     CDS             209675..210295
                     /locus_tag="MGF_RS00965"
                     /old_locus_tag="MGF_1242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113405.1"
                     /db_xref="GI:499425941"
                     /translation="MSSKLKLIKPIDYSKEIKITQFFIDPAMMEQQRQRIKAALPKEM
                     NDETMMQYELLQLSIKDNVFSAIMNYLAEHFEFEIDQAEVKKLIEQLKASGLGAQREE
                     LLANMADKIIKKGLMFDYLSEQWKVKVSDNEVKNMLDIYYEKTNQSIHDVLNDRQKFE
                     SVRSSIFEEKMVLKTISMFLIRFNMQNPNYVEESETDKSSESKSVN"
     gene            210295..210579
                     /locus_tag="MGF_RS00970"
                     /old_locus_tag="MGF_1250"
     CDS             210295..210579
                     /locus_tag="MGF_RS00970"
                     /old_locus_tag="MGF_1250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883924.1"
                     /db_xref="GI:500213751"
                     /translation="MLNTVLLEGLIDSYKWSKNKTGFYVTITQKRKFGNQTFTDYYVI
                     YANDQLGLELEKYVLEHEYLAIKGSLTTYQDKKSKVWKTQILAEKILVRK"
     gene            210592..212313
                     /locus_tag="MGF_RS00975"
                     /old_locus_tag="MGF_1252"
     CDS             210592..212313
                     /locus_tag="MGF_RS00975"
                     /old_locus_tag="MGF_1252"
                     /EC_number="6.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_014574454.1"
                     /db_xref="GI:504387352"
                     /translation="MLNYFNTALLMVQMILKKQDPSIKFGQMSVNDQGFYLDYLSQTL
                     NINPEDFNKLIKSLAKLCSSAQPISLKTVDLKIANQLLSDQPYLLELINEAKEKTVNL
                     ATVDNHHYYLPMAQLVDNTKLVKAFNFQSVGGAYFKGDKDNLVMVRLNGFGFENDKVM
                     QDYLEIIEEQKQRDHRRINKILELFTFNQLAGPGMPIWLPNGQIVRQLIGDYVHSVQK
                     KFGFMAVNTPILGNVDLYKKSGHYNHYAKDMFPELALLDGDKMMLRPMTCPHHCLVYL
                     NKPRNYYDLPMRLSEDALLHRYEASGGLTGLERVRAMTLLDNHIFCRLDQIKTEILNA
                     YQVIKEVIGTFNLKFHRIDLSLHDPNDKQSFIDNEQMWARSENQLEDALKDLGLEYTK
                     QVGEAAFYGPKIDFQVKTALNKIITVSTIQLDFSLPSEEKFDIKYKTKDNTYEQGVII
                     HLGIIGTYERFVATLLEQTKGALDLWLAPKQAVIIPVNNSVHLEGCNQLLEKLLAKDL
                     RVTVDSRDERLNKKIRDHQVNKIPVQIIVGDNELKNPDLITYRLYGQEDSNQLELTKF
                     IELFKKP"
     gene            212326..213150
                     /locus_tag="MGF_RS00980"
                     /old_locus_tag="MGF_1257"
     CDS             212326..213150
                     /locus_tag="MGF_RS00980"
                     /old_locus_tag="MGF_1257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883928.1"
                     /db_xref="GI:500213755"
                     /translation="MGKNKLLIIDVDQHLVYDQGYDIDQLTKTIQELKAHFEILISSS
                     SWFENIINFNNLIKLGLNDISYLAANGACLRKKSDRKFYYESFFKKNDYDLINHLALI
                     KQSGILLKGASSIDSYDNLLATYFLNYNTIKQARMRWKDQIYWNNDYKSFNQAIQKML
                     INQIYLFNIKEWINSSDFNQTILNHDRFNFIQLNETDGLFINKEVNKFATIKKHFPNT
                     FLIYLSLHNQIDPKANERFDYLVVPDNVNEAVLQSAHFVFKPNELNLLIDNLKSII"
     gene            213265..216465
                     /locus_tag="MGF_RS00985"
                     /old_locus_tag="MGF_1260"
     CDS             213265..216465
                     /locus_tag="MGF_RS00985"
                     /old_locus_tag="MGF_1260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence-associated protein Hlp3"
                     /protein_id="WP_014574455.1"
                     /db_xref="GI:504387353"
                     /translation="MIMNPKIHNKILKNLAKLKKKAFTKYAAYDFNFAYDKNGNVYLV
                     GVDNVTNQTFNLIKPVFKFLKKPLPAELYGMDQQPFYFVNNHHYIDALNSDTGEQELL
                     RYNVIDQSLVNAQTNDLVDPAFYTDLEGYELDLSQYTGSLLDLSNEVIPVEQQPVEQE
                     EVNLTPEQVEEAEQVEQQPVDQQQVQQVDPNLNEQPVEGDNQNFTQQYYDQQLGYADQ
                     NVDYGYDPQQYTQEQDYVDNTQQYDQVQDYVDPNQQYYDDQQQYDQQGYDQGYDQQYD
                     QQGYDQQGYDQGYDQQQYDEQPTQQVEAVVEQIEPVVDEVVEEQQPVEVAKPAPTKPV
                     RPRPQPGKKATKYAIKKPEPKPEVVKEEPIEPVVEKEEVVAVVEQVVDQPVEVKKEEP
                     IPAPVVVADDEIKLASEQPVKKKINLDDLQQIPVVIKLPKFETPKLPEPKADSEQKEE
                     VAVKVVEQPVENPQVQETKDHHALPKVKIEKRQEVELVPSKLDDHYDLIEEENDDFFV
                     DKFKFEDVKLSDLLVEQKPIEVNQPVQQPVVLEQSTPPVQAQPQVVEPKLEITKLEEL
                     VEIKTDNTESLNKLETLIDENKKIIDQFKQLKEEAKKSNSNINLEKVAKQLVDYLTNK
                     LNEKTAALNKPEPSTPELNKVEQAKQKAVEQLVYEQVVSQPREKVVQQPKEVVAKPYF
                     EESDDLLRSVSNKPKQPTSELLDFLVQQVVDGEEDDLPPPTNFDKRPNQNVRQKLDEI
                     NQVETQGFNQTQFVPPQSLNQVETPNQRLFLEPEIQVQPQALYTASREHEQVQPKAQH
                     QQPTTRIEREEVVNKLQREPLVPPARVAYHSNREFDDLYQNHYEQRTARINPQDPYYD
                     QGYEQPDPYQEQYLDQGYQQQVDPRYQQEAYQEYNRPLPPNQEYGYYPPAYESRRDYQ
                     PYEPRRANYEVRKPLAYEFSKQPAPRRYQQLPNRYNEFDQSRQLAYPVHKGTLRTEAD
                     FLRFREGYGYDYDRPSTQYYRSNYDTYVREVRRPIRQLGMIEPVAEFRSRALAPRRVT
                     RPTYGLRRVSRISSLAPRGYNQQPRVRRVPVSRGYW"
     gene            216465..217274
                     /locus_tag="MGF_RS00990"
                     /old_locus_tag="MGF_1278"
     CDS             216465..217274
                     /locus_tag="MGF_RS00990"
                     /old_locus_tag="MGF_1278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="choline kinase"
                     /protein_id="WP_041594401.1"
                     /db_xref="GI:753838784"
                     /translation="MDRSKNHALDFFIKHTNYSPNQVSRIEPIHNGFTNLSYLIETSD
                     QQKYQIRFALNNELVNRVNEYQVITLLKNDLFIYFDQETGDCIKKWIVGQEVDYFDQT
                     RLKNLAKAIKKLHQVPLGNCSILPIDYYKGIENAKLATRHKRLYLSLINKYRDLPKHL
                     THSDLNAHNILVDEYNQIHLIDFEWSRINNAYFDLANMARESLSLEQAYYLVDCYGGL
                     DLKIFNEFLIISCLFALIWTYNMQQTDKIIAYRKGVEKRLAYYLESFVVNL"
     gene            217342..218259
                     /locus_tag="MGF_RS00995"
                     /old_locus_tag="MGF_1284"
     CDS             217342..218259
                     /locus_tag="MGF_RS00995"
                     /old_locus_tag="MGF_1284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadhesin protein MGC2"
                     /protein_id="WP_014574457.1"
                     /db_xref="GI:504387355"
                     /translation="MFSLKKLKSKLVGVSFVFSGAISLGTGIGLTSEHKYEHSPTLVL
                     HEGETNSVGPRKITSEPWFYPVVGAGAGLIVVSLLLGLGIGIPIAKKKERMMIQEREE
                     HQKMVESLGIIEQQNKTEAIESTTAVPTEEVNVQEPTQPADVNVVNNPQMGINQPGFN
                     QPQINPQFGLNPQQRINPQGFGGPMPPNHMGMRPGFNQMPPQMGGMPPNHMGMRPGFN
                     QMPPNQMGGMPPRPNFPNQMPNMNQPRPGFRPQPGGGVSMGNKAGGGFNHPGAPMGPN
                     RMNFPHQGMNQPPHMAGPRAGFPPQNGPR"
     gene            218419..221778
                     /locus_tag="MGF_RS01000"
                     /old_locus_tag="MGF_1292"
     CDS             218419..221778
                     /locus_tag="MGF_RS01000"
                     /old_locus_tag="MGF_1292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="adhesin"
                     /protein_id="WP_014574458.1"
                     /db_xref="GI:504387356"
                     /translation="MKKLIFKFSVGITPFALIGLGSFGLAVSGAKPNNLKPVNQVGEM
                     NSQDQSNLLEKARRWRNSNFTSLSIDGTNPGALVLTGSKSISRIDLYGNVIWTFDPGN
                     TKDLTGKVGFYDASNRLTAFSGNVPFDLSDLSSKTVVEATQDQEDPNVFYLLLIPDAA
                     VQQEQKTKDQVFENYFMSDAPATGDTSAQAGGDASSSGGAGTGVGAAVPAGTPAAASS
                     TARLVEENSTDMRTTNPATSETVIEYNSDQNKIPKPKALLDSNESSDTINSGKSYSSI
                     NAQKNLQGVIVKVNENLFNSENPFAVENMAFIKPKDMVDNYPSTWTQGSANGKMSNVL
                     QFYQHNNPNVVENSLFRAKYFPRRLETKTDTPLIDSSFSPHEHPEWYENNQFVMPWMQ
                     YITNLGGLYAKDGMVYLFGGNGTWVNNESALSIGVFRTKFENRTAEAPGNTKTVGYPY
                     GILLSAISFDVTGNRLVPGTASLGQDVGYHFVPRLAVGGVSSPRGANGNIFLGSAITW
                     GTNGGNFLDTKWHSPTVIQNAPTTFVTVNSSGALQNIGTPQQTSTPMPNDNGNESIPY
                     RWTNSYDYNSVRFAALISKPAGGNTKQVESLFTTALKLDTLNSLPDQFTPQNNIFFSY
                     AMLDGHQWSLGTRKDSTWLTTNTINNFTYNTQQQLATSAGENANPRNILNALTTAKGF
                     DRRNIGNVVYTKSNNTNNFTYYYQVGGAITTWPEVQVNYKTSANITYYNLTSTDFGRV
                     RPETQTTTISSKLNGAYLSSTGDKEGWYNGSIYVKQANFTPSSQGYTWQDFKGLTTTA
                     SNAVISNWTKAGYSIRPDDDTVFSVSKIPFEKEITAAVNVKSLDSYYVQLNGETSVNT
                     VARVSPDSSALALNPNRVTNPLMNRDNVIGQGAFISRNDIPSSFFENKINDIVATEAD
                     GTEILDSKYINSIYRYTPPQNNPDIRLRLLVIDRSRATNDFIKLLPQVLVDGEYVPVP
                     QANSVFVSDQEFTGFNALPGYVLPVAISIPIIVIALALALGLGIGIPMSQNRKMLKQG
                     FAISNKKVDILTTAVGSVFKQIINRTSVTNIKKTPQMLQANKKDGASSPSKPSAPAAK
                     KPAGPSKPSAPGAKPTAPAKPKAPAPTKKIE"
     gene            221800..224976
                     /locus_tag="MGF_RS01005"
                     /old_locus_tag="MGF_1316"
     CDS             221800..224976
                     /locus_tag="MGF_RS01005"
                     /old_locus_tag="MGF_1316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule A (CrmA)"
                     /protein_id="WP_014574459.1"
                     /db_xref="GI:504387357"
                     /translation="MNISKKLKSYTLIGGLAVLGTLGSASFGFKQSDKSNDNTQLVNQ
                     ARTLDANSVKLAGLGQNGSLFNTVLRDVDDNFITAASGTIIKLDSFTKPLYGLDLSDD
                     FAGYKVKQIVSDYTTSRNRFDQRQTRAYYALLVNDDAIVHLKRINTNQNRIGNLNNNS
                     KFVIGGVDNPAHVIRFTDDGTKFNFTKQTQGEIVNDFILDAPILPKDLHPDWYNLYIQ
                     RKILPNDVNTAVVPWPVGRVSGTNATDGTFDFGNGVASSTNPIEQTKTTTNNQMSMTF
                     DSSAMPSANNRYDSELNVKHRIKTSFGLDEKFVYPEWTGQEENANLTRLTNRPSGNNY
                     WILNIPGTPNVTLKEDTVNVFSRLYLNSVNSLSFIGDSIYIFGTSELPSLWYYAFPTR
                     LSDLTALNQVKSADAEASSTDTGTTTNGTTTTTGGTGSAPSAGTGTTTNTPTVTNPIL
                     STYRSFGIDSKPTSVNKIDETNWGDPNVIEARIYSEYRLGIQNEIPLVNAGNFIQNTI
                     GGVGFTSSGSRVVLRASYNSDQRPTGNFQPFLYVFGYLGYQQTRADTFWYGRYKLLNN
                     SPYDVLDAARVGTETNRSQRNSLTYPVMGGYLTEEGARSFSNISYIREASDTPQSRSI
                     FQSGYSDNTYEYIQSALGFDGIRNNLNVGVKASSFLNSNRPNPNGLEMIAATTYLRSQ
                     IGLARTSGLPNQQPFGTTHEVISVTPRDQFSSIKNIRTIIPGKQLWYFLFTNENNKSS
                     VYTLRLADSSNPDASSSFSPTRLIDVNEIGVILPLLDNSFYTVNAAGNVALFSSNPGS
                     PGSYTAVNTFNQNLSDIAFEGSGAKYTSDFWGTIQFKPDEYLIQNGFTSQVARNFVTN
                     QSFLNSLVDFTPANAGTNYRVVVDPDGNLTNQNLPLKVQIQYLDGKYYDAKLKNDNLV
                     TFSYNNFAALPSWVVPTAIGSTLGILAIMIILGLAIGIPLRAQRKLQDKGFKTTFKKV
                     DTLTAAVGSVYKKIITQTANVKKKPAALGAGKSGDKKPAAAKPDAPAKPSAPKASSPA
                     KPTAPKSGAPTKPTAPKPAAPKPTAPKE"
     gene            225132..227897
                     /locus_tag="MGF_RS01010"
                     /old_locus_tag="MGF_1336"
     CDS             225132..227897
                     /locus_tag="MGF_RS01010"
                     /old_locus_tag="MGF_1336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule B (CrmB)"
                     /protein_id="WP_014574460.1"
                     /db_xref="GI:504387358"
                     /translation="MLKAHIKRSLILFIILIVAAISLIFIGLFGFKKPNINQVKLNNQ
                     SSSLITNQPSDQIIRRYSLNSIRWNANANFSSSPTKDGGLLVITADGRLERIDSFGYL
                     KWELNLRNINALASVDEKQNLVYSDNRIVTKPLDPVFINSVSKKVVAEAIQSQEDPTI
                     YYLLAVSDQILTNDVKDQLLSFQQLATDLTSQGVVLKIKEEPTQINDPVGIIDYATIS
                     PTDLTQNYPTSWKTNTLSLYGDNGSFRKADHPSWFNNDSNFISLPWLQYITNLANLYE
                     YKDNVFLFGGNGNWVNDDQSGRQQATKYLSIGVFRIRFHKNLSTRPTVTGYPYAHLLS
                     SLTSNDPDTQKLLLGQNTNYTLVPRIAVGGVKQGLGENKNSVFLFGSITTGLNNTDNP
                     NQVVLDSANYTNEELANLNTLSSVPLSAKNALKNSVGPRALIGLFFNLDDLISLPDQI
                     VQANISSTYYLNQNSYPFRLIAPWTTTLAQPDIDALNVASENKSITGTLYNLTIRHGF
                     KENDLGGLIQLDDSSYGVAVGPYILRIYLPSLSRSISNKPNWLYRLSNIDFINYDINS
                     PINFNPIFEFKDFRGIGVIHSNKSYLFSLFAPSSLITTTPKLYYSAFGDQINRNANFN
                     VLTIPKTNGILQFNNRDGLALQNNDFSFHLYSVNNDDLQDNGIINPVVQRVKFLGSGN
                     FNQPNRLDLIGTSLNDLFELQDNETILKPDRIKAIYNYFPVNNNQDYQLKLKVINLDY
                     DQGTFRLVPYVFSKVTNDYQIIPDHNDGLTTNNSFLNFKRSIGIDDIYLYVGIGVPVL
                     ILLVSIGLMTLVGMALVRERKRLIRSFRTNNLKIDGLVLSIGSVFKSLIHSSKRFKRL
                     LSNDKNEKEQKQMMQKILNKTASINDKQSTNYSNQSFNQDDQSRVNFSNLREYKAKTK
                     MISEDEY"
     gene            227904..230465
                     /locus_tag="MGF_RS01015"
                     /old_locus_tag="MGF_1351"
     CDS             227904..230465
                     /locus_tag="MGF_RS01015"
                     /old_locus_tag="MGF_1351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule C (CrmC)"
                     /protein_id="WP_014574461.1"
                     /db_xref="GI:504387359"
                     /translation="MIKKQLRQVQINSLVKIVISLILSLFLFLGFTQTFNHSSRSDKL
                     VNQAQLVADNNQDYQQLKTEQNHYVTNSNNDYFVLTKTGVVKLDVFGNVYYNYSFATN
                     FINYQTVDFVADSLRADYYYLLIKNPIVSINGNDLNSLSVSSPAYVLQLKDENNTLNV
                     LKTFQLSSYRFSRDIATLYNRIGFESSSSSSNLSGLLDKPTNSTLLNNISAYYDHAIS
                     KLVFINNRLGVFGSNNQLSLWFYLFNINQTNDFSTNNDLNLVTIFPQLYGTTNLNWAL
                     NNISNVNQATTAQFVINNIRLYTPAYFVIGANVVKQNLVNPNGLLNAQQTAIYSLHLG
                     LVPAPISAITNNNQFGYKISANYYNSDNLNYSNLFVSGMISQTKVAQITNNLNLFNEF
                     FSASHTTRLNLSKINSKTQTAYHYSVQEDRSNQTNNSYPNLIGILIIKDEMMGFLYSA
                     DSYNLLSQINYHLISDDISMAGFDLLTTMALKDGKWHLSFFDPRQSISWINQISPTIS
                     QLNNGTLAINYTKLYQANQQGSIFLTLILGEQAFYTLVTQNNRVDLNLIFYDQKTQSF
                     SDATFFNNGVPSFDNIPNSDGSKLWGMISFKPSSYLVNQDLNTTSAMRLSNNNLLLNN
                     LYDYTPGEIDWKPRVEAIALNDSTLRLSIQFPYFDGNYYSPNQKLVNLAFPSIIYDNL
                     NAYPVYVVPTIVISAIVVFILVVAFIFLIVLQILKTKKVSLDLFRNANRKVDKLNDSV
                     NIIYEKIETKLYSPQSEPKKLVNNQTRQINPPFNNQTVQINPTNRFNPNQQPRRYYPQ
                     HPNQTRTYPYQQTTFMPPHQRPGFNQPRKVNPRPQANSEPTAQFGFYDRTKQPNQ"
     gene            230544..231803
                     /locus_tag="MGF_RS01020"
                     /old_locus_tag="MGF_1368"
     CDS             230544..231803
                     /locus_tag="MGF_RS01020"
                     /old_locus_tag="MGF_1368"
                     /EC_number="6.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_014574462.1"
                     /db_xref="GI:504387360"
                     /translation="MSNKQITAVRGTTDWFDQAMILFNAISHKIIALSDLYTYQRIKT
                     PVFEHAELFSRNLEHSDIVKKELYQLIDRSERKLALRPEGTASIIRAVNEHKLLDQNP
                     WPLKLYYLEPMFRYERPQKGRMREFYQYGIELVGELDQLDYLQTILFAKKILDIFNFD
                     CVLNINWLGNFASRKRWVEQLNQYFKQYQDQLSELSVSRLDSYGVLRILDDKNESKKD
                     FVRSAPTIDQFISLEEQTQFKQLLEQLDQLGIKYVYNSSLVRGLDYYSELVFEFILAN
                     NDQAQSTLIGGGCYQNLIAELTNKPLKAIGFALSIERFISYLDDKTKDSLINQDQKPR
                     YLLINLVPNKELATLNLSQELINHNYQVYYQHKLNKVDKAIKYALRAKFTHLIIMGND
                     EWSKQTMTIKDLASQTQQTIKYKEFIK"
     gene            231813..233561
                     /locus_tag="MGF_RS01025"
                     /old_locus_tag="MGF_1373"
     CDS             231813..233561
                     /locus_tag="MGF_RS01025"
                     /old_locus_tag="MGF_1373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="WP_014574463.1"
                     /db_xref="GI:504387361"
                     /translation="MLKPLDFTNRKPIIELKQAQLLNQDVEIVGWVKNVRKLGNFNFI
                     EVADKSALIQVFDQKNQYANLSREDLVFIKGKLQLKKVANPNLELGDRELLINQLTLI
                     SKSKTPPFLIEDNTDALEEVRLKYRYLDLRRPVLQKNMKLRSDFFLIVRNFLTSQGFI
                     EIETPILSKTTPEGARDYVVPSRLGPNMFYALPQSAQIYKQLLMISGFERYFQISRCF
                     RDEDLRKDRQPEHVQIDMEVSFMSKEQFFKLVEAMFIHIFDRLMNVKIEPNFMRMSYD
                     EAMNRFGTDKPDLRFGCELVDVSAVFVDHEFSVFKQFALKNRLKAIVLDEILISYKEH
                     KVMEKYAKDNYAKGLSWFSYDQNQIIDGSIKRFISSDDLKNLGLLNKKGTIFFVGDDD
                     LNVINKSLGAVRIQLNELYQLANEDEYKFLWIVDWPLYEWDDKTNSYQSAHNLFTAPE
                     AKYLSTFNEDKANAKAASYDLVLNGFELGSGAIRITDPSLQKAVMSSLGLSEAEMNDK
                     FGFLLDAYQYGAPQHCGIGLGSDRLLMILTKSKSIRDVIAFPKNNQGFDLMNNSPSEA
                     INQQFLDELYLAIKEK"
     gene            233575..235743
                     /locus_tag="MGF_RS01030"
                     /old_locus_tag="MGF_1389"
     CDS             233575..235743
                     /locus_tag="MGF_RS01030"
                     /old_locus_tag="MGF_1389"
                     /EC_number="3.1.7.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="guanosine polyphosphate pyrophosphohydrolase"
                     /protein_id="WP_014574464.1"
                     /db_xref="GI:504387362"
                     /translation="MDFQSVNNRLEDFKQILIKNNYSEASIKKFLSAFEFAKFWHADQ
                     KRKSGEPYIIHPLETSIKLAEWRMDDDTIIAGLLHDLLEDTSVDKRLISSTFNNNVLD
                     LVKAVTKISSEAKKNREGLLLHKNELDYTIRVFSSISKDLRPIIIKIADRFHNLSTIQ
                     YLKSDRQKIIAQETFDIYAQIAGRLGMYWIKTQLLDITFKIINPTAFDDTQSLINAHK
                     LINSLKWINFEQQIKKILDGNHLNYELTSRIKSVYSTYQKLNYRHNSQNIKNIHDIYA
                     LRIIVENEFDVYQVLGLVHLNFKYIPRLFKDYICAPKNNLYQSIHTTVLVDGTLIEVQ
                     IRTKSMDRNSNLGLASHWAYKLNIDISETDEYKTEVLNRFQVDIFNEKRARDLTLIKD
                     LTKGSLIDVLVSNNNKNYSLSSSVTALELAYRVDPKQFIFLDKIMCSNDNILFDKLLE
                     DGDVVSFEYSNEIKINESWLKRIKNPAIKKELIAIIEQLNQYEDSEKEFLEKLRKHLK
                     KNVISQNDILERVKILGFKRLSDYVKYVNKTNFTDNEQYDFFSKNYNWKKILKKLKVH
                     KPKWLFLNSYFKEIPGINFASIKISTCCSILPYIPSAGLIQKNILNVHSPNCKNIKKL
                     NNEKIIALHWSEEKLAARPRLFRSYVKLQGAWSGNVVNDILLIIINNNAKLFSLNVTK
                     DKKNNTFMADLGIYVQDMRHLNFIMDEITLKDMSFNWNLL"
     gene            235751..237373
                     /locus_tag="MGF_RS01035"
                     /old_locus_tag="MGF_1401"
     CDS             235751..237373
                     /locus_tag="MGF_RS01035"
                     /old_locus_tag="MGF_1401"
                     /EC_number="6.3.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CTP synthase"
                     /protein_id="WP_014574465.1"
                     /db_xref="GI:504387363"
                     /translation="MTSKKTKYIFVSGGVYSSVGKGLIVASIASIFKHQNFKINILKL
                     DPYLNVDSGTMSPYEHGEVFVTSDGTETDLDLGYYERFLVQDLNERSSITSGKVYFSV
                     INKERKGEYLGKTVQLIPHVTNEIKRRIALAATDENNQSYDLVFCEIGGTIGDLESLP
                     FIEAIKQIIRENNKHDTAFIHVVPIISLSNSEQKTKPLQHSLKELNNLGINPDFLVIR
                     SKESLDLKTKHKIASATYLNKDHIFNSVDLNNTYFLPDYLNQQKIHEKIANKLQITID
                     PKIKLSAWDDLAKKINNQDNLVRKIAIIGKYTQFKDAYLSLIESLNLAGYHNHVKLEI
                     DWIESSLYDDASLEEVNHKLKDVHGIIVPGGFGSRGVEGKIKFIQVARTKKIPFLGIC
                     LGMQLACVEYARNVLGMTDANSSEFNSQTTYPIFKIMNPDDLNYGGSLRLGDYLVSLK
                     DQTLTKAIYQQDSIKRRHRHRYEFNNDYLNQFNDGEFIVSGIYLQENLVETIELKNHP
                     FFIGCQYHPEFSSKITAAEALFDSLVKKIKML"
     gene            237384..240314
                     /locus_tag="MGF_RS01040"
                     /old_locus_tag="MGF_1410"
     CDS             237384..240314
                     /locus_tag="MGF_RS01040"
                     /old_locus_tag="MGF_1410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574466.1"
                     /db_xref="GI:504387364"
                     /translation="MKVSFDYLLKSFIIFVLMVLSIVGITFGSIKTAELTPKGRFYNG
                     DINTTIYFSPYELKTDENQNNGVQLNQTFDFSQPRNAEQTELIPQQAWTNLANSYSQK
                     LFALGFSEINVAFNDNIPLPANNQVDRSWLNSNNTLPALVISVNKTLEKTPNERERIF
                     DERLKRTIQTTLNNQYNLTLETTDGYVLLDNNEIIKDSIRVIQPSASSTNSGLSFEVK
                     LKNNQKFSSNSDNSNQVLDYFVNLIPKSSDYFTSNGQGSVEDIRNRLFVSNNTTDVLG
                     NRNLVLWNDKLGALNYVRNIFNVVQNSNQWFALNNTEQALWNFLHATGGYEPSANVKN
                     LVAPFKSAQDIQLNDLYYIYAEPKAYVAAAADAKDKPEEITTPQGSRNPRSSTPTDFS
                     GLFSPFILYELRTTNVDGSESQLLNSLFPTNITINNNGDAVLSLTQRLNSSATYMNFD
                     YNQANSLATLIRESSPNNTFYVVDNSSTINQPLVNKTFINLSQYQSGFLAVGIILLFL
                     SLIMIVGFKVQGFFGIFGLILSAVITFLIYSRFNAFVDLFSFIGLIGVIIFNFLVQLF
                     INLNFKRNVSNKISLLESWRSTHNKTFLKVVDLYLILLVIGLFMSFISKYESQSIGIL
                     LIISSLIGFFINYGLSVLLVKIFNSINNFSPKFYLYKHTYKNLESISGNLSKDAMAFN
                     DLVITIDEQVDKTFSKNYKYQIMDKRSLVALLLFVGLIILGGFALSNFINRSFFINSD
                     SLYDSLNTILIALGSTTLIGLAYFLLRYQWIVIIGYLFYGLVNFGIILGVLFLSRNIV
                     SSEFGYLFLLISLFSYIYSLANFVFVTTNLYSYFNLQEIYQPQSVKKIVNNTAVATID
                     LYLYSTIISTAVYFIFYGLNYGGGGLNLNDEFNQQLVYFGVFSLFNVSLININAIFLL
                     NPLIGLLMIKKSNTNSIYWSKVSLKTKQEEKNFDLIDEQLLEGINLHKRSSRVVYQEP
                     KADN"
     gene            240318..240854
                     /locus_tag="MGF_RS01045"
                     /old_locus_tag="MGF_1430"
     CDS             240318..240854
                     /locus_tag="MGF_RS01045"
                     /old_locus_tag="MGF_1430"
                     /EC_number="2.4.2.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_014574467.1"
                     /db_xref="GI:504387365"
                     /translation="MKTELIAQLKKTIITVKDFPKPGILFYDITPILLDPKLFDQVIS
                     VMAEVAKKSNADMIASPESRGFLFGVPLANKLKLPFVLVRKQNKLPRATFSASYDLEY
                     GKNNVIEIHQDAIKPNSKVMIVDDLLATAGTVDAISRLVKQAKSEVVSYSFLIRLKDL
                     GGIDKLDQTKAIDYILEY"
     gene            240938..241720
                     /locus_tag="MGF_RS01050"
                     /old_locus_tag="MGF_1435"
     CDS             240938..241720
                     /locus_tag="MGF_RS01050"
                     /old_locus_tag="MGF_1435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574468.1"
                     /db_xref="GI:504387366"
                     /translation="MLNRQFIPNSFLQQEVSFVKKAFLKSHLYAGIAFLLSFFAALII
                     TTIAQRTGLTNSLGFLIASSVSLTVGFLIVIISSFWLNVYRSMRTLVSIYLFSWVFLT
                     FGLSGVLLSVDNYNIRELEGIDLTQINTALLIVGLVYIVTSFLGYKMSNKAGFRLAKF
                     LFVLFIVSSIIILVVNIVFIFGINQGVFSLYFLLITILSLVFSVLALILSSFMTRKVA
                     ESIQLSDNEQLINNFIAYTSFILFFRLFILFIDILRIISYRR"
     gene            241781..242307
                     /locus_tag="MGF_RS01055"
                     /old_locus_tag="MGF_1439"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            242326..242805
                     /locus_tag="MGF_RS01060"
                     /old_locus_tag="MGF_1441"
     CDS             242326..242805
                     /locus_tag="MGF_RS01060"
                     /old_locus_tag="MGF_1441"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBS1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_011113424.1"
                     /db_xref="GI:499425960"
                     /translation="MAKTKKHLLTQEGLKKLQAELRLLVDVKRADVIKLIQEAREQGD
                     LSENADYDSAKATQSEIESRITEIQDILNHYEIIKEVDTKNKRVIVGAKVTIHDHSDE
                     CNYTYEIVGPIESDPAENKISHESPVAKAIMDKKEGESAEVIGIEHPYKVTIKKIVL"
     gene            242896..242981
                     /locus_tag="MGF_RS01065"
                     /old_locus_tag="MGF_tRNA17"
     tRNA            242896..242981
                     /locus_tag="MGF_RS01065"
                     /old_locus_tag="MGF_tRNA17"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:242930..242932,aa:Tyr,seq:gta)
     gene            242985..243059
                     /locus_tag="MGF_RS01070"
                     /old_locus_tag="MGF_tRNA18"
     tRNA            242985..243059
                     /locus_tag="MGF_RS01070"
                     /old_locus_tag="MGF_tRNA18"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:243017..243019,aa:Gln,seq:ttg)
     gene            243065..243139
                     /locus_tag="MGF_RS01075"
                     /old_locus_tag="MGF_tRNA19"
     tRNA            243065..243139
                     /locus_tag="MGF_RS01075"
                     /old_locus_tag="MGF_tRNA19"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:243097..243099,aa:Lys,seq:ttt)
     gene            243149..243234
                     /locus_tag="MGF_RS01080"
                     /old_locus_tag="MGF_tRNA20"
     tRNA            243149..243234
                     /locus_tag="MGF_RS01080"
                     /old_locus_tag="MGF_tRNA20"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:243182..243184,aa:Leu,seq:taa)
     gene            243239..243312
                     /locus_tag="MGF_RS01085"
                     /old_locus_tag="MGF_tRNA21"
     tRNA            243239..243312
                     /locus_tag="MGF_RS01085"
                     /old_locus_tag="MGF_tRNA21"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:243271..243273,aa:Gly,seq:tcc)
     gene            243697..>245088
                     /locus_tag="MGF_RS01090"
                     /old_locus_tag="MGF_1453"
     CDS             243697..>245088
                     /locus_tag="MGF_RS01090"
                     /old_locus_tag="MGF_1453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574470.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="WP_041594429.1"
                     /db_xref="GI:753838812"
                     /translation="MTKKTFNDRTFALLTINYVVGFGFIATIVDIVNIGYWAILILFL
                     TSFIATATAFAFSRLISAFPNETGGSISYAKKTNYKFLTCFTGFNQYVQVPLFAATGP
                     LFLVRIAEVLTANETTLWIVRGVSIAFYISLVLLVVLRVRVSKWFIFATAIIKWISLG
                     IGIIGLVILVARNASNLVENFKNVKDVNAYLIFSTIITFMFAFGGVETTPNIANNVQF
                     NKFSKALIIAIVTIIGFYTIAYILFLNLNLNLISDGFIQVYKTVLGTTGLVIFSIYLL
                     FYNISSTMTSTLANPKVLVSAAQIGFLPSFLTRTNRFNQHRNAIITNAVLIIVSMFIF
                     TLLPMFLKLNTNFFRNVINMGTIAFLLQYVLSFITIFVLVKQKKITNIRWWELLFYGL
                     AVLFILVPSLIYLFPFLVGQSWTVENTITIVTYSIFFLVFLIYFFIANHKNKINLDAK
                     IEEPQEDENVVVNQ"
     gene            245235..245657
                     /locus_tag="MGF_RS01095"
                     /old_locus_tag="MGF_1460"
     CDS             245235..245657
                     /locus_tag="MGF_RS01095"
                     /old_locus_tag="MGF_1460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-binding protein"
                     /protein_id="WP_011113426.1"
                     /db_xref="GI:499425962"
                     /translation="MQENVKDLLTLQASLFVLETKVRNFHWNIKGDDFFPVHEELGKL
                     YEEAADKVDLVAEKIVMLENTAYGSYKEALKNSLLKEESAKPISSKELFKVLQKDLKT
                     ILEFIGKMQKISYRVQPILDEIILFLDMWLWKVTKSLA"
     gene            246018..247985
                     /locus_tag="MGF_RS01100"
                     /old_locus_tag="MGF_1467"
     CDS             246018..247985
                     /locus_tag="MGF_RS01100"
                     /old_locus_tag="MGF_1467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574471.1"
                     /db_xref="GI:504387369"
                     /translation="MRRKNILKFVSLLGIGSFVMLAAASCTSAPAPAPTPTPTPTPTP
                     TPTPNPNPGDEAAARELTAARASLTSLLNSKNTNVEMYADYAKIQNALKSAYTTAEQT
                     SQNSSTTLEQVKSATSNLQTAIDKAATDKKNFDQSHNELLMAYRNLKTTVSQKSATVS
                     SLGLSNPQYSAILKKVNASYQAAEKILSATLDPISGPAPTPKSIAQAGNSISIETNPE
                     TLKPFKTNADMFNSYQFYKLDSTKLTDVQSKNTMPSNYSFVGYSVGLDNANWSFAQRT
                     VWTNGSDTGSTTRLLNQSADSAQATQPEGASNPEATATKLLTDVSWIYSLTGTNAKYT
                     LKFTYYGPETGYLYFPYKLIKQADSNNLGLQYKLNTAAQPTPIIFGTQANASGPAATV
                     DSINIAKVMIPGLAFGENTIELSVPATKVAPMIGNMYFTSNANSQGTIYNQIFGNTES
                     NESNSTVVSVNLLKGYGLAADWSTYIAEYSGAGLTLNNEKKADEKYYLIGFVGGTSER
                     RIYSITENVQKLPSSVTNQNSRTYTFYVNAPKAGAYYIKGVFTSGISRDLKFSTEDMS
                     SNNNVTVKQLSTGNYSTITLRTFDTSATKGPTQVTTDSTGRKTLTLVEGLNKIVVSGA
                     TENMGNAPNFGYLEFILNETQPETTNVSNPS"
     gene            248321..250951
                     /locus_tag="MGF_RS01105"
                     /old_locus_tag="MGF_1483"
     CDS             248321..250951
                     /locus_tag="MGF_RS01105"
                     /old_locus_tag="MGF_1483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574472.1"
                     /db_xref="GI:504387370"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTQATTPTPNPKPTPNPNP
                     PSGGMNGGNTNPGNGGGMDNSAKQLAAAKTEAKAVIDASAELSDSVKEALKRQVDATT
                     TGPAARDLKTKAEALVSAVKALSGSVTAAKTLQAEEQYTNVSQDFKTTLEAKLTAATA
                     LLEDGTKLKNLDASGNLDTTKASLESSKTDLDAAVAAVKPELTFAKTKASVVKTASEL
                     RPLVNEALLAELQKQANDLPKNDQSKADKLDSELKSLKASLTSLQDLVSKGLAMQVDY
                     PQKYYDADNKDAFDAALLKASSVFPAFKWTAESIMVPDPTNGALPNPRAWTKARDKSE
                     FKLQNFVMAPAQAAAPTPTEPAAAESASAIVRVANGEAASPDGAVSREAQTTPAPAPM
                     ADLASTVSYLKSLNDSLKAESDKLNGDTTTNKTAYYKLVEGRTLYWDGFMPKIVVEGY
                     QPAGHGSNKDTNETTNREKLKAWFGKESNWTGLSEQLTKKLGAERFKNVKLTFKDVIY
                     ETISTGSDVKIPKVTFTVAAKDGYQLGNEKGTTTTLELKIRVLYTSQNQTQNALKYQG
                     VSFSREPSQTRTINDANVKANVNVYLNYTGPAIVLDADLPAVGSANNTTINGTSPIKD
                     TDLATKVKALLNKTANQNDPTDLMKAITKYVQTFDPKYLSTRTDNGYRAWVSWMQVED
                     KGNGKVLHQRELKQPADIFLQQMKDDTEAVYLAIGGTTDDQWLNAFLIRIPLTKFVKP
                     LTTFTATPASAPAQTGSGTGSTQQAQSSSTTDTTQTDGNSTSKTTDYGTKDDQSQTSN
                     TVSKEGSGDSSENGETHSTTSTTTSGTTTTSNKSSSSESQTSSSGSSTTKTESTATSG
                     TGSTQQAQSSPTTGTSSSSN"
     gene            251356..253422
                     /locus_tag="MGF_RS01110"
                     /old_locus_tag="MGF_1500"
     CDS             251356..253422
                     /locus_tag="MGF_RS01110"
                     /old_locus_tag="MGF_1500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574473.1"
                     /db_xref="GI:504387371"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTQASTPTPTPTPTPTPTP
                     TPNPEPKPNPGGGDTNNPPSGGMNGVDTNPGGGQGMMNATNQELVNAKKALSDLIGGE
                     SKTVELYADYAKIKADLTSAYAVAKTTSDSSTSTLDQVKTATSTLQTAINTAASDKEK
                     FDQQNSQLLMAYKVLKDTLNKKEAIVMSLNQEKYSAILSEINAASSTAEEIVKQTLNP
                     VNGNLPVVDTLNAENTKILEAIKEEKINSEKSNADLFANYQLYKLDRTKLMSEGSNNT
                     KQPGNYSFVAYASDIASPNWNFAQRTVWTADSRTWTSPLPNNSQNSAPLTDVSWIYTL
                     SGTGAKYTLTFDYYGPQTGYLYFPYKLAKTSDKVGLQYKLNQADPVAIQFSEAAATAS
                     APAETDGRQESAETTTANEKVNPMPSVNTINVAKVTLSNLKFGSNTIEFSVPMDQDNM
                     NKVAPMIGNIYITSSNDEANKKQIYDSIFGNTSSQTASQTSVSVDLLKGYSLATSWST
                     YIRQFTGLTGNGVQTSDFVYLIGLIGGSQNRTVASGPMNIKNIPNMNGATRTFTIYAN
                     APVNGNYHISGAYLQGANQARSLKFSTGTSGSNNEVTVTGLKQKNWTTLGHFDTKMTS
                     TTVSGTGTPMKRTLTLNQGLNKIVVSGVNNGDTPFIGNLTFTLESNQTISEQVEPSSA
                     TAEKNI"
     gene            253708..255777
                     /locus_tag="MGF_RS01115"
                     /old_locus_tag="MGF_1517"
     CDS             253708..255777
                     /locus_tag="MGF_RS01115"
                     /old_locus_tag="MGF_1517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574474.1"
                     /db_xref="GI:504387372"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPTPNPEP
                     NPMPNPGGGVGMSDGNTNPGNGGGMMGDNPNPGNTTPKQQLAAARKTLTDLLGTENTN
                     VALYADYAKIQSTLSTAYMTAKTASENTSATLDNLRSASTTLQAAIDKAASDKRAFDS
                     ANQSLVAAYNNLKTTLQSKTTSLEGLSENKYSGIKNHLSKLFDTGSAITARTLDPTSG
                     ERPTLLEKVNEANNGIKMAISSESLNKWKTNADKFNDFEKNPLSKEKLESTNDTAHNQ
                     EQPANWSFAAYSVDLTSNSQNLPNWNFAQRKVWTSEGQEGGRTVLVSSPVSSTDVSWI
                     YSLAGEGTKYTLSFEYYGPDTAFLYFPYKLVKQADSNSVALQYSLNKASPKLINFQPV
                     RTEPANADSTTNETTTTGSSESRSSSEVLVADEAATSNNEMNPTPTVDSINIAKVTLT
                     GLAFGQNTIEFSVPTDQTNKVAPMIGNMFISSNSESQEKIYNQIFGNTSNLSTDSRSV
                     TVDLLKGYSLASGWSTYVGEFKRLTGANQTASDSQTSAPSYLVGFIAGHGQRTVDNVS
                     NIIRNPNIAGQKRTLAIYVNAPSDGQYGISGTYISNTSNRSLKFQTESDDANSVTITV
                     KAKTAWTELQTFNTSDMMVVQNNQTRTLHLKQGLNKIVISGSNDTPFIGNLTFTLNNT
                     PSSNSES"
     gene            256126..258078
                     /locus_tag="MGF_RS01120"
                     /old_locus_tag="MGF_1528"
     CDS             256126..258078
                     /locus_tag="MGF_RS01120"
                     /old_locus_tag="MGF_1528"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574475.1"
                     /db_xref="GI:504387373"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTTPTPNPTPNPNPPSGGM
                     NGGDTNPGDGQGMMNAASQELEAARMGLTTVFDSKAKNLGLYVDYKKTQQNLTKAYDA
                     AKTVLDNSSSTTQNLNEAKTRLETAIRTAATSKQTFDEQHAELVKVYKELKTTLSNET
                     ATLAPYEEAQYAGIKMHLSGLYDAGKAITTKTLEPVEGDPLTADVVMMANTKIVEAIK
                     DEVLNPQKENATKLADSFVKQVLVKEKITGVEEAHNKAQPANYSFVGYSVDITGTTTG
                     QTSIPNWDYAQRTIFTNGDEPRSISNTPADGQTMAQPLSNVSWIYSLAGTGAKYTLEF
                     TYYGPSTGYLYFPYKLVNTSDQMKLGLEYKLNDATEPSTITFGSEQTMNGKTPTVNDI
                     NVAKVTLANLKFGSNKIEFSVPAEKVSPMIGNMYLSSSPNNWNKIYDDIFGNSVTTEN
                     NRTIISVDALNGYSLASDWSTYIAEYSGAGLTLNDQAKPNEKYYLIGYVGGTGARNDM
                     MVPKNNVQKFPLASNTTNRNYVFYVNAPKAGAYYIKGVFASGDPRNLKFSAGDMSSNN
                     SVTIEQLSTDNLTTLRTFDTSATTAPTQVTTVANNRKTLTLVEGLNKIVVSGATANIG
                     SAPNFGYLEFILNETQPETTNDSNPS"
     gene            258415..260535
                     /locus_tag="MGF_RS01125"
                     /old_locus_tag="MGF_1542"
     CDS             258415..260535
                     /locus_tag="MGF_RS01125"
                     /old_locus_tag="MGF_1542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574476.1"
                     /db_xref="GI:504387374"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCNSATTPTPTPNPTPNPEP
                     KPDPIPNPPSRGMNGGDTNPGDGQGMMNATNQELVNAKKALSDLIGGESKTVELYADY
                     AKIKADLTSAYTVAKTTSDSSTSTLDQVKTATSKLQTAIDKAASDKQKFEQDHKDLLM
                     PYSELKTTLSQKNATVVLLNQPKYSAILNKINSIYAQGEEVVIRTLNPVSGAIPTAAS
                     ITKVNDEINKAISENQLKPKKDNADAFANYQFFKLDKAKITGTSTNNTAQPQNYSFVG
                     YSVGVTGMQSGQTTIPNWNFAQRIVWSSGAPRAPLASQTETPPMSAPQGTEPAQQQGD
                     SSSKQASETQEVSPTPAAEGQAQQADTEQPATSQGTPLTDVSWIYSLSGTDVKYTFSF
                     NYFGPSMAYLYFPYKLVKSGDSVGLQYKLNNNNPVALNFGAEANANGPAASVDNINVA
                     KVNLANLNFGENKIEFSVPMNKVAPMIGNMYITSDVANQGAVYNQIFGNTNSSSDAAA
                     TSVTVDMLKGYSLASDWSTVISQYAGNDLTVDNMQKPNEKFYLVGYVGGKSPRTYRES
                     DVTMNVQKSPAVSDTNKRDYIFYVNAPKDGAYSIRGVYISGTQNTEMANSWLQFKTGD
                     ETNVLQVETPGNNNTEKAASGNWTTKLATFDTARENTKLNPKDKKTLNLKAGLNKIIV
                     NGKDGTGDAPNFGNITFTLMNPSM"
     gene            260945..262603
                     /locus_tag="MGF_RS01130"
                     /old_locus_tag="MGF_1558"
     CDS             260945..262603
                     /locus_tag="MGF_RS01130"
                     /old_locus_tag="MGF_1558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_014574477.1"
                     /db_xref="GI:504387375"
                     /translation="MDTQEYALRMVDIHKSFNNGQIKANSGINLSVKRNEIHAIIGEN
                     GAGKSTLMSILFGLYKQDKGQIYVWGKEVNFKSSKDASKAKIGMVHQHFKLIENFKVI
                     DNIILGSETTKAGIIHYKKSFNKLKKIIDEYNFKIDLNAKVSSLTVGEQQKVEILKVL
                     YRDADLLIFDEPTAVLSDNEIESFLEILREFKAKNKTILIISHKLHEIKAIADNATII
                     RKGEYVDSVDVKRTSIEEMAELMVGRTIIPSINDSPVTSDEVVLSVRDLNLDTKTAEE
                     KYDELLNKASSVTKTTFTKGWQKAKQTWEKLSSSNRDKSKINFEIKKGEIFAVAGVEG
                     NGQSKLIEIISGLKKSEPNKIFFRDNNKLVDISKLSIKKRSRLGISFVPEDRHKHGLT
                     LDENVRLNSVNNLIDKKPFSDKGFIVPFEIAKYAQDIIDKFDVRGTANGTALSRSLSG
                     GNQQKLIIGREMSKKHELLILAQPTRGLDVGAIEYIHGQIIEAKKQGKAVLLVSYELD
                     EIMALADTIAVISRNNFIGIGSKEEMTRSKIGQLLAGEAMNESI"
     gene            262590..264239
                     /locus_tag="MGF_RS01135"
                     /old_locus_tag="MGF_1567"
     CDS             262590..264239
                     /locus_tag="MGF_RS01135"
                     /old_locus_tag="MGF_1567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574478.1"
                     /db_xref="GI:504387376"
                     /translation="MNQFKKYPNFLIGFDRFFYRKEHKSTRRRILSIIVLILIALLVI
                     YGILVATNVNRYAFLSLFTRGLRDQKQQQDFITNIGIFTLAGLSFGFAMQVKIFNIGI
                     SGQMLAGASFAFIITHYLAKVGFAPAVGAQLITIILSMFVAAFVSVLTGLFKIYLKIN
                     EVVSAILLNWIILLIVGTIINNHFIDSTQRLNGNFLSVKFPDQYSFYVVNGPTFFTSN
                     TGWMWTIAVTAVSVVIVWVLLRFTVFGHKLKTTGLSSSSAEYFGYNKNLLQLSSFAIS
                     GALAGILGVVVYTGQASQAIDFSSVGRFGLSSVPIEGFNGIAISLIALNNPWGIVIVS
                     MLFSLISVGQGPANLPTPQTLSLTLGVLMYIISIYGLMNYLKPWRWIIIKIYGDKNIT
                     EYQNLENNMAALSEKHLFKVKKLQKDLNEQLNKQYGSKLKVALMVLINPIKILFLKEY
                     KEQINTYKNEYVQERVSIVNEFYHSCVFNSILATEKVIQDCESSKNQKLLHKLSKWNK
                     EERRIQKLAATLEDEMKMQVNKHIKTINEKISNLNINKEAR"
     gene            264239..265171
                     /locus_tag="MGF_RS01140"
                     /old_locus_tag="MGF_1577"
     CDS             264239..265171
                     /locus_tag="MGF_RS01140"
                     /old_locus_tag="MGF_1577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574479.1"
                     /db_xref="GI:504387377"
                     /translation="MFSPTQLDQWLILAPALILGVFGGYLSERAGIVNIAINGTMTFG
                     ATFFVLFSNIFFRSMGGMLTTTYNWTFLASILLSALLSVPVGILFGVATIKLKADHVI
                     AGTGINLLATGIGQILSDRATTLFGRPSLDNVYNRTLRPNSVSTEAIIIFVLFIVFFI
                     ILYVVMNFSKIGLRYRAVGENPNAVDSQGINVTKYQWIGIILASVVAGSGGALFGYYQ
                     SGRSFAGDVDGVGFIALAILIVSGWKLLPITIIGLVFSSLLVYSTSTTSVNQSQIFLI
                     RTIPYSLTLATMLLLGKFSIGPKNVGNHFDKGLR"
     gene            265251..265961
                     /locus_tag="MGF_RS01145"
                     /old_locus_tag="MGF_1584"
     CDS             265251..265961
                     /locus_tag="MGF_RS01145"
                     /old_locus_tag="MGF_1584"
                     /EC_number="2.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="purine nucleoside phosphorylase"
                     /protein_id="WP_014574480.1"
                     /db_xref="GI:504387378"
                     /translation="MTPHIKAKKEEIAKTVIMPGDPLRAKWIAETFLEDYKLVNEVRN
                     MFAYTGKYKNKLVTVMGHGMGNPSIGIYTHELYNFYDVENIIRVGSCGALVKDVNLGD
                     VILESKAYSESPYAMLIGVDVVDKTNYPSAKLLELSRKTAHELKIKYHEGLVICEDAF
                     YQTLYTPKQANEKWNAIAVEMEGFALNANAQKAKKHAMTILTVSDSLVTHESMSTEKR
                     QTTFKNMMELALNVANKL"
     gene            265967..266638
                     /locus_tag="MGF_RS01150"
                     /old_locus_tag="MGF_1585"
     CDS             265967..266638
                     /locus_tag="MGF_RS01150"
                     /old_locus_tag="MGF_1585"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAQ0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="WP_011884869.1"
                     /db_xref="GI:500214705"
                     /translation="MSILNFNKLIDHTNLKANATYEEIERLCHEAIEYGFFSVCVNPA
                     YIRTAKKILLKSPVKVCTVVGFPLGQTFSEQKVYEAKTSIKMGADEIDMVINIPELIN
                     GCACVIDEIRQVKKVCGEKILKVIVETALLNEEQIRKATLACIDGGADFIKTSTGFST
                     RGASLNDIKIMQQASQNKILIKASGGISTARELIEFVKVGADRIGTSRSVKLMQELKT
                     MDLAK"
     gene            266649..267908
                     /locus_tag="MGF_RS01155"
                     /old_locus_tag="MGF_1587"
     CDS             266649..267908
                     /locus_tag="MGF_RS01155"
                     /old_locus_tag="MGF_1587"
                     /EC_number="2.4.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thymidine phosphorylase"
                     /protein_id="WP_011113841.1"
                     /db_xref="GI:499426377"
                     /translation="MNIIDIIEKKKTKQILTKEEIGFFIDGCVKKTIPDYQISALLMA
                     IWFNGLNDDELFYLTDFMIKSGKTLNFESDQKKLIDKHSTGGVGDKVSIALAPILACF
                     NFKVAKMSGRGLAHTGGTIDKLEAIGVDCFISLDQAKQILKTNDMFIIAQTNDLVLAD
                     KILYALRDVTATTDCLDLIASSIISKKFAINSDYIFIDIKYGLGAFCKTIDEANELKK
                     RMLNLAKKFNRHLKCELNDMNEVLGNSIGNAIEIKEAIAYLKNQLSQNNSFKILMDNL
                     VAEILVETKQFTTKKEALISLDQLLKTTKPFDKFISWIKSQIGNWQEIINDSYFQPKY
                     EYQLKAKKAGKISYSSPVDLAMVSVGLGSGRMIKDQPIDFQAGIYLHKKNHDQVSLDE
                     PIMSLYSSKPIDQVIIDKADKTIRYET"
     gene            267871..268302
                     /locus_tag="MGF_RS01160"
                     /old_locus_tag="MGF_1597"
     CDS             267871..268302
                     /locus_tag="MGF_RS01160"
                     /old_locus_tag="MGF_1597"
                     /EC_number="3.5.4.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytidine deaminase"
                     /protein_id="WP_011113840.1"
                     /db_xref="GI:499426376"
                     /translation="MIKQIKQLDMKHNELLRLLDKAYCVYSNFHVACILVDDQNKEYQ
                     GVNVEFASYPITLCAERNAIGTMITSSNSDHLPVIKQIHLMSDSNDSNASPCGMCRQA
                     LWEFSDDSTLITIYYKNQTKKTYQFKQLLPLGFNHKAMTAK"
     gene            268322..269953
                     /locus_tag="MGF_RS01165"
                     /old_locus_tag="MGF_1601"
     CDS             268322..269953
                     /locus_tag="MGF_RS01165"
                     /old_locus_tag="MGF_1601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphomannomutase"
                     /protein_id="WP_041593700.1"
                     /db_xref="GI:753838083"
                     /translation="MNNTVKYWLVHPKVSKDLKAQIKAMSEQELAYAFNEKPLGFGTA
                     GIRQKMGPGYRYLNDFTYAQMAFGYGRFLIDKFGFSPRCVIAHDNRKNGVHFAKIITD
                     VLTSMGIEVYLFDNNKISSTPILSYAIPRYNADGGINVTASHNPKTDNGFKTYNEKGA
                     QLLNQDAQKIIDFMPKSCEILNLEYQPNDRLVKFIPDEIYDRYFADIYRDLYTTDHKE
                     VKDFKVIFTGQHGAASYWLPEMLRRFNYNVIPVKEQCKYDENFTYTKSPNPEARESWD
                     LALKYAQHYGADIMLATDPDADRLAVAVKHNNEFRYFNGNEMGIIFAYYILKYKQLTK
                     RPYIVSSYVSTNLIDRIIAKYNGVVYRVGTGFKWIGNKAIDHKDQEDFILGFEEAIGA
                     LPTTIGSDKDSFQTAALALEIYNECLKRKITMVDFLEREIYPQFGFIHNDTITTLIND
                     LDWKKKANDWMERLKRYDQPYINDRKIVSIKWNQAGDCLDWILEDDSWIRFRLSGTEP
                     KFKFYYNLYGNSLKQLKEEANQITKTLKRYISLIK"
     gene            269974..270732
                     /locus_tag="MGF_RS01170"
                     /old_locus_tag="MGF_1611"
     CDS             269974..270732
                     /locus_tag="MGF_RS01170"
                     /old_locus_tag="MGF_1611"
                     /EC_number="5.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAQ4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="triosephosphate isomerase"
                     /protein_id="WP_014574482.1"
                     /db_xref="GI:504387380"
                     /translation="MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVA
                     PVFVHLGLANQLKRNECLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRK
                     LFHESDELINQKVKTLLENKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSL
                     LKDLIIAYEPVWAIGTGKTASSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTP
                     DNVSELLAQKDINGALVGGASLDPHKFIQLIEAK"
     gene            270736..272247
                     /locus_tag="MGF_RS01175"
                     /old_locus_tag="MGF_1617"
     CDS             270736..272247
                     /locus_tag="MGF_RS01175"
                     /old_locus_tag="MGF_1617"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphoglycerate mutase"
                     /protein_id="WP_011113837.1"
                     /db_xref="GI:499426373"
                     /translation="MKKALLMILDGYGISSTTHGNAVKNAKTPHLDNLMNNNPTIMLQ
                     ASGEAVGLPKNQIGNSEVGHLNIGAGRIIYTGLSLINKEIENKKFFTNQALLNAIDHA
                     KKNNSKLHILGLVSNGGVHSHINHIYAIMELANQHNVPAILHIFGDGRDVPPTQLLAD
                     LDQLIKKAETTKTKIGTISGRFYAMDRDQRWDRIDLAYNNLLSNTGKSFADLKTYVKD
                     SYQQNITDEFIVPAYNNNYKSDEITIQDNDSVVFANFRPDRARQLSHYVFGSNYYDHH
                     PQLRRKNLYFVIMMQYEGINPSAICYPPKIEKNTLGEVLKNANKKQLRIAETEKYAHV
                     TFFFDGGVEVEYQNEDKVLVPSRKDVKTYDLAPEMSAAAIVDQLLKVYTKYDLTVLNF
                     ANPDMVGHTGNYEATLKGLEALDHEIGRLLADAKKNNITVFFTADHGNAEEMIDENNQ
                     KVTKHTTNVVPFSITDPNVKFTKKEGILANVAPTILKYLEIQIPEEMDQEPLI"
     gene            272295..273134
                     /locus_tag="MGF_RS01180"
                     /old_locus_tag="MGF_1624"
     CDS             272295..273134
                     /locus_tag="MGF_RS01180"
                     /old_locus_tag="MGF_1624"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="WP_011113836.1"
                     /db_xref="GI:499426372"
                     /translation="MDNKNSVIKFENVSFSYNSKKQVLKNVSYEIYEKEYVCIVGHNG
                     SGKSTMSKLLTGILKPLAGTIYLFGYAISRDNIKFLRDNVGIIFQNPDNQFIGITAED
                     DIAFGLENRKIPRGEIKRIIDSVADKVGIKDILKFEPHKLSGGQKQRVAIASVLAINP
                     SIILFDESTSMLDPKGKKDIKSFMLQLRNQGKTVISITHDMEEVVNCDRVLVMDHGNL
                     IKQGRPDEIFKDKQFLRDINLDVPFSLDLAMQLNELDEKINSTLRYNELIDNICSRVD
                     QKD"
     gene            273107..274063
                     /locus_tag="MGF_RS01185"
                     /old_locus_tag="MGF_1629"
     CDS             273107..274063
                     /locus_tag="MGF_RS01185"
                     /old_locus_tag="MGF_1629"
                     /EC_number="3.6.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="WP_014574483.1"
                     /db_xref="GI:504387381"
                     /translation="MFKSWSKRLKYAPTPLVGDEVLRAQGLKCVFDEKTPEEFWALNG
                     IDFTFEKNKIYCIIGNSGSGKSTLVTHFNGLLTSKYGTLSIRDFKNNHDIVISPNTKK
                     IKNFKRLRKIISMVFQFPEYQLFKDTIQKDIMFGPVALGVHKEEAAKLAKFYLNRMGL
                     DSSYLDVSPFELSGGQKRRVAIAGILAIQSEIIIFDEPTAGLDPKGESEMVELILESK
                     KENKTVIVITHQMEKVLEIADEVILLDKGKILTSGTPYQIFTDPEIIQTTSIALPHVV
                     QVINDLSLRNPIFKKLYDYEPRTVKDLAKAINEVIKNYEKRN"
     gene            274047..275216
                     /locus_tag="MGF_RS01190"
                     /old_locus_tag="MGF_1637"
     CDS             274047..275216
                     /locus_tag="MGF_RS01190"
                     /old_locus_tag="MGF_1637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cobalt ABC transporter permease"
                     /protein_id="WP_014574484.1"
                     /db_xref="GI:504387382"
                     /translation="MKNAINGYILSNSVVHKTNPSIKLIIFIAFVVIIFLPTGLVFQL
                     IVLAIISLIFMISKLPFRIYWSTLKTIIIMFLFLFLINWFTYRNPGFLNISVWANNNH
                     SYILIGDYNDYSVANLYDYNFFKTESPMIMNTKTKMFITFDDLLSLVHQKRADLTPIQ
                     LQEYYRIAVPKVAGAELKQFEFNPNSLVLKPVLMFNWYALSFKTLFITLSIVLKIFMM
                     ILLATILTSSSTSIELTFGIEQLLSPLKLLKVPVNSLAMTISISIRFVPSLLLESQRI
                     LNAQASRGIDFKNGNTIERMRSLVSLIIPMVSIAFRNAGELANAMDARSYNPRFARTR
                     YRIFKVHALDLVVYTFLMVLLGFFIYVAASRVLFGVFGSPEWMTIGLGQNVGQVK"
     gene            275149..275940
                     /locus_tag="MGF_RS01195"
                     /old_locus_tag="MGF_1644"
     CDS             275149..275940
                     /locus_tag="MGF_RS01195"
                     /old_locus_tag="MGF_1644"
                     /EC_number="5.4.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_014574485.1"
                     /db_xref="GI:504387383"
                     /translation="MVYLVHQNEWRSVWVKTLAKLNKNVLINISYHGTKFHGYAVQND
                     YETVQSKLQDALAWIYESKIYVNASGRTDKGVHAINQYISFYIDDRISLEKLREILNR
                     YGQNKWYIKWIKEVDRNFHARFSAKAKTYLYLIDYCANNPLFYDHAWIVNFQLDFNLI
                     EKAIPILEGTHNFWSFSTADKDKGLRTINKINLKQEDNKVYIYITGDGFLRSMVRMIV
                     GALYNIGIKKYDLNHLKWLLDNPKKGRAITKAPASGLYLYEVYYE"
     gene            276059..277081
                     /locus_tag="MGF_RS01200"
                     /old_locus_tag="MGF_1651"
     CDS             276059..277081
                     /locus_tag="MGF_RS01200"
                     /old_locus_tag="MGF_1651"
                     /EC_number="2.7.6.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_014574486.1"
                     /db_xref="GI:504387384"
                     /translation="MNVKSNHIIFGLSAAKKLTDSICRRLSMKPGEIVIQKFADDEIF
                     VRPDCTLRNKDVVFIQSTNSPVNDNLMELLIAIDSAKRASAKSITALIPYYGYARQDR
                     KSAGREPITSKLVADLLTKAGATRVTLTDIHSDQTQGFFDIPVDTLKASFVLLSHVLV
                     DNKIDDLVVVSPDYGGVKRARKIAESINVPLAIIDKRRPKPNVAESINILGEVKNKCC
                     ILVDDMIDTGGTIISAAKLLKKQKAKTVLVMATHGLFNKNAIELFDECYKKKEINKVY
                     ITDTIDQTEKNLEKKPQFKVVKLDHFYSLVLDKYINGGSISDVYTIYQEWVKSPNLKK
                     ILKEIE"
     gene            277033..277593
                     /locus_tag="MGF_RS01205"
                     /old_locus_tag="MGF_1657"
     CDS             277033..277593
                     /locus_tag="MGF_RS01205"
                     /old_locus_tag="MGF_1657"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="small primase"
                     /protein_id="WP_011113831.1"
                     /db_xref="GI:499426367"
                     /translation="MSKITKPKENSKRNRINEIIVVEGKTDTVKLKSLFDCETIETNG
                     SEISDQTISLIKELSLTRGVILFLDPDYQGKKIRAKLIKELKEYREAFIDLSELKDSK
                     KKGIAEASNEAVLSAFNNLVSSEHDSYQSLTWKEYLALNLNTKNKRIELCKKLNIPYG
                     NNKSLFRYLNLLKKNFDELKKLISEI"
     gene            complement(277577..278782)
                     /locus_tag="MGF_RS01210"
                     /old_locus_tag="MGF_1666"
     CDS             complement(277577..278782)
                     /locus_tag="MGF_RS01210"
                     /old_locus_tag="MGF_1666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase IV"
                     /protein_id="WP_014574487.1"
                     /db_xref="GI:504387385"
                     /translation="MFLMDRKTIFHIDFDAFFASVEENFNPEYNNKPLVVGSKSNGSI
                     VSSANYIARKFGVRSAMPIFQAKKLCPSLIIAEVDYPKYERVSAYVFSYLRDFVSNKM
                     EVASIDECYMDVTDILEKNSEISASDLAKKIQKQIYELTQLTVSIGISSNLFLAKMAS
                     DQNKPNGVYEIWPDEIEEKLWPLEIKKMYLIGSKKIPLLNQLNIKNIGNFAQFENKEL
                     LIDIFKNMYWDHYNHAHGKGSDFVDYERNSRKSISVSKNIRHKVSDYESLLKLFNDLF
                     DDVYSRLKNHNLLAKNISVSIRTEKVRSLSFSFKQYSDKKTLFYNKAIDLFERLHNNQ
                     LVANISISFGNITNKYKFIPNINIYEELSQEQKDTMLLKKIVNQINKEYNKELVNIAD
                     DFDYFKFQK"
     gene            278888..279886
                     /locus_tag="MGF_RS01215"
                     /old_locus_tag="MGF_1667"
     CDS             278888..279886
                     /locus_tag="MGF_RS01215"
                     /old_locus_tag="MGF_1667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycosyl transferase"
                     /protein_id="WP_011113829.1"
                     /db_xref="GI:499426365"
                     /translation="MNETNSRSSEFYHVKNPLISILIPIYNNAKNIEITVSSALFQSY
                     KNVEIICIDDCSSDNSYQVLKRFETLEQNIRIYRNPIQRGKGFVYDQLIKYASGHFFM
                     FLETPNTLNQDAIKNMVSVVEQFTEIVIGRNMVGNTANPMKGMYDIPTNDKKISDRNS
                     IDYIFGNSFYTQGMLIKKSFFEALDMRYGRNPYIPDFYIKYDMLANCDFFRVVWKPTI
                     NFIESDNYYDFERFKFLEAKYRYILHQFPRMVEWFSNYVPIKDRLNDFKSSIITNIID
                     QVRIEYRSSVPSLREKFEQNIIIPLRNQYMASNYIFKVPNNLREKLKSGENKRLFR"
     gene            279905..281836
                     /locus_tag="MGF_RS01220"
                     /old_locus_tag="MGF_1673"
     CDS             279905..281836
                     /locus_tag="MGF_RS01220"
                     /old_locus_tag="MGF_1673"
                     /EC_number="2.2.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transketolase"
                     /protein_id="WP_014574488.1"
                     /db_xref="GI:504387386"
                     /translation="MVIKLIYQNKPFPKNSNSIVNNFRFLMFDTVNNNFVGSAAYGFG
                     AASYLYVLFRNYFVMDLDNLDANYNDKLVVSKQLGGSNIRACFYLLKHPDIKIEDLMS
                     FSHEKQIRNLYDFSTYQPGYNLAYAVGLAIDAKLVNQKSHDTITNKIYCIVSAADLNS
                     SYGLAALKTAANQELNNLIIIYDNNHFEERGENQDYLVTDFSSLVKDMGFKYINVFNG
                     NNIEKLDAGFHYAVNSKKPAFIDINTIVGHGYDSAGTKEVIKSSLTQDQLDQLTKRFE
                     YTGEEFMVLYETANDLYPNIKERVNKLKGLIADQVDQLKQNNLVIPNYLSAFKDWALS
                     EDQIDANQSLAKLKADLIRCQPNSVLLNVSDHDDEFEREVEAIDPSRIVLLGNWIELA
                     IIIANAISDNKIHLPVINLDINLIDKTIQNLKLEEKKDQILYLVDNCKELSRKYVNKV
                     IDLISREKDGIVLQPGTNEELKYSLCNFKAKNKDKTYIILPSSDDLISIQADKINFGG
                     YELYGDSYATVNIVTAGSDLIKALDLRQQLLENKITARIVSVISLTDFDQINAVSKSV
                     LLKNLPSYFISRADKVAWGYVLSQNQPEVDHKSTENTTYIKKPRRAQKSNNKIKTLDN
                     KTKVDESNKQLNATKEDKQ"
     gene            281942..282163
                     /locus_tag="MGF_RS01225"
                     /old_locus_tag="MGF_1683"
     CDS             281942..282163
                     /locus_tag="MGF_RS01225"
                     /old_locus_tag="MGF_1683"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAR5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113827.1"
                     /db_xref="GI:499426363"
                     /translation="MVLGLALGLSIPLCLIVGAFVGYFVSMKVFKRQMRKNPPITEAQ
                     IRSLYAQMGRKPSEAQVKQMMRAYTKETK"
     gene            282169..282729
                     /locus_tag="MGF_RS01230"
                     /old_locus_tag="MGF_1686"
     CDS             282169..282729
                     /locus_tag="MGF_RS01230"
                     /old_locus_tag="MGF_1686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein YsxC"
                     /protein_id="WP_011113826.1"
                     /db_xref="GI:499426362"
                     /translation="MNRFIKSATSLKDCINDSKKEVCLIGRSNVGKSTIINGLANAKI
                     AQTSKTPGRTVTMNFYEISNQRIVDLPGYGYARIKKSQKEEISLFLSDYLNHRKNLVG
                     IFLILDLGVITDQDIEIVRLLTTLDVEYYIVFNKIDKYPKSAYINNKEKILDALKVNE
                     DRILLISAKNKQNLNNLMLKIIDVIS"
     gene            282747..285329
                     /locus_tag="MGF_RS01235"
                     /old_locus_tag="MGF_1689"
     CDS             282747..285329
                     /locus_tag="MGF_RS01235"
                     /old_locus_tag="MGF_1689"
                     /EC_number="6.1.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_014574489.1"
                     /db_xref="GI:504387387"
                     /translation="MKRLKKIDLNQKYDHKTVSEGVVDFWLTTDYANQDSDFCDPNAK
                     PFSIIMPPPNLTGILHIGHAWNLSIQDLIVRYQKLVMGKINWIPGTDHAGIATQTKFE
                     SIQRTKKIDYKKDDRTMHFNNIYQWSQKSSQTIKNQAKSLGLALNWKKEKFTLSQESN
                     KYVLDVFVKLYQQGYIVKKYTLVNWDTKLNTAISNIEVINKETTQKLHYIKYYLKDSD
                     DYLVIATTRPETIYADVAVFVNPNDQRYLKYHNQMVINPLNNKLIPILVDEYIDMEFG
                     SAVMKCTPGHDHNDYALSKKYQLEELSCINFDGTLNELALEFSGLYLYEARELIVKKL
                     ISEDKYVKFEEITSNVGYSDRSNVIVQPLLSKQWFLITTKFVDEIKKLVNNEDQIKIY
                     PKRFLDTINNWLDHNQDWCISRQLVWGHQIPAWYHKDHPDEVIVSINSLGDDYYRDSD
                     VLDTWFSSALWPLICFDDGLDQKEFNANFPNSLLVTAYDIVFFWVLRMIFMSWLLKKS
                     IPFHDLLLHGLILDEHNRKMSKSLNNGVDPIQIIDQYGADALRLFLTSNTSPGEDVSY
                     NVEKINAAASFLNKLWNLARYLKLIDQSKLTDQPLDSLDHWIIHRFNEVNAGIQDKLK
                     EYRFALSNKQLSDFIWDDFANVYIELNKKAQWSKAKFELANDIFRKFLIMLHPSVPFI
                     TEQIYNTFEFSDSKPSIILEKWPGLIKIENALDHFDQIFNLIIKIRNFKQSFDLKNKD
                     TLDLLYKNEVSYIKDLTKYLKTENVNLIKISDQKLNDLFLIATEDNEFYVVYTQDKTK
                     IVDKLVVEIAKLEKEVERSSNIVNNENFKKKAPKEKYEAELKKLSNYQEELKLKQDKL
                     NSLK"
     gene            286473..287390
                     /locus_tag="MGF_RS01240"
                     /old_locus_tag="MGF_1705"
     CDS             286473..287390
                     /locus_tag="MGF_RS01240"
                     /old_locus_tag="MGF_1705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_014574491.1"
                     /db_xref="GI:504387389"
                     /translation="MNYLIICDDFYLSQDYLTQKLNPENVVWVNYNENTNLAPYLSSG
                     LFDTNSNKDLVIINPSFLYKEFNLNESKIIINNINNSSKNIYLLVNKNYDSKKEKFLK
                     IAGKNEIKSLDKNNDYKIGFIKKQLDNLFTDYPNWLIYLINDKSNSDARLIANEIQKL
                     QYVDKETLYDSELIEKIIIDHSDKKIYNLAKEIINNKVEEILVIYEDLIENKRQPTEI
                     ISMLITMLSKIYLMLLGKSMKLSDEEIAKKMGVNLYWVKYTYRDLYVKSAAVIKNFIV
                     NLLELDINNKRNLSDSYQTLKFFIIKGVN"
     gene            287380..288747
                     /locus_tag="MGF_RS01245"
                     /old_locus_tag="MGF_1709"
     CDS             287380..288747
                     /locus_tag="MGF_RS01245"
                     /old_locus_tag="MGF_1709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113822.1"
                     /db_xref="GI:499426358"
                     /translation="MLINMSIDLNTTLDNIKYKLNTIFNSEKFAHELKNKAFRDVLFK
                     QIAAYKYLATKAENSSQNLEYVDVALERLNHHSSDKRTADELATYTEIDDAMDDIRYL
                     DIFILNTFNLSFDEIVKDDKTPDKNTDSKSSVENKVEAATPTVSDIEEDEIKPNRSIP
                     FNGGINSPINLKDNLEKIFTTIGQPDYRQFASIVVKSELDIGKIFLYKEKLKLMPLLN
                     YFAFVISLLFALLGASLMIWYFVLFQRQAIPTFVSQFDKNSYPIFATPNFISAAVLIA
                     VSVVTSISYINSATGKTPPKRAQNAVALISTYMNKEVKVPQINDNLKYSFKIRPLVLF
                     ILFLLVYSFSPFLTPFAGGSLLQGIISLYSVPARIDFVTNATITPEIVSKITEVIWIS
                     LMTLPLAILFLIVVSFFFKPKIDNERLEETINKYAEEIKKATGEITSLFDRGSTTDTS
                     KSGVF"
     gene            288750..289652
                     /locus_tag="MGF_RS01250"
                     /old_locus_tag="MGF_1718"
     CDS             288750..289652
                     /locus_tag="MGF_RS01250"
                     /old_locus_tag="MGF_1718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574492.1"
                     /db_xref="GI:504387390"
                     /translation="MQKLRLQKQLGVAKKSIDRSAIIKFFLPFWPLKLRYNIYLISFL
                     ALFIALKIVLGIFVVRIGPTISLGISWVGLALIGWIFGPVVAIPIGFLTDTLSFFLGG
                     GGVWYWLYAVQEPMIIFTAALFGSIYRIRKNYASNFWDFVFQQILIVGFCISGFIFLS
                     LYNNADTDRFLVRNNSFGTTLSMIFMALFFVFAELISWLLYLKHRKTKESIKLFLYVS
                     TMMITLSILYSLVLGTISINEFLINVVHQKPKTRDFILSAYLIPRVIKETLRLPILII
                     CAIALIKISEPYLQNFFNLSRLRW"
     gene            289761..290582
                     /locus_tag="MGF_RS01255"
                     /old_locus_tag="MGF_1725"
     CDS             289761..290582
                     /locus_tag="MGF_RS01255"
                     /old_locus_tag="MGF_1725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574493.1"
                     /db_xref="GI:504387391"
                     /translation="MFKNKKHKILAASFLLSGVTVVSMVASSCSSAANNPVVEGLFKT
                     KQHPENFSNSSAGSFNAVLQNSLETDQGFNDFARFLIANSLADWYTNNASNSIVQKYR
                     GWERDAETKLESETTSLRNQFRRNFEIRRQTDLFDPNGGTADSYKRRQVLTNVFTDFS
                     SMVFQNNYLGYFDDKNKKVDNPLIDVISKPENWKNFKFYSDGYTDSKSTQNDNQMFAD
                     FQAYVFNQWVKRENPNLVSRIVFTNENINGGLDQIFDKKSFNFSASRKRSSYCGL"
     gene            <290512..291176
                     /locus_tag="MGF_RS01260"
                     /old_locus_tag="MGF_1732"
                     /note="glyceraldehyde-3-phosphate dehydrogenase;
                     disrupted; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
     gene            291362..294178
                     /locus_tag="MGF_RS01265"
                     /old_locus_tag="MGF_1736"
     CDS             291362..294178
                     /locus_tag="MGF_RS01265"
                     /old_locus_tag="MGF_1736"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020002904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sialidase"
                     /protein_id="WP_014574495.1"
                     /db_xref="GI:504387393"
                     /translation="MKKTKAQKDQQKKSQFKKRFWFTFTFLIGSITIISSFLIPLSLK
                     WIWAPLNIEEDLEINIKDDLNGSRFISEINSDNLPEFVNAFFNNKQYSIDDLNLKLAG
                     VNYITGWVYVQASVKPNVKVAKKYQDAVKLFKLEFKNSQVKLFDPNVTTFLIKPENNT
                     KEFTSEFQTREDLESFLNNADNISLSELQDKLNLTFFDKNNVPLNLYTGAVVTLSNPV
                     KFTIASYVMDYKITWQIPAANDVFYGNLYPFSLNGKLNLWLKKINSISSLYSDVDDID
                     FKKLQSKEIFRNLEEVQNFSTSIETLDQFYNAPDDLVVKGQDFKLGYYVNKTAQTFDN
                     VESFLDNSNLISSGYLTRMTYDDKHKVVISKPNLDTFTKASSETQRKYLQSFKQNKAP
                     VKVTIANTVDRTVEVFYTDFSFNKSPLVNGKYLFFNMSPPGDKFVYYTKDVNTWRIPG
                     VVKTHDNKLIFNADKRVNNKDDRGHLEQDIRVSEDGGKTWSNPQTIVRISAKNTKDGA
                     NKGQVIDGTMLEVFDKSINKHKLLYVFGVSSYLHTVHDEWTIRGDGNTSGLVNNNKWM
                     LFIDKENLNQKFVAKPITVDGDSNWFKVFKVKNSSRVQWKDIDDTTQLDEANIIIDNS
                     LKNGTITGNVYDKVPSNIFSTFGEPGRNSRSSEISGYISKYSIWDQRWPNYFVFNRMQ
                     KNAYFANSRYYFDNILWTFQVESIDGGKTWTNLRNVSPFLNRKDQRWYINGVGNGIQL
                     NHQRNSNGDVIAVFPFYFANKRKLERSKLMATKDGGKTWYELADYPFKLLPPGASESS
                     ISEDSKGNLWWLARRSDGRVFTLIKSEDGGKNWKVIFNAKRGIFTGQFIGSTIFNIKA
                     LGEKLIFSASDNRGGKIYLVDINNPRTLEPIYTINRGSYGYSTTVTFNENDNYFDVLT
                     FYEVNSPQKGRDINLKRLRVFVVS"
     gene            294226..294456
                     /locus_tag="MGF_RS01270"
                     /old_locus_tag="MGF_1749"
     CDS             294226..294456
                     /locus_tag="MGF_RS01270"
                     /old_locus_tag="MGF_1749"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594402.1"
                     /db_xref="GI:753838785"
                     /translation="MIWYFVLFQRQAIPTFVSQFDKNSYPIFVTPNFILAAVLIAASV
                     VTSISYINSATGEITSLFDRASTTDTSKSGVF"
     gene            294459..295362
                     /locus_tag="MGF_RS01275"
                     /old_locus_tag="MGF_1754"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            295460..298912
                     /locus_tag="MGF_RS01280"
                     /old_locus_tag="MGF_1760"
     CDS             295460..298912
                     /locus_tag="MGF_RS01280"
                     /old_locus_tag="MGF_1760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574499.1"
                     /db_xref="GI:504387397"
                     /translation="MFKNKKHKILAASFLLSGVTVVSMLASSCSSAANNPVVEGLFKT
                     KQHPENFSNSSAGSFNAVLQNSLETDQGFNDFARFLIANSLADWYTNNASNSIVQKYR
                     GWERDAETKLESETTSLRNQFRRNFEIRRQTDLFDPNGGTADSYKRRQVLTNVFTDFS
                     SIVFQNNYLGYFDDKNKKVDNPLIDVISKPENWKNFKFYSDGYTDSKSTQNDNQMFAD
                     FQAYVFDQWVKRENPNLVSRIVFTNENINGGLDQIFDKKVLGDELKASYSFQAFTNPN
                     QVIDRTSPKLSTGFRQLVANDGLVNYYNPANFTVDFLNQFSSDSGGKLLMSASDMFNS
                     FDVAFSTAYVQQYQDLTNNVDKDNAIASVILDPNNIMKNFIFANQANANSAYSTTLDL
                     TSNDPQLKELSEKIKSSILVDKIADNSYYDIYKQYAEGKASLHEYIRPTSSDMNSNEI
                     QKQFILSRGKDGIHIMAIDGANYYLTGSSRNIEKQKEFLLFRNQLVNNPDFSRFFSEK
                     SYQFNVLDPVKKYYDKNNITLTIEFLLNAIDDQNSFLHKPGNEALLGSLTKASSILKD
                     LVKAKVDYDFALKVKNDAINAREKIIERAGTFDNLIKTDKTPAIGIAGKLPHPAAADG
                     SYVGIESYYKNLLVENKLLPENTLTTKDQGLSKLFDQVVNDTKAKYFQTAKTVAEGLL
                     LNGEPSYTYSQNVFVSSRYDPQYSLAANLAINTTIALPTSTNDFKRQFYLNDQRFTNF
                     YDPRTNQFKDFEGLKADQIKNVVNFYFIQSTWESQANKVKYGSWATKAEYDNVLNNYF
                     DNQRTISNLNDDARLNYLRYLNTFRYLIQDNLAEFKRILSTQITRGVSANVSWTLTNG
                     TKLDNNGNIASTQDKINFTNFVANPNYLQGSKFNLANLNKATDNNPNSQSNNLNYSTT
                     NNNQTVYGFNGLSIANANNNTNLNTEVRSVLFDNFEQSGQNGVLYAFGGSLEDVVNYV
                     NTLTTNRELDAFVELLRRAQVNINLFETDANGMALSAEQRRVNLISQLSDTKILPADV
                     YAKFVGYVGQNKVSSTDLTTQPDSFVPFTAAKSLLNWTTYIKQINFKEVANLGGASWL
                     TNPSNRLDLSVDELLSIVAKYAFDNSYQNNAELAIISQQSLIDVNDKRLYDALGLRWV
                     LRNS"
     gene            298952..302527
                     /locus_tag="MGF_RS01285"
                     /old_locus_tag="MGF_1775"
     CDS             298952..302527
                     /locus_tag="MGF_RS01285"
                     /old_locus_tag="MGF_1775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574500.1"
                     /db_xref="GI:504387398"
                     /translation="MSQSKNKKYRIVKQVSFLSLISLAGVLVSSCGAAANANQLLMNK
                     FKTGFRTDGNNQNLGFIGNGNILGGQQDQARTVLATALKNNQGFQSLLSSLLSDSLAD
                     YYKNSKSSVLSNKYQNFSDDINDQLNTSIEDNKRIYGNNYMDLIQTQLFDSNGGTKES
                     YLQNQLNQKISNDFFDSLFKDSYLNYAPTMSTDADGFVVYSNLTKIPSRTILSDPANW
                     ANIRFTDGGFSATNNEQTNNEFLAQIQAFAFNQWVTDENPNLVSRIVFTSDTPKDGLN
                     SIFNDRTVSSTALVASYNFQAFKNPKDQPFDENKGMRAYNQFITRGLDSYVNSTTKGI
                     NIPNNLSSDSGGKLLMTASDMFNSFDVSFSAAYVQQYLKQTNNTNRDTVGVVQSDIDE
                     INLMNNFIRAKANGNTTNTYSQQITNNSLLKTGEANRTTDPYYNAYADLAAGTKDIHE
                     IFEWNGMKTVDSSKSDNSSTNVMSKNTNASKFLFSRGRDGIHVMAIDGGDYYLNQSGM
                     TRNITKQKEFLAYRSLLRSSINLSENERYDFDLSTQIKNHFNKNQTLNLYLALSKMYE
                     EAVAKSTDKNNIFNIEDNANFSFRTSFKKVYDLVNNLVKAEVAYQNALNLDAQVKNIR
                     TKIYDRAKGFEDNERTNQTANNGIAARLPYVRAVDGSFNGLEQYYLSLYGLQPTTSSK
                     GTVAEISKNLADKKTARDAEIDNLLTKLKVQTTLLNNESQNTFVEVKSDDQTLNQWSG
                     LYLAVNLAVGSIISTSTLTNEIRIDYIRSNPNFREFFNVANNQVFSFQGINQQLLVDV
                     IRNVFKLSAFNGLSDKTSYGIYTNFSSLNQIIDKVWDEQLANAQQGSDLRFSYYRFLY
                     TFQWLLRNNLQNFKNLAMLNMRPGDVAFATWSLPINFNAEVAPASNNQPVDAQANNQS
                     FNPLITFDQNPNGILGSFQANWQNMVASEASKISAPNYWDNSSLTYNVSSSENTPTTP
                     QYGFAGLVFKNSSAPISNELKSALFSTYGSSGEQGAFYGFGSKVNLLTYVDNIKTERE
                     LDELARSITNETRVPNNTYFGNNSDNKPLTFDEKVVEIKKMIEMIPAQAFERYVGYIG
                     TTKSTNFELNHSLYLQGSLRRVAAYVKEVSYNDLTNLGAGWLTDTTKALGLSPSELLT
                     VVAMTANNSTVQIQAINELTANNKLTVFDQRLYNALGTIFGRKLS"
     gene            302535..303311
                     /locus_tag="MGF_RS01290"
                     /old_locus_tag="MGF_1789"
     CDS             302535..303311
                     /locus_tag="MGF_RS01290"
                     /old_locus_tag="MGF_1789"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574501.1"
                     /db_xref="GI:504387399"
                     /translation="MTDTKQKFCIRNWYHQTLTKSQRVFLVVLLFNAAGLGFVVYNFF
                     SSLQTNAFGSPFMNGFTTISSFTNQTSVLLFIFSFVFVFYPNNSLLKNERFLVFCMTY
                     TLFTFLTGGIFQNLVDQTANRTNFSRASLASGIFLQIVNPIVFIFCGYLRFVFNPIKK
                     IRRYSKFILPGMIYPIIYMIYVLTIPLVYKTPDNVVYSVYGNYTNVITNRTMAITIGV
                     LMTFLYFPGSFIFIIFFIRKFNNHYYRVAQIRVRLGLKSK"
     gene            303318..304109
                     /locus_tag="MGF_RS01295"
                     /old_locus_tag="MGF_1795"
     CDS             303318..304109
                     /locus_tag="MGF_RS01295"
                     /old_locus_tag="MGF_1795"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574502.1"
                     /db_xref="GI:504387400"
                     /translation="MNRLKLKKVSFKSWYKNQLTRSQKIFFFAFIVNAISILLVFQGL
                     FVLLFKGRDGFLSLDKFTNQTNILIFFFSLFYVFFPKHSFLKNDKFLIACITYIFITF
                     FVYNLVSIANAVAVIVAPKSILAWSYTRIGYGSKATAFLLFIDLFKHLFNPIVFIVCG
                     FFKFVYYPNLKLKKISSYLLPMIIYPAIYCVYVIVAPFIYKQENGMTYSVYNVATNTK
                     DYPQFAYPVLFFLLFVLIPVTTYLTWFGARKISEKYEQNQVVINP"
     gene            304136..304942
                     /locus_tag="MGF_RS01300"
                     /old_locus_tag="MGF_1802"
     CDS             304136..304942
                     /locus_tag="MGF_RS01300"
                     /old_locus_tag="MGF_1802"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574503.1"
                     /db_xref="GI:504387401"
                     /translation="MNQIDKKPKSFSFWFKYELTKAQKIFFFVFWLNLATVIFIVQEV
                     VAELLSNVNSVNNLNNFVDAYRTFDKFTNQSNFILLVFSFFYVFLPRHSFLKKDKFLV
                     ASIVYILFTFFGYNIILQFGRLGYRFITNPTKLARGLMVHLFNPVTFIIAGFLAFVYS
                     PARSIGKFHTYLIPGVIYPIIYGIYVISVPYLYKTVDGSIYSVYGGVTNVIENPKIAW
                     AAIIALLFGYFPLSYFIVWISYVKISKKYIDYPASLRKKSIKFIKFKMKQ"
     gene            304960..306759
                     /locus_tag="MGF_RS01305"
                     /old_locus_tag="MGF_1805"
     CDS             304960..306759
                     /locus_tag="MGF_RS01305"
                     /old_locus_tag="MGF_1805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886180.1"
                     /note="back-translocating Elongation Factor EF4; binds to
                     the ribosome on the universally-conserved alpha-sarcin
                     loop; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor 4"
                     /protein_id="WP_014574504.1"
                     /db_xref="GI:504387402"
                     /translation="MDKKNIRNFSIIAHIDHGKSTLSDRLIEITETVSKREMKNQLLD
                     SMELERERGITIKLNAVQLKFKRNNQDYTFHLIDTPGHVDFTYEVSRSLAACEAALLV
                     VDATQGVQAQTLSNVYLALENNLEIIPVINKVDLPSADVERVKREIETKIGIDCSDVP
                     LISAKTGLNIDQVLDAIIKKVPSPNNANDNDPLKALIFDSYYDPHKGVVCFIRIFDGK
                     LKVGDEILFMANNVKYVVTEVGIKNPNMQSRAYLEAGEVGYVTASIKTIRDVHVGDTI
                     TNANNPCDKPLAGYRKVSPMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYEYETSN
                     ALGFGVRCGFLGLLHMDVIRERIVREYNIPLILLAPSVMYKCYLTDGQELKVDNPANM
                     PERNRIKSMLEPYVKLSISTPDEFIGPIMELCQNFRGEYMELSEIDSSRKVLVYEIPL
                     AEIIYSFFDKLKSVTKGYASLDYELIGYRDSNLVKVDILLNGQKVDALSFISHTQFVY
                     QKAKKIVEKLKTLIPRHLFEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDVSRKKK
                     LLEQQKEGKKRLKAIGSVQIPQETFSKLLQDDE"
     repeat_region   305536..356917
                     /note="F strain 25k tandem repeat, containing TTAAAAGCA
                     sequences at repeat junctions"
                     /rpt_unit_range=305536..331222
     gene            306752..308194
                     /locus_tag="MGF_RS01310"
                     /old_locus_tag="MGF_1816"
     CDS             306752..308194
                     /locus_tag="MGF_RS01310"
                     /old_locus_tag="MGF_1816"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="permease"
                     /protein_id="WP_014574505.1"
                     /db_xref="GI:504387403"
                     /translation="MNNQFDWLLVQLSNQASIVLSERYKISLIINVVLFLFALIISII
                     FFWRIKFENKGYKKLFVFYSIFWLPIFLVRSYRGTLHNDLALDRNLLFLPLSLYGFVG
                     IFFRPLFDYLGIRFKSRKKVVFAALLLQLATFIPIIIKPSFATNFIQTIGVGIAASCI
                     GSFSLWFNEQHAKEKPFLAISILSIPPLIADFVASPVQSLVRTLAITTQRTADVNITK
                     YLWLIGLIVILINIVFWWFLRENPQFVGLKKHDPKDIIDGSPNKIYCFIVVILFAGIV
                     IFTKFATADGIAQITLQQLVGNSNSAPYEGYLSSVFSAAQLLGGVLMGVVGVKYFDKW
                     MVALIGSIFFVLYNTSMILLINSTSVPTLTKGGIYLGIQAISGFGYGILYNLLIAHAL
                     SYGFKNNKITPIGINQTTASIAITSANFFTTFIRDKISSDFVKANTVISYILIGTVLA
                     GLSLYFFNSWIDHDKKLKPIFWIKSFKSCI"
     gene            308262..314198
                     /locus_tag="MGF_RS01315"
                     /old_locus_tag="MGF_1830"
     CDS             308262..314198
                     /locus_tag="MGF_RS01315"
                     /old_locus_tag="MGF_1830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="putative cytadherence-associated protein"
                     /protein_id="WP_014574506.1"
                     /db_xref="GI:504387404"
                     /translation="MPKMIKGTEFIVAKKTKNKKKNHFEDIQTTNDINEEESEAIFGN
                     LYDGADEVLPASLAYENGQLPEDGSIQVAFDADDNAYYISYDHENEIFIEPYEKYELD
                     ASALYDAEGNPFDFFANYHVEGAEAAQEEESGEYWEQFVGVEGYGYYDENEEWVWTGY
                     FDEDNKFIPNEEEEPAEVEALEEKSEAAEEVVEQEPQEEVQAEEVEEQPESKQEGSGE
                     YWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEDAAVAGDEQVEEYSAQEE
                     QAQEEYKQQPEQEVSGEYWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEY
                     GQPVNEEEYAESVSEEQVPVSEEQVVEEPAEVEEVVEEPAVEQVPEEAQPEQVQEEVQ
                     AYEHVEEQQPEEAYVEKQPQEEMVVVPEKAEEYVQEQPEEATADAIDEYYDEITHVED
                     EVVEEEQIQTDNFVSSDEINWSNYVGNEDYGYYDENNEWVWKGYFNEYGMFIPQQEDY
                     TDSIPVDEQPVEQTADLAEQAEEEVVEEPTASDEIVQVEEEEVESEPVVPTVTDDLVA
                     LEQPFEFDTQQFVGNIDFGYYDESSEWIWTGHFDKDGKFFDFDGNLVYSPQEGVKPVE
                     VPKPTDLTDQIPQNALVVAEPDVFSEDIIQQVDENQFDVGEELVVRGLLNPTSRPIQP
                     QELNIKPVFEEEKLNLPVLANEVSLQPEEPKVDYSKRSDSDQLVTQTPVVLEDAVADD
                     LISVDTKGFVPELSQPTFAPKAVSQDQFKLVQPVVSQPKFDQITHLADEIKMDVNVTS
                     SDVDVQPIQINPSLEVASEPSKLDIFVKKPAVELKKIEFIEPVSEKIDLQIFEQQEIV
                     TKPVSTIQKPTYTDETVSVSVNAIDETTSETDTIVQVTPTTSEASDFDINKILNTKPV
                     ETITVELPKDEPKLVTGVHVSLVDVEAKPVEEIVEFDSPKPSVSEVVVEKEDKVTLVE
                     EEPFFNKFIGNEQYGYYNNKNVWIWTGYFDDQNNFVSDKDSKTQKVDQLIEEFNKQEA
                     IKKTEEVEAKKASEPFYNKYIGNKQFGYYNDKNVWIWNGYFDENDQFVPDQSSTKRSE
                     KLIEDELQKQRIHELELELAQAQQAILESTKLKDQEVAKIKEEVLKVQQEAIKAKEVA
                     TLRNFVPKGSPLLNPAKEVENSMIVYQEDKLEVNDLRNELSKLKTQREEFDNFSKIRD
                     LDVINLYNASTSHRGMDYVFSGFEKKEEQFVKKPLHFLEEVKADPVQVAKEETISNLD
                     QLLKQDPHLLLAKKTDKSVNPQASLTVLADQKEVELTQQAVRKQAEAIEAERVDVIKP
                     LEQVQLNQSRSLLDDLTPKFEVKPSLIKDDVIQPKYNDDLEPIEQLQFKQERSLLDDY
                     MPKFDDQGLFSKVEFKLPTVNKEYRPKVEPIDVIKPLEPVRINKERSLLDDYLPPKLN
                     AQPTFEKTELDLGLEKPLANGELYEELKAEFSTTITPADSKDMIDQLLEETNDLITSS
                     TQTRSTKIHSFSKSPLKTEPEPILDTKFDDKFIELDENQGFDQLIVESDDELLTDVVQ
                     EQVSVNQIAVTNEEYKKDMAELKQFLEKRSEELFKQYFSKFEELTKLQMESFNQIKNE
                     LRSEMNEIRDEVRSNKLALTSEITEEIYPSAPKVSRKQRGVHGFSEPTSEFDFDNSLS
                     LVNENNYDLYELLDRIINYEDVPLTSSNLFKAEEYQAKVKQSVYNIKLILKNSEAEAT
                     KNYNYILSTLKNEITLLQKDLPIISSQLNKLQHDLRAKQLNRGDYKFVQEQIQELRAE
                     HANKTRAISFYNKKVSDLKSIYAQQIRKIKSDYKKISDLANKRKVSSDYIDQALQSFE
                     TARVSQPNIKRNYEQLYRNQLQQNVNANYGNFRRYDPLIENPGYEYFSNHQPREFFSE
                     LESIDNDIFSSNDLIYSNRNTYLDENFRINDYELTSNFNDIDAIYGMDKLRLPPFEPS
                     NLVNDMEFNSSFDIDFDTDF"
     gene            314245..315231
                     /locus_tag="MGF_RS01320"
                     /old_locus_tag="MGF_1865"
     CDS             314245..315231
                     /locus_tag="MGF_RS01320"
                     /old_locus_tag="MGF_1865"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884799.1"
                     /db_xref="GI:500214635"
                     /translation="MNNEQTKTLDLGINANHNSYGSINAPSRAAQIQEKEYSGVFNPG
                     SLEVTNLKEESAQSLNNLERSIPWFYKREIFYNTLDLIFGLLVILGFGTGLILLCLYI
                     YFNNKSWHIVWAALPFGILALFIGYRTISSYANIKGGLKHEYIFSKAQIAVNIKRAYK
                     NLRLIPVNMNWLSAAIYLTITIAIIVTLVSAFAINLITIANLNQEFTREQINAAKTFG
                     YLYVLKANSELDKWPLYSIIVNGTIGIGTLILQIYLIINSSIRARAIENFYGKMPIEE
                     EDMHRAIVAANKRNFKIFLVYLVIIGLVVLLVKKIITGSLSAINKKKVISIK"
     gene            315231..316100
                     /locus_tag="MGF_RS01325"
                     /old_locus_tag="MGF_1868"
     CDS             315231..316100
                     /locus_tag="MGF_RS01325"
                     /old_locus_tag="MGF_1868"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="haloacid dehalogenase"
                     /protein_id="WP_014574507.1"
                     /db_xref="GI:504387405"
                     /translation="MSDLDKNKQLKLIGIDLDGTLLSIRKKVTKKVIGSLLELRKKLP
                     NIVIAIITGRSYLSAKRVVNELQEAGVKINYLCSYNGSVLFKINEQSELIKLDEHSID
                     SLTTKAIFDYCTKNKIVFQGYLVTDEVNRSIVLSDNFSGRLIASFNKNKSFCSKDFVD
                     GRYYKINLISSNHKRLKRFNQFVSENYSDDLEIANIYPTFLEITTKNINKAFALASVC
                     DLENISLEQTAVIGDSLNDYSMFEIASYKFAMKRANKKLKDISTYIASSRRHNQFKEI
                     IQKTIAIVDDEKK"
     gene            complement(316479..317345)
                     /locus_tag="MGF_RS01330"
                     /old_locus_tag="MGF_1879"
     CDS             complement(316479..317345)
                     /locus_tag="MGF_RS01330"
                     /old_locus_tag="MGF_1879"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="haloacid dehalogenase"
                     /protein_id="WP_014574508.1"
                     /db_xref="GI:504387406"
                     /translation="MKNKKLLIISDLDGTLLNDESKLSYQTIKVIKLLNKLGHHFCIA
                     TGRPSRASIDIYNELGLNTVMANLNGSYIWHPKDRFFKAINLSFSKDIVKNLLHKTSI
                     IKLVDNFIVENNEGTYIMNKPVSSREHDELLQCFHIDGKDNCTFGQDKILNLRQDPNA
                     ILLQVKNPHNIDEVVFQLKECFSTFVVRKWSLPVSGIIIEVNTVYANKGNALDYLSSY
                     YGIPKEFVVTFGDGENDIEMLQKSRFGYAMKNAISSAKLLARYITKYNNNDHGVGFEL
                     FHKIIKRSLKNS"
     gene            complement(317348..318400)
                     /locus_tag="MGF_RS01335"
                     /old_locus_tag="MGF_1886"
     CDS             complement(317348..318400)
                     /locus_tag="MGF_RS01335"
                     /old_locus_tag="MGF_1886"
                     /EC_number="6.1.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="WP_014574509.1"
                     /db_xref="GI:504387407"
                     /translation="MIKIISGIQSTGSLHIGNYLGSISKNINLQNKYQLNLFVANLHT
                     ITVDFDPTQARQNIIELVKIYLASGFDTNKNNIFLQSEINEHAALGHVLLCHTTMGEL
                     ERMTQYKDKKQKFVQSNQTIKIPTGLLTYPTLMAADILLYQSDYVCVGDDQKQHLELT
                     RDIAIRMNKRYGELFKVPEPIIAKVGSRIMDLNDPSKKMSKSSLSKKGIINLDDSREE
                     VLSKIKSAKTDNLNKVNFDYKTQPEISNLVSIYYGVINDHFNLGLKSAKFNKTLDEEV
                     VPIDIIKHFENKSYKDFKEELLELIWNILDNIQTNMKKITDEDVMRVLKSGKDKLLPI
                     AQKTLLKVYQKLGMVI"
     gene            318473..318952
                     /locus_tag="MGF_RS01340"
                     /old_locus_tag="MGF_1885"
     CDS             318473..318952
                     /locus_tag="MGF_RS01340"
                     /old_locus_tag="MGF_1885"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="regulatory protein"
                     /protein_id="WP_014574510.1"
                     /db_xref="GI:504387408"
                     /translation="MTNNQNSQTNNIVLFITASCIGCTRVRRFFREYNIQHKEINFYK
                     TAIEEKYFNDILSLTENGVFDIISTRSKYLQNNKVNIDELTISQLITLVNEHPSILKR
                     PIILQYDKSGIPKRLMVGYNSTDIRVFLREVADVKAYYLDEYWFDDESSPSSRKEDE"
     gene            318909..319733
                     /locus_tag="MGF_RS01345"
                     /old_locus_tag="MGF_1890"
     CDS             318909..319733
                     /locus_tag="MGF_RS01345"
                     /old_locus_tag="MGF_1890"
                     /EC_number="2.7.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="WP_014574511.1"
                     /db_xref="GI:504387409"
                     /translation="MMMKVHQVQEKKMNKTYYLISSLAPKSESLKPLIKKELNKKLVE
                     VDDPTVADYLFINGGDGTFIKNAIKYDRAGLKIIGINGGSLGFYTTFNETNIDQIANN
                     LDQLKYTQLDFIKLQIDDQIYHALNEFNINSTTAYGYDIFIDNEFYQKFRGTGLLIST
                     TTGSTGINKSANGAILFPRIKAIQMVELHPLLHSSFTTIQSPIILPIDTKIRIEIKEN
                     YCDHDACPRIVADGAVIRQGLSSTTIEISATRSQADYVATTDLRSYMQRLQKTFIY"
     gene            319816..320193
                     /locus_tag="MGF_RS01350"
                     /old_locus_tag="MGF_1897"
     CDS             319816..320193
                     /locus_tag="MGF_RS01350"
                     /old_locus_tag="MGF_1897"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_014574512.1"
                     /db_xref="GI:504387410"
                     /translation="MYFKMNKFTWIFLNIITFGILRLVATKKAKRISSQINQELIKSE
                     KLPFDLDQFINILGGLENIQTTQATLNMIKINVVDKTKVNQDQIKSRLKINGIMWASH
                     DLSLVCGDYASSLSEQIIQLKNR"
     gene            320291..322045
                     /locus_tag="MGF_RS01355"
                     /old_locus_tag="MGF_1899"
     CDS             320291..322045
                     /locus_tag="MGF_RS01355"
                     /old_locus_tag="MGF_1899"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="WP_014574513.1"
                     /db_xref="GI:504387411"
                     /translation="MPIIRMNKKNRSLKDAPKSKKIGFFSGITIAIGSSIGAGIFFKA
                     QAVLQNSHYSLAFAIFSWLFAAFSVTSMALALVEISSGRNDNLSIIGWCQTFNNHYVY
                     KTCKNFMVYIYVPLTYFFMPFFFLLSIQDGIRGFNENYHGLNTKADWAILMLISVGIS
                     AYFIVVSGISSSAANFQNLIISVVKFLPLLLAIILGFVIFNHNGSKPVNPKIGLGFQN
                     SATTDLATKYSFSNLSPGFGLFISVGGIYFAYDGFYYAAGIQTEMKKPQKTPLAILIG
                     LLFVTLVYLIMAIAMSLGSTDGSPFGFKEYFARNDLLPLYAAFQITIGVGILGIINGL
                     SLWANRFMEDLIKKFELPFSMKLINKISPNKVVVGMQYNLILAVPVVIIASLIGGLGY
                     IDNSYSDADYGTGVGRIYSFSDLMANWTSVIAFVYIVIAIMGGLANRKTNKIKVNKSK
                     IFVPSAVCAIFTMVVSVSLTFFQPIADALLLYNIPFNDQYKNVYISRVLLVLVLFVFL
                     FIMFIPILIEDQLMIKSYGSVSKGELAKLRIKAEVKKTSFKQELLDYIKTLKTKDLND
                     DLKAALKEVNVEVDELII"
     gene            complement(322100..322762)
                     /locus_tag="MGF_RS01360"
                     /old_locus_tag="MGF_1913"
     CDS             complement(322100..322762)
                     /locus_tag="MGF_RS01360"
                     /old_locus_tag="MGF_1913"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="large conductance mechanosensitive channel
                     protein MscL"
                     /protein_id="WP_011884781.1"
                     /db_xref="GI:500214617"
                     /translation="MKDLFNKDKQVSLSKNAMKNATQVVKRGNIFMLAIGLLLGTSFN
                     AVIASLANDVIIAAIAKLYNVQDLQKWQVQGIFIGKFFAALLSFVIINVILVSALFVS
                     YYIIEVRKAIKAKQLLAEGVNPTTTKPIEINKDEKIIELLEYNNMLLQQQIEIFGKAH
                     NMKVEILSKKFSDSVISVPFDINKPEPQSVEAANLEKMLRPNAQNAVSTSNWSGTEGL
                     IG"
     gene            complement(322816..324015)
                     /locus_tag="MGF_RS01365"
                     /old_locus_tag="MGF_1918"
     CDS             complement(322816..324015)
                     /locus_tag="MGF_RS01365"
                     /old_locus_tag="MGF_1918"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Ion channel protein"
                     /protein_id="WP_014574514.1"
                     /db_xref="GI:504387412"
                     /translation="MNLGFSKFKIGRNKLMRILSIIVWSKSDIDEHLVQYEKRIKLFR
                     GIYALIIVFASLISFVTLVITPKTDNNNIFAQFAKVTLLLTFFVFITDWLAHAFTYKH
                     ATGLPQIKFVKAFLKYFFTFNSIVIIICVLSSGQAIKFFVTNLSATNELIFASFQSLA
                     LVKTIRLFMVLSLFKPFGAITSVFVTQKKLLASVFLIIIVLIILFAIIIWSQETVELL
                     RKRAAFLTQVSDNYLNFSQFAVFIHLNKLMQGSGQYEEAINKITDAQIQAAASALNSV
                     DASNFASLSSGYVQNFTEAFYFTTITLTTVGYGDFVPHAPISRVIVSFISLLAISIIA
                     IPSGIIAGSFLTEMQKSSERNKVKTKKNPDNKKDNFFMIPKKKQAETNIKKKPLDQCE
                     LIPIKQN"
     gene            complement(324620..325783)
                     /locus_tag="MGF_RS01370"
                     /old_locus_tag="MGF_1923"
     CDS             complement(324620..325783)
                     /locus_tag="MGF_RS01370"
                     /old_locus_tag="MGF_1923"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574515.1"
                     /db_xref="GI:504387413"
                     /translation="MNKQNILEKNKLNIKRISVTIVSFIVLLIAVLTFIFLKNISFKK
                     IFDILRDPSDTRQKVFIFLIFACMVYGFLWQFLTLYIIARRYKVKTRWYDWLIYALVS
                     TLINNVTPFAAGAEPYKVYWLVKNKVKLSDAITVVGATAIYWSIVQITVTWPSFIYIS
                     TNYNLLIESKSGIIAYWFSFFGMLVDFGIFTTFATAVFSVKFHLFVYKVVNKIRKLLK
                     LKDLTEDKRLEYVNQKKAFIKEFKHYWVVIFMFLFTASLVIFQYSSVYMSLVILDSKL
                     TDLYNFIKVFNFSNVAITANNFIPIPGGEGTIQVTLELYFQSLVNPSLLSREFIRYFD
                     SKAFNTDINNTIFLWRFALFYLPTMIGIIPSLYEIIVYFKSLHKPKNSTVIIT"
     gene            325968..327749
                     /gene="dnaK"
                     /locus_tag="MGF_RS01375"
                     /old_locus_tag="MGF_1924"
     CDS             325968..327749
                     /gene="dnaK"
                     /locus_tag="MGF_RS01375"
                     /old_locus_tag="MGF_1924"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886168.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="chaperone protein DnaK"
                     /protein_id="WP_011113796.1"
                     /db_xref="GI:499426332"
                     /translation="MSNNNGLIIGIDLGTTNSCVSVMEGAQKVVIENPEGKRTTPSVV
                     SYKNGEIIVGDAAKRQMLTNPNTIVSIKRLMGTSKKVKINDKGVEKELTPEEVSASIL
                     SYLKDYAEKKTGQKISRAVITVPAYFNDAERQATKTAGKIAGLTVERIINEPTAAALA
                     YGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTFEVMATAGDNRLGGDDWDNKIIEWI
                     IAEIKKDHPSLDLKSDKMAMQRLKEAAERAKIELSAQLETLISLPFIAVTPEGPVNAE
                     LTLSRAKFEELTKDLLERTRNPIADVLKEAKVDPSQVDEILLVGGSTRMPAVQKLVES
                     MIPNKAPNRTINPDEVVAIGAAVQGGVLRGDVKDILLLDVTPLTLAIETLGGVATPII
                     KRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGGIQPAPKGKP
                     QIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAI
                     VKQRIEMRYEGEGIVNTINEILGSKEAEALPAQEKASLTKIVDGINGALKAEKWDELK
                     EQIDGFKKWRDDMSKKYGGGEAPAEPK"
     gene            328032..330209
                     /locus_tag="MGF_RS01380"
                     /old_locus_tag="MGF_1934"
     CDS             328032..330209
                     /locus_tag="MGF_RS01380"
                     /old_locus_tag="MGF_1934"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574516.1"
                     /db_xref="GI:504387414"
                     /translation="MAKKTTWLKLFCSLSGLSVISSSCFNPESFFSFKNESDTIKLSN
                     ITSNDLTVSDKLTHNNLLASNITSSNFSRYFELKLVQKADEQQDLDEQQDLNNLVDIK
                     VGGFSADDSNGILSFIVTLEKKNSNPVEFKQVSLEINGFLKKQEPVSQPKNDTDNVKK
                     PENSNNDESTDTTPPPTSDEPSTDQEKNPNSSDESSTDQSSSPTTVDETKKVDETKKP
                     EPSSSETKLRVFSDQEIYKKIYDRTFSLEFYTRYTRKNSSNSNIEQLYYLNNGTGWLL
                     DYQVSPQNPDLYRLFLATNLHVAQTLWNKNDFDRPVTDLKSAPETIGFSLGKSDQVEF
                     SAQNSSLNNSVVKYATLLDNTAFYNRVPNRANSWRVSSQRLTIPQTVFAAVDFVNDQE
                     TTQEFSSYWANQFKTQFVNNRLDDKNLLEHTYPKDAESRTKIADKYLEQGIGLYKDFA
                     VLSVVVNLSPKMLANETAQRYDGSRLLRKYVLEAIHELNESSRLAKLPGQLNLTNQDL
                     PYVDLDYPSIDQNQPNAYSFEEINKAYIAGYPGVEDSSNSSRVNFRWVQNNLNKDPNY
                     QLKPNINSGLVNKTQDITGLIQSYHNKYYHQYGITQEVLRSSLRSGSSGSVVYSKYGL
                     PFGIFWGGYNGGDPQQEENNRGLFDYLANDTKKSLNINVRYSNPNRASRFKINIEPYN
                     LIDGTNKQKYPNQTNSYREALAKYLVWSQNNNFSNSTYLFSHP"
     gene            complement(330789..>331229)
                     /locus_tag="MGF_RS01385"
                     /old_locus_tag="MGF_1948"
     CDS             complement(330789..>331229)
                     /locus_tag="MGF_RS01385"
                     /old_locus_tag="MGF_1948"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886166.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594430.1"
                     /db_xref="GI:753838813"
                     /translation="AFNDHYSHMQTANYNKLREKMNLPLFKDYSKIFTEEDKAKLILQ
                     GLLGSIRGDLIRDKAVIRGRVVTTGHSYNIGTDNVMKKHHLLYSENYYGSYNTPTIST
                     RNVELSYGLLATRMFKTVLGEKDSFKNTSFIKAGKTLQITEVTY"
     gene            <331222..332445
                     /locus_tag="MGF_RS01390"
                     /old_locus_tag="MGF_1950"
     CDS             <331222..332445
                     /locus_tag="MGF_RS01390"
                     /old_locus_tag="MGF_1950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886180.1"
                     /exception="unextendable partial coding region"
                     /note="back-translocating Elongation Factor EF4; binds to
                     the ribosome on the universally-conserved alpha-sarcin
                     loop; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein LepA"
                     /protein_id="WP_041594431.1"
                     /db_xref="GI:753838814"
                     /translation="LKALIFDSYYDPHKGVVCFIRIFDGKLKVGDEILFMANNVKYVV
                     TEVGIKNPNMQSRAYLEAGEVGYVTASIKTIRDVHVGDTITNANNPCDKPLAGYRKVS
                     PMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYEYETSNALGFGVRCGFLGLLHMDV
                     IRERIVREYNIPLILLAPSVMYKCYLTDGQELKVDNPANMPERNRIKSMLEPYVKLSI
                     STPDEFIGPIMELCQNFRGEYMELSEIDSSRKVLVYEIPLAEIIYSFFDKLKSVTKGY
                     ASLDYELIGYRDSNLVKVDILLNGQKVDALSFISHTQFVYQKAKKIVEKLKTLIPRHL
                     FEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDVSRKKKLLEQQKEGKKRLKAIGSV
                     QIPQETFSKLLQDDE"
     gene            332438..333880
                     /locus_tag="MGF_RS01395"
                     /old_locus_tag="MGF_1957"
     CDS             332438..333880
                     /locus_tag="MGF_RS01395"
                     /old_locus_tag="MGF_1957"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="permease"
                     /protein_id="WP_014574505.1"
                     /db_xref="GI:504387403"
                     /translation="MNNQFDWLLVQLSNQASIVLSERYKISLIINVVLFLFALIISII
                     FFWRIKFENKGYKKLFVFYSIFWLPIFLVRSYRGTLHNDLALDRNLLFLPLSLYGFVG
                     IFFRPLFDYLGIRFKSRKKVVFAALLLQLATFIPIIIKPSFATNFIQTIGVGIAASCI
                     GSFSLWFNEQHAKEKPFLAISILSIPPLIADFVASPVQSLVRTLAITTQRTADVNITK
                     YLWLIGLIVILINIVFWWFLRENPQFVGLKKHDPKDIIDGSPNKIYCFIVVILFAGIV
                     IFTKFATADGIAQITLQQLVGNSNSAPYEGYLSSVFSAAQLLGGVLMGVVGVKYFDKW
                     MVALIGSIFFVLYNTSMILLINSTSVPTLTKGGIYLGIQAISGFGYGILYNLLIAHAL
                     SYGFKNNKITPIGINQTTASIAITSANFFTTFIRDKISSDFVKANTVISYILIGTVLA
                     GLSLYFFNSWIDHDKKLKPIFWIKSFKSCI"
     gene            333948..339884
                     /locus_tag="MGF_RS01400"
                     /old_locus_tag="MGF_1971"
     CDS             333948..339884
                     /locus_tag="MGF_RS01400"
                     /old_locus_tag="MGF_1971"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="putative cytadherence-associated protein"
                     /protein_id="WP_014574506.1"
                     /db_xref="GI:504387404"
                     /translation="MPKMIKGTEFIVAKKTKNKKKNHFEDIQTTNDINEEESEAIFGN
                     LYDGADEVLPASLAYENGQLPEDGSIQVAFDADDNAYYISYDHENEIFIEPYEKYELD
                     ASALYDAEGNPFDFFANYHVEGAEAAQEEESGEYWEQFVGVEGYGYYDENEEWVWTGY
                     FDEDNKFIPNEEEEPAEVEALEEKSEAAEEVVEQEPQEEVQAEEVEEQPESKQEGSGE
                     YWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEDAAVAGDEQVEEYSAQEE
                     QAQEEYKQQPEQEVSGEYWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEY
                     GQPVNEEEYAESVSEEQVPVSEEQVVEEPAEVEEVVEEPAVEQVPEEAQPEQVQEEVQ
                     AYEHVEEQQPEEAYVEKQPQEEMVVVPEKAEEYVQEQPEEATADAIDEYYDEITHVED
                     EVVEEEQIQTDNFVSSDEINWSNYVGNEDYGYYDENNEWVWKGYFNEYGMFIPQQEDY
                     TDSIPVDEQPVEQTADLAEQAEEEVVEEPTASDEIVQVEEEEVESEPVVPTVTDDLVA
                     LEQPFEFDTQQFVGNIDFGYYDESSEWIWTGHFDKDGKFFDFDGNLVYSPQEGVKPVE
                     VPKPTDLTDQIPQNALVVAEPDVFSEDIIQQVDENQFDVGEELVVRGLLNPTSRPIQP
                     QELNIKPVFEEEKLNLPVLANEVSLQPEEPKVDYSKRSDSDQLVTQTPVVLEDAVADD
                     LISVDTKGFVPELSQPTFAPKAVSQDQFKLVQPVVSQPKFDQITHLADEIKMDVNVTS
                     SDVDVQPIQINPSLEVASEPSKLDIFVKKPAVELKKIEFIEPVSEKIDLQIFEQQEIV
                     TKPVSTIQKPTYTDETVSVSVNAIDETTSETDTIVQVTPTTSEASDFDINKILNTKPV
                     ETITVELPKDEPKLVTGVHVSLVDVEAKPVEEIVEFDSPKPSVSEVVVEKEDKVTLVE
                     EEPFFNKFIGNEQYGYYNNKNVWIWTGYFDDQNNFVSDKDSKTQKVDQLIEEFNKQEA
                     IKKTEEVEAKKASEPFYNKYIGNKQFGYYNDKNVWIWNGYFDENDQFVPDQSSTKRSE
                     KLIEDELQKQRIHELELELAQAQQAILESTKLKDQEVAKIKEEVLKVQQEAIKAKEVA
                     TLRNFVPKGSPLLNPAKEVENSMIVYQEDKLEVNDLRNELSKLKTQREEFDNFSKIRD
                     LDVINLYNASTSHRGMDYVFSGFEKKEEQFVKKPLHFLEEVKADPVQVAKEETISNLD
                     QLLKQDPHLLLAKKTDKSVNPQASLTVLADQKEVELTQQAVRKQAEAIEAERVDVIKP
                     LEQVQLNQSRSLLDDLTPKFEVKPSLIKDDVIQPKYNDDLEPIEQLQFKQERSLLDDY
                     MPKFDDQGLFSKVEFKLPTVNKEYRPKVEPIDVIKPLEPVRINKERSLLDDYLPPKLN
                     AQPTFEKTELDLGLEKPLANGELYEELKAEFSTTITPADSKDMIDQLLEETNDLITSS
                     TQTRSTKIHSFSKSPLKTEPEPILDTKFDDKFIELDENQGFDQLIVESDDELLTDVVQ
                     EQVSVNQIAVTNEEYKKDMAELKQFLEKRSEELFKQYFSKFEELTKLQMESFNQIKNE
                     LRSEMNEIRDEVRSNKLALTSEITEEIYPSAPKVSRKQRGVHGFSEPTSEFDFDNSLS
                     LVNENNYDLYELLDRIINYEDVPLTSSNLFKAEEYQAKVKQSVYNIKLILKNSEAEAT
                     KNYNYILSTLKNEITLLQKDLPIISSQLNKLQHDLRAKQLNRGDYKFVQEQIQELRAE
                     HANKTRAISFYNKKVSDLKSIYAQQIRKIKSDYKKISDLANKRKVSSDYIDQALQSFE
                     TARVSQPNIKRNYEQLYRNQLQQNVNANYGNFRRYDPLIENPGYEYFSNHQPREFFSE
                     LESIDNDIFSSNDLIYSNRNTYLDENFRINDYELTSNFNDIDAIYGMDKLRLPPFEPS
                     NLVNDMEFNSSFDIDFDTDF"
     gene            339931..340917
                     /locus_tag="MGF_RS01405"
                     /old_locus_tag="MGF_2006"
     CDS             339931..340917
                     /locus_tag="MGF_RS01405"
                     /old_locus_tag="MGF_2006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884799.1"
                     /db_xref="GI:500214635"
                     /translation="MNNEQTKTLDLGINANHNSYGSINAPSRAAQIQEKEYSGVFNPG
                     SLEVTNLKEESAQSLNNLERSIPWFYKREIFYNTLDLIFGLLVILGFGTGLILLCLYI
                     YFNNKSWHIVWAALPFGILALFIGYRTISSYANIKGGLKHEYIFSKAQIAVNIKRAYK
                     NLRLIPVNMNWLSAAIYLTITIAIIVTLVSAFAINLITIANLNQEFTREQINAAKTFG
                     YLYVLKANSELDKWPLYSIIVNGTIGIGTLILQIYLIINSSIRARAIENFYGKMPIEE
                     EDMHRAIVAANKRNFKIFLVYLVIIGLVVLLVKKIITGSLSAINKKKVISIK"
     gene            340917..341786
                     /locus_tag="MGF_RS01410"
                     /old_locus_tag="MGF_2009"
     CDS             340917..341786
                     /locus_tag="MGF_RS01410"
                     /old_locus_tag="MGF_2009"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="haloacid dehalogenase"
                     /protein_id="WP_014574507.1"
                     /db_xref="GI:504387405"
                     /translation="MSDLDKNKQLKLIGIDLDGTLLSIRKKVTKKVIGSLLELRKKLP
                     NIVIAIITGRSYLSAKRVVNELQEAGVKINYLCSYNGSVLFKINEQSELIKLDEHSID
                     SLTTKAIFDYCTKNKIVFQGYLVTDEVNRSIVLSDNFSGRLIASFNKNKSFCSKDFVD
                     GRYYKINLISSNHKRLKRFNQFVSENYSDDLEIANIYPTFLEITTKNINKAFALASVC
                     DLENISLEQTAVIGDSLNDYSMFEIASYKFAMKRANKKLKDISTYIASSRRHNQFKEI
                     IQKTIAIVDDEKK"
     gene            complement(342165..343031)
                     /locus_tag="MGF_RS01415"
                     /old_locus_tag="MGF_2020"
     CDS             complement(342165..343031)
                     /locus_tag="MGF_RS01415"
                     /old_locus_tag="MGF_2020"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="haloacid dehalogenase"
                     /protein_id="WP_014574508.1"
                     /db_xref="GI:504387406"
                     /translation="MKNKKLLIISDLDGTLLNDESKLSYQTIKVIKLLNKLGHHFCIA
                     TGRPSRASIDIYNELGLNTVMANLNGSYIWHPKDRFFKAINLSFSKDIVKNLLHKTSI
                     IKLVDNFIVENNEGTYIMNKPVSSREHDELLQCFHIDGKDNCTFGQDKILNLRQDPNA
                     ILLQVKNPHNIDEVVFQLKECFSTFVVRKWSLPVSGIIIEVNTVYANKGNALDYLSSY
                     YGIPKEFVVTFGDGENDIEMLQKSRFGYAMKNAISSAKLLARYITKYNNNDHGVGFEL
                     FHKIIKRSLKNS"
     gene            complement(343034..344086)
                     /locus_tag="MGF_RS01420"
                     /old_locus_tag="MGF_2027"
     CDS             complement(343034..344086)
                     /locus_tag="MGF_RS01420"
                     /old_locus_tag="MGF_2027"
                     /EC_number="6.1.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="WP_014574509.1"
                     /db_xref="GI:504387407"
                     /translation="MIKIISGIQSTGSLHIGNYLGSISKNINLQNKYQLNLFVANLHT
                     ITVDFDPTQARQNIIELVKIYLASGFDTNKNNIFLQSEINEHAALGHVLLCHTTMGEL
                     ERMTQYKDKKQKFVQSNQTIKIPTGLLTYPTLMAADILLYQSDYVCVGDDQKQHLELT
                     RDIAIRMNKRYGELFKVPEPIIAKVGSRIMDLNDPSKKMSKSSLSKKGIINLDDSREE
                     VLSKIKSAKTDNLNKVNFDYKTQPEISNLVSIYYGVINDHFNLGLKSAKFNKTLDEEV
                     VPIDIIKHFENKSYKDFKEELLELIWNILDNIQTNMKKITDEDVMRVLKSGKDKLLPI
                     AQKTLLKVYQKLGMVI"
     gene            344159..344638
                     /locus_tag="MGF_RS01425"
                     /old_locus_tag="MGF_2026"
     CDS             344159..344638
                     /locus_tag="MGF_RS01425"
                     /old_locus_tag="MGF_2026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="regulatory protein"
                     /protein_id="WP_014574510.1"
                     /db_xref="GI:504387408"
                     /translation="MTNNQNSQTNNIVLFITASCIGCTRVRRFFREYNIQHKEINFYK
                     TAIEEKYFNDILSLTENGVFDIISTRSKYLQNNKVNIDELTISQLITLVNEHPSILKR
                     PIILQYDKSGIPKRLMVGYNSTDIRVFLREVADVKAYYLDEYWFDDESSPSSRKEDE"
     gene            344595..345419
                     /locus_tag="MGF_RS01430"
                     /old_locus_tag="MGF_2031"
     CDS             344595..345419
                     /locus_tag="MGF_RS01430"
                     /old_locus_tag="MGF_2031"
                     /EC_number="2.7.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="WP_014574511.1"
                     /db_xref="GI:504387409"
                     /translation="MMMKVHQVQEKKMNKTYYLISSLAPKSESLKPLIKKELNKKLVE
                     VDDPTVADYLFINGGDGTFIKNAIKYDRAGLKIIGINGGSLGFYTTFNETNIDQIANN
                     LDQLKYTQLDFIKLQIDDQIYHALNEFNINSTTAYGYDIFIDNEFYQKFRGTGLLIST
                     TTGSTGINKSANGAILFPRIKAIQMVELHPLLHSSFTTIQSPIILPIDTKIRIEIKEN
                     YCDHDACPRIVADGAVIRQGLSSTTIEISATRSQADYVATTDLRSYMQRLQKTFIY"
     gene            345502..345879
                     /locus_tag="MGF_RS01435"
                     /old_locus_tag="MGF_2038"
     CDS             345502..345879
                     /locus_tag="MGF_RS01435"
                     /old_locus_tag="MGF_2038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="PTS sugar transporter subunit IIA"
                     /protein_id="WP_014574512.1"
                     /db_xref="GI:504387410"
                     /translation="MYFKMNKFTWIFLNIITFGILRLVATKKAKRISSQINQELIKSE
                     KLPFDLDQFINILGGLENIQTTQATLNMIKINVVDKTKVNQDQIKSRLKINGIMWASH
                     DLSLVCGDYASSLSEQIIQLKNR"
     gene            345977..347731
                     /locus_tag="MGF_RS01440"
                     /old_locus_tag="MGF_2040"
     CDS             345977..347731
                     /locus_tag="MGF_RS01440"
                     /old_locus_tag="MGF_2040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="WP_014574513.1"
                     /db_xref="GI:504387411"
                     /translation="MPIIRMNKKNRSLKDAPKSKKIGFFSGITIAIGSSIGAGIFFKA
                     QAVLQNSHYSLAFAIFSWLFAAFSVTSMALALVEISSGRNDNLSIIGWCQTFNNHYVY
                     KTCKNFMVYIYVPLTYFFMPFFFLLSIQDGIRGFNENYHGLNTKADWAILMLISVGIS
                     AYFIVVSGISSSAANFQNLIISVVKFLPLLLAIILGFVIFNHNGSKPVNPKIGLGFQN
                     SATTDLATKYSFSNLSPGFGLFISVGGIYFAYDGFYYAAGIQTEMKKPQKTPLAILIG
                     LLFVTLVYLIMAIAMSLGSTDGSPFGFKEYFARNDLLPLYAAFQITIGVGILGIINGL
                     SLWANRFMEDLIKKFELPFSMKLINKISPNKVVVGMQYNLILAVPVVIIASLIGGLGY
                     IDNSYSDADYGTGVGRIYSFSDLMANWTSVIAFVYIVIAIMGGLANRKTNKIKVNKSK
                     IFVPSAVCAIFTMVVSVSLTFFQPIADALLLYNIPFNDQYKNVYISRVLLVLVLFVFL
                     FIMFIPILIEDQLMIKSYGSVSKGELAKLRIKAEVKKTSFKQELLDYIKTLKTKDLND
                     DLKAALKEVNVEVDELII"
     gene            complement(347786..348448)
                     /locus_tag="MGF_RS01445"
                     /old_locus_tag="MGF_2054"
     CDS             complement(347786..348448)
                     /locus_tag="MGF_RS01445"
                     /old_locus_tag="MGF_2054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="large conductance mechanosensitive channel
                     protein MscL"
                     /protein_id="WP_011884781.1"
                     /db_xref="GI:500214617"
                     /translation="MKDLFNKDKQVSLSKNAMKNATQVVKRGNIFMLAIGLLLGTSFN
                     AVIASLANDVIIAAIAKLYNVQDLQKWQVQGIFIGKFFAALLSFVIINVILVSALFVS
                     YYIIEVRKAIKAKQLLAEGVNPTTTKPIEINKDEKIIELLEYNNMLLQQQIEIFGKAH
                     NMKVEILSKKFSDSVISVPFDINKPEPQSVEAANLEKMLRPNAQNAVSTSNWSGTEGL
                     IG"
     gene            complement(348502..349701)
                     /locus_tag="MGF_RS01450"
                     /old_locus_tag="MGF_2059"
     CDS             complement(348502..349701)
                     /locus_tag="MGF_RS01450"
                     /old_locus_tag="MGF_2059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Ion channel protein"
                     /protein_id="WP_014574514.1"
                     /db_xref="GI:504387412"
                     /translation="MNLGFSKFKIGRNKLMRILSIIVWSKSDIDEHLVQYEKRIKLFR
                     GIYALIIVFASLISFVTLVITPKTDNNNIFAQFAKVTLLLTFFVFITDWLAHAFTYKH
                     ATGLPQIKFVKAFLKYFFTFNSIVIIICVLSSGQAIKFFVTNLSATNELIFASFQSLA
                     LVKTIRLFMVLSLFKPFGAITSVFVTQKKLLASVFLIIIVLIILFAIIIWSQETVELL
                     RKRAAFLTQVSDNYLNFSQFAVFIHLNKLMQGSGQYEEAINKITDAQIQAAASALNSV
                     DASNFASLSSGYVQNFTEAFYFTTITLTTVGYGDFVPHAPISRVIVSFISLLAISIIA
                     IPSGIIAGSFLTEMQKSSERNKVKTKKNPDNKKDNFFMIPKKKQAETNIKKKPLDQCE
                     LIPIKQN"
     gene            complement(350306..351469)
                     /locus_tag="MGF_RS01455"
                     /old_locus_tag="MGF_2064"
     CDS             complement(350306..351469)
                     /locus_tag="MGF_RS01455"
                     /old_locus_tag="MGF_2064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574515.1"
                     /db_xref="GI:504387413"
                     /translation="MNKQNILEKNKLNIKRISVTIVSFIVLLIAVLTFIFLKNISFKK
                     IFDILRDPSDTRQKVFIFLIFACMVYGFLWQFLTLYIIARRYKVKTRWYDWLIYALVS
                     TLINNVTPFAAGAEPYKVYWLVKNKVKLSDAITVVGATAIYWSIVQITVTWPSFIYIS
                     TNYNLLIESKSGIIAYWFSFFGMLVDFGIFTTFATAVFSVKFHLFVYKVVNKIRKLLK
                     LKDLTEDKRLEYVNQKKAFIKEFKHYWVVIFMFLFTASLVIFQYSSVYMSLVILDSKL
                     TDLYNFIKVFNFSNVAITANNFIPIPGGEGTIQVTLELYFQSLVNPSLLSREFIRYFD
                     SKAFNTDINNTIFLWRFALFYLPTMIGIIPSLYEIIVYFKSLHKPKNSTVIIT"
     gene            351654..353435
                     /gene="dnaK"
                     /locus_tag="MGF_RS01460"
                     /old_locus_tag="MGF_2065"
     CDS             351654..353435
                     /gene="dnaK"
                     /locus_tag="MGF_RS01460"
                     /old_locus_tag="MGF_2065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886168.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="chaperone protein DnaK"
                     /protein_id="WP_011113796.1"
                     /db_xref="GI:499426332"
                     /translation="MSNNNGLIIGIDLGTTNSCVSVMEGAQKVVIENPEGKRTTPSVV
                     SYKNGEIIVGDAAKRQMLTNPNTIVSIKRLMGTSKKVKINDKGVEKELTPEEVSASIL
                     SYLKDYAEKKTGQKISRAVITVPAYFNDAERQATKTAGKIAGLTVERIINEPTAAALA
                     YGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTFEVMATAGDNRLGGDDWDNKIIEWI
                     IAEIKKDHPSLDLKSDKMAMQRLKEAAERAKIELSAQLETLISLPFIAVTPEGPVNAE
                     LTLSRAKFEELTKDLLERTRNPIADVLKEAKVDPSQVDEILLVGGSTRMPAVQKLVES
                     MIPNKAPNRTINPDEVVAIGAAVQGGVLRGDVKDILLLDVTPLTLAIETLGGVATPII
                     KRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGGIQPAPKGKP
                     QIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAI
                     VKQRIEMRYEGEGIVNTINEILGSKEAEALPAQEKASLTKIVDGINGALKAEKWDELK
                     EQIDGFKKWRDDMSKKYGGGEAPAEPK"
     gene            353718..355895
                     /locus_tag="MGF_RS01465"
                     /old_locus_tag="MGF_2075"
     CDS             353718..355895
                     /locus_tag="MGF_RS01465"
                     /old_locus_tag="MGF_2075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574516.1"
                     /db_xref="GI:504387414"
                     /translation="MAKKTTWLKLFCSLSGLSVISSSCFNPESFFSFKNESDTIKLSN
                     ITSNDLTVSDKLTHNNLLASNITSSNFSRYFELKLVQKADEQQDLDEQQDLNNLVDIK
                     VGGFSADDSNGILSFIVTLEKKNSNPVEFKQVSLEINGFLKKQEPVSQPKNDTDNVKK
                     PENSNNDESTDTTPPPTSDEPSTDQEKNPNSSDESSTDQSSSPTTVDETKKVDETKKP
                     EPSSSETKLRVFSDQEIYKKIYDRTFSLEFYTRYTRKNSSNSNIEQLYYLNNGTGWLL
                     DYQVSPQNPDLYRLFLATNLHVAQTLWNKNDFDRPVTDLKSAPETIGFSLGKSDQVEF
                     SAQNSSLNNSVVKYATLLDNTAFYNRVPNRANSWRVSSQRLTIPQTVFAAVDFVNDQE
                     TTQEFSSYWANQFKTQFVNNRLDDKNLLEHTYPKDAESRTKIADKYLEQGIGLYKDFA
                     VLSVVVNLSPKMLANETAQRYDGSRLLRKYVLEAIHELNESSRLAKLPGQLNLTNQDL
                     PYVDLDYPSIDQNQPNAYSFEEINKAYIAGYPGVEDSSNSSRVNFRWVQNNLNKDPNY
                     QLKPNINSGLVNKTQDITGLIQSYHNKYYHQYGITQEVLRSSLRSGSSGSVVYSKYGL
                     PFGIFWGGYNGGDPQQEENNRGLFDYLANDTKKSLNINVRYSNPNRASRFKINIEPYN
                     LIDGTNKQKYPNQTNSYREALAKYLVWSQNNNFSNSTYLFSHP"
     gene            complement(356475..356960)
                     /locus_tag="MGF_RS01470"
                     /old_locus_tag="MGF_2091"
     CDS             complement(356475..356960)
                     /locus_tag="MGF_RS01470"
                     /old_locus_tag="MGF_2091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574519.1"
                     /db_xref="GI:504387417"
                     /translation="MKLDPNDIEVFRPLIAFNDHYSHMQTANYNKLREKMNLPLFKDY
                     SKIFTEEDKAKLILQGLLGSIRGDLIRDKAVIRGRVVTTGHSYNIGTDNVMKKHHLLY
                     SENYYGSYNTPTISTRNVELSYGLLATRMFKTVLGEKDSFKNTSFIKAGKTLQITEVT
                     Y"
     gene            complement(356966..357346)
                     /locus_tag="MGF_RS01475"
                     /old_locus_tag="MGF_2095"
     CDS             complement(356966..357346)
                     /locus_tag="MGF_RS01475"
                     /old_locus_tag="MGF_2095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113793.1"
                     /db_xref="GI:499426329"
                     /translation="MSDRGPTFNTYHATLDQINKYQASVQKEVAAQKAAEQTFNAIPT
                     ITGNNKGSVQTPQYQPKYNEIFNALLKTYGSGEQGGLYSDRDKYAYYDSFINDPKFVQ
                     TVNKYKEMFKKELEAGRGEFSNSL"
     gene            complement(357407..357595)
                     /locus_tag="MGF_RS01480"
                     /old_locus_tag="MGF_2098"
     CDS             complement(357407..357595)
                     /locus_tag="MGF_RS01480"
                     /old_locus_tag="MGF_2098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574520.1"
                     /db_xref="GI:504387418"
                     /translation="MNIQLDSSDVNSSSDQGRPKSQGELALEKAESWFRELKIKADQV
                     GDAVQYASVMQNIKAIEN"
     gene            complement(357704..358105)
                     /locus_tag="MGF_RS01485"
                     /old_locus_tag="MGF_2102"
     CDS             complement(357704..358105)
                     /locus_tag="MGF_RS01485"
                     /old_locus_tag="MGF_2102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574522.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574522.1"
                     /db_xref="GI:504387420"
                     /translation="MLTSLLLVAPLSAILVSCANKNETKEDSTNETVKTEKTLTNKND
                     EAASENQNPTNEGSSSTSNDKNTSEQPKQVNNKAVSEQNNAQTAPSAKNNAEKTLLLE
                     WVGQYVQKAKNLVSVISSHSGSEEKKISWSN"
     gene            358216..359475
                     /locus_tag="MGF_RS01490"
                     /old_locus_tag="MGF_2103"
     CDS             358216..359475
                     /locus_tag="MGF_RS01490"
                     /old_locus_tag="MGF_2103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014574523.1"
                     /db_xref="GI:504387421"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LIDGEHVGKLELLRENADNDENVYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIP
                     KYQRIIHDKFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDW
                     HERPLENNYPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNT
                     ESATEWMNILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAK
                     YVSHSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGGSNKRAVEVVERAMDNIEKL
                     FSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLN
                     QKSNRVRNWYRIYEELMDVFPNLLNKN"
     gene            360086..361933
                     /locus_tag="MGF_RS01495"
                     /old_locus_tag="MGF_2118"
     CDS             360086..361933
                     /locus_tag="MGF_RS01495"
                     /old_locus_tag="MGF_2118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574524.1"
                     /db_xref="GI:504387422"
                     /translation="MKRSKKILFSLGTVLPLAGGVLLTSCSEAMSRTKYNFAADADFR
                     KAAFGNIGTINQVKNVVENSLQLPKTAPTVTMAPDAGAAAPSAGSEAAGAEASTGTAA
                     AGGSGSSGSSASSSAGSGSQGGETTSTGSGGSSSNTSGQSGSAQANTAGGSGTSSSNS
                     GSQSSSTQGSAAAGTAASGSTSETAMMTMLSGAWKHFDAIVKAKMNSEKTTAEMGLMK
                     FYTDFKAKFDEVLKFEGSKNLRDGTASLEDLRTGKTDLETKAKALFTVYNALGTALGQ
                     SKTFDTTKKSFEELAEANQGLSTLYKLMNVDVYNFAKPIEGNSYNDLARFFEALNGFL
                     GGQFAMNTTTSNVFQLFGNITALLISRELRIIDGAINSVLLTTPSTNREGLETLLLTN
                     VNKNSTIKQRYDETVKTLNDVKAQTDQWANSPIVTKANNQQSKLEMAAAKANDTSKPI
                     LTRLVNALYGNSANMPGFAVKGLFRSVNDLKTQLDAVKTLVSANYTSLSDFINVYKMT
                     NTTWMEGVGIFVNSQALNGLNNTEIDKLTAASTSDAADTALFTEVKTELKRLVAATAS
                     LPKNGAGQDKKSAFYLNQMVRSITSDNQARLASMGEGAQEFSFYVNTAL"
     gene            362287..362910
                     /locus_tag="MGF_RS01500"
                     /old_locus_tag="MGF_2128"
     CDS             362287..362910
                     /locus_tag="MGF_RS01500"
                     /old_locus_tag="MGF_2128"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAV0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_011113789.1"
                     /db_xref="GI:499426325"
                     /translation="MSRYTGSIYRKARRLNFSILESGKEFTNNKSKKGVKVPGQHGSL
                     IRPKLSNYGEQLQEKQKMQFMYGLNDRQFRRLFAVSKKMSGILTMNLFRTLESRLDNL
                     VFRMGFAPTRRGARQLVSHGHVLVNGKTFDIPSALISLGSVVELKPRAHNLPLVKLAL
                     ESKAVAPFVEVNKKTLSGTYVRYPERNELPADVNETYVVEYYKRLVK"
     gene            362930..363355
                     /locus_tag="MGF_RS01505"
                     /old_locus_tag="MGF_2132"
     CDS             362930..363355
                     /locus_tag="MGF_RS01505"
                     /old_locus_tag="MGF_2132"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAV1.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_011113788.1"
                     /db_xref="GI:499426324"
                     /translation="MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVTSKSSPFKR
                     GVCTRVGTMTPKKPNSALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKD
                     LPGVRYHIVRGTLDTTGVDKRRQQRSAYGAKRPKADKKK"
     gene            363365..363832
                     /locus_tag="MGF_RS01510"
                     /old_locus_tag="MGF_2137"
     CDS             363365..363832
                     /locus_tag="MGF_RS01510"
                     /old_locus_tag="MGF_2137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_011113787.1"
                     /db_xref="GI:499426323"
                     /translation="MRKNRAEKRKVLPDPVYNSVLVTRAINAIMLDGKKGIAQKILYG
                     SFDLIAQKTQKDPLEIFNKAVENIMPRLELKVRRIAGANYQVPTDVSPERKVTLALRW
                     LVTLSRKRHEKTMLDKIANEIIDASNNTGASVKKREDTHKMAEANKAFAHMRM"
     gene            363846..365927
                     /gene="fusA"
                     /locus_tag="MGF_RS01515"
                     /old_locus_tag="MGF_2142"
     CDS             363846..365927
                     /gene="fusA"
                     /locus_tag="MGF_RS01515"
                     /old_locus_tag="MGF_2142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886163.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor P"
                     /protein_id="WP_014574525.1"
                     /db_xref="GI:504387423"
                     /translation="MARQYPLEKFRNFGIMAHIDAGKTTTSERILFHSGKTHKIGETH
                     DGASVMDWMAQEKERGITITSAATSVTWKDCQLNLIDTPGHVDFTVEVERSLRVLDGA
                     VAVLDAQMGVEPQTETVWRQASRYEVPRIVFVNKMDKTGANFQRSVDSIHSRLGVKSV
                     PIQLPIGAENDFVGIIDLVEMKAYFFDGGENENYETKEIPAEYLEEAKKAHNHMLDEI
                     VTFDEAVMEKYLDGQEISKAEIKSCIRKGVVSSTLFPVLCGTAFKNKGVKPLLDAVVD
                     YLPSPIDVPPAKGYKVGEEVQIPTSDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLTS
                     GSYVINTTKDKKERVSRIVKMHAQQRDEIDEIRAGDICAIVGLKDTTTGDTIASENQN
                     LTLESMTFAQPVISLAVEPKTKADQEKMGISLSKLAEEDPTFRTYTDEETGQTIIAGM
                     GELHLDILVDRLRREFKVDVNVGAPQVSYRETLKAKADVEGKYIKQSGGRGQYGHVVI
                     TFEPNHDKGFEFEDKIVGGKIPKEYIKSVKAGLEAAMNNGPLAGYPMIDIKASLFDGS
                     YHDVDSNEMAYKIAASMALKEAGKRCQPALLEPIMAIEVTVPEQYFGDTMGDISSRRG
                     MIEGTESRDNVQVIKAKVPLSEMFGYATDLRSFTQGRGNYIMQFSHYAEAPKSVVEKV
                     IEDKAKKNKTA"
     gene            366058..366978
                     /locus_tag="MGF_RS01520"
                     /old_locus_tag="MGF_2159"
     CDS             366058..366978
                     /locus_tag="MGF_RS01520"
                     /old_locus_tag="MGF_2159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phase-variant protein A (pvpA) domain protein"
                     /protein_id="WP_014574526.1"
                     /db_xref="GI:504387424"
                     /translation="MGQELNKLKKHKIISMVLMAIGALILLSGIALTAVIASPINSVE
                     VTEMMNGQEVTTTKKISTFAFLINMLPNYQLSTLGYLQITGAAAGLVVGIVLLALGAT
                     FFVKTRRKTNEMLTALQDAEEVEEVAQEEQAEENVEATPTQQAEVKTEQLIGTQLVTT
                     DVASTTQAAGTEKAQGDLLPPSQQPTGMRPAPLPMGSPKLLGPNQAGHSQHGPRPMNA
                     HPGQPRPQQAGPRPMGAGGSNQPRPMPNRPQNPQGPRPMNPQGDPRPQPAGVRPNSPQ
                     ANQPGRRPTPNNPQGPRPMGPRPNGGPNRA"
     gene            complement(367063..367701)
                     /locus_tag="MGF_RS01525"
                     /old_locus_tag="MGF_2168"
     CDS             complement(367063..367701)
                     /locus_tag="MGF_RS01525"
                     /old_locus_tag="MGF_2168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574527.1"
                     /db_xref="GI:504387425"
                     /translation="MLKKLTINQVDHKLVNQIAKLIFNKFNLHKNIIPFLLKHKIEKL
                     FTYWALMKATMIIVDQTNKNILIYSDNPDQINKKYQQEYINLMNTFQYVETNDEKSAT
                     TSIIHRFKSLLSRYETLMLNQEVATDIKNLNQILLLLSDYQSFLNNAKELIQSEQELF
                     AFSASHLNYLDYENNKMYQIIKIPLMINNMQIKDVNQEDVVIYLYSTKQAVD"
     gene            367779..367973
                     /locus_tag="MGF_RS01530"
                     /old_locus_tag="MGF_2169"
     CDS             367779..367973
                     /locus_tag="MGF_RS01530"
                     /old_locus_tag="MGF_2169"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAV5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_011113782.1"
                     /db_xref="GI:499426318"
                     /translation="MARRDDLTGLGPLAGNNRSHALNITKRRWNLNLQKVKVKTDRGT
                     LTVKVSARTIRTLRKLDLLA"
     gene            368063..368476
                     /locus_tag="MGF_RS01535"
                     /old_locus_tag="MGF_2171"
     CDS             368063..368476
                     /locus_tag="MGF_RS01535"
                     /old_locus_tag="MGF_2171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_014574528.1"
                     /db_xref="GI:504387426"
                     /translation="MAKKEYAFTAKLNPDRTVTGKTPKHELLMDSSTTKGPSPLELMM
                     NGLMGCELSVISYYGPKLFGLQLEDLEMKVQAWRDPEPQDEYYGLRKIEIEWFVKSNK
                     SLEEVKEIIKYAHKVCPVFNSLSGRIVIDEKFTLK"
     gene            complement(368541..369851)
                     /locus_tag="MGF_RS01540"
                     /old_locus_tag="MGF_2179"
     CDS             complement(368541..369851)
                     /locus_tag="MGF_RS01540"
                     /old_locus_tag="MGF_2179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574529.1"
                     /db_xref="GI:504387427"
                     /translation="MTKYIENNELSTYTFNPRGLKAIIFIGVFSSLISIGFLVICGDV
                     SLGFKVFFNFIWYPFIGLGYCISALAIGFDVYTHRHLTFKQYVYKNRFFYLCFYSCAV
                     ISIIVFIITLSVLRSTNSHLVELGVLANKNDPLLGWGTNPKNWYGFVFLYTLVPLANY
                     NVIGTTFVVTLFWFNLFGFLIINFLNRVGFFWNTFLIVILVTYCFFSHLSLSVATENT
                     EIGKNNPWLFEVFRYSGIINTMTLFYFGLYMRKYMRIWKFKCSVTTLVVLIVSAIVAQ
                     TVLDFTYYKKIAFDFILANAYASPLILILSWLWLNTFLGYNLESKKTKSKFIHQFNRF
                     TNHIGFCYPIWFQLVGWTSTFIFGYLFINIIAKVDINPSWYQGLRLSFKLNADQNNAI
                     FISLMFFNMFVVPVAYYYPAKFMVYLLNKIDHKIRTKRKNKLNK"
     gene            369916..370737
                     /locus_tag="MGF_RS01545"
                     /old_locus_tag="MGF_2180"
     CDS             369916..370737
                     /locus_tag="MGF_RS01545"
                     /old_locus_tag="MGF_2180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methyltransferase"
                     /protein_id="WP_014574530.1"
                     /db_xref="GI:504387428"
                     /translation="MSALYLVGLPIGNLSEINHRALEILNQLEIIYCENTDNFKKLLN
                     LLNIDFRDKKLISYHKFNETNRFSMIQEQLKSNDVGLVSDAGFPCINDPGQKLVSYLR
                     SIDFKQIICINGSNAALCALATSGFESSQFYYGGFFGYKKQEITNELNEKLKYNTTLI
                     YYESVHRIKNTLEIINENFPDLEVCIARELTKKFESLYFGKISEIIGKIEYKGEFVIL
                     INKRNIKQENEINEEIIKELNTLIKYNMRSKDACKYLADKYNLKSSLLYAFCIEK"
     gene            370715..371956
                     /locus_tag="MGF_RS01550"
                     /old_locus_tag="MGF_2184"
     CDS             370715..371956
                     /locus_tag="MGF_RS01550"
                     /old_locus_tag="MGF_2184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase AAA"
                     /protein_id="WP_014574531.1"
                     /db_xref="GI:504387429"
                     /translation="MLFVSKNKEPFYQPESVEDIIGQKHLLHEYGILRRMIDLRKPYS
                     LLVTGEPGIGKTTLCNILISEMNLPSFSFNSASDSLQELKQFISKAKDLNQCVIIIDE
                     IHRLHRDKQDLLIKGLDAKSFILFGITTENPYFTINPAIRSRVHTIELVNPTSIELFE
                     GYKKIVQQKNIVTISDDILYKIANMVNGDLRKGINIIELLDIYYKNVEITEEILKNVI
                     DNNVTLVSYGDTFHDLKSALQKSIRGSDPDAAVYYLAQLIATKDLITISRRLIACAYE
                     DIGLANPDLCSRVYLATQAAKEAGFPEANQILSSIVIEMALSEKSSSAYEAISDALVE
                     VANGNIQNVPWHIKKNPINLSSTLNNMQKYKNPHNYDNHWVSQDYLPREIRDKKYYIK
                     QAHNYNEKLINDYWLKWRKDK"
     gene            complement(372024..372902)
                     /locus_tag="MGF_RS01555"
                     /old_locus_tag="MGF_2191"
     CDS             complement(372024..372902)
                     /locus_tag="MGF_RS01555"
                     /old_locus_tag="MGF_2191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574532.1"
                     /db_xref="GI:504387430"
                     /translation="MVKFFNKAIRRLIYIVGIVVVLLMIGIGVTGYVFHDNISTYYKN
                     FQDRNNSLLNQTRKILIDVQRITSNPEINTIPTRINNAINTIDQSLGKFKTTINNTKN
                     NVASLEQSIQEIKDSLKRHEVTFRIVANNQYDDVMRRLDEFQTTARDLNNEVIPNAEK
                     ILDNVSMGLDDARKLHNIINISELLKNVDKTVVPINNIINGLLQINNAVSSDQFSENL
                     KSVSLILMTVSLSLLSLGALTLILRLIFYRSINGYVVKRSKAKQQLADFFEKACKIYP
                     ELSNEIKKDVEHPQSS"
     gene            373711..374304
                     /locus_tag="MGF_RS01560"
                     /old_locus_tag="MGF_2192"
     CDS             373711..374304
                     /locus_tag="MGF_RS01560"
                     /old_locus_tag="MGF_2192"
                     /EC_number="1.7.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="azoreductase"
                     /protein_id="WP_011113776.1"
                     /db_xref="GI:499426312"
                     /translation="MSKVLFINASPVANEASFSYQLAKTFESEYLKLNPSDQVSWLDL
                     NELDKGSMTLTSKNSKEHFKDENVDPLINQIKSVDKLVVIAPMTNFNYPATLKNWLDK
                     ICVANKTFSYKYSKKGGSIGLMDHLKVMIINTQGAPEGWYAFADVTVLLKGVFEFIGA
                     MVDSIKVAGTKVEYLNKQPKEIVEPNLALIKEKAKNF"
     gene            374405..375376
                     /locus_tag="MGF_RS01565"
                     /old_locus_tag="MGF_2194"
     CDS             374405..375376
                     /locus_tag="MGF_RS01565"
                     /old_locus_tag="MGF_2194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S2"
                     /protein_id="WP_014574533.1"
                     /db_xref="GI:504387431"
                     /translation="MFLFEDLNVESAQAAKAEESPAPTVQSKEEQVPANSTDKVLVTH
                     TKLLDVGAFNGVAKRKWNPKMKHYIIPRNAAQFSAQFDLINSDLLNLKLHEAFNYLTE
                     AAKAKKNILFVGTKSKAVQELIQSIAERTNSFYINQRWLGGTLTNFKTISNSINQLKR
                     LIHTRDNDLTKYTKKEQIMIMKKLAKLERFFGGIKDMQGLPHVLVIDDPIKEKNAVTE
                     ARKLRIPVIALCNTNSDPNVITLPIPANNYNIRSVTLLLNLLGDAVALAQGNPAKFAF
                     KPDEEIDIPQLVKKETRTVVNRDRAGFNKKQPKAEESAKPAEKKAEK"
     gene            375963..381587
                     /locus_tag="MGF_RS01570"
                     /old_locus_tag="MGF_2205"
     CDS             375963..381587
                     /locus_tag="MGF_RS01570"
                     /old_locus_tag="MGF_2205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574534.1"
                     /db_xref="GI:504387432"
                     /translation="MIARSSNHFLINIINVSQKRTNKKERTGSMLKKWSLKSKSLLLK
                     TGLALGVISLASGVIIGSMIGFAENSAEKNGQLSPANKQLFDNDYSKIYDQNGNLNPE
                     LTITNANKTAQTGRTSSDATEFWFLDNPNQKYDFDQFFSEYYKRFNEPFVLEIKYGSF
                     SFFDEYVLAVRPKQFLEFTNWFITNVAWGPDLLTLNSFRLVPGVEQNGNAITLGSHST
                     LHKEVSEIKFFPDAFFGSLPIHSTIAGPGNEVDSLTYSVFSNETSKKDLDQFLKNIPL
                     ASALKNDIQREGNSDSTVGFGEIYRASKLVNKTFKIAIGSPTTDQQNRTAPPVYRSPI
                     IVNENFTQTDLDELKTQYPALNSQTLDLFKTYQIKSVKVTAPTQNNTEPALDLTVAEP
                     GSETTLNLNVDLNSLNNSRYVSYKTLLSAYQDNISNYLNFYDMDSYLNNEFYLYQDDN
                     KLNHFYNLFVEAINENPDLKALSSLEEQQARVKKYKVVSFEKTNNAQEYSLKVNLQEV
                     LENLQEGASSSLEFVANKANDYSPEGFDDFLEAINYQGGIDPVSLFYTPTDNQARDEQ
                     GNPLTGLDSRSYQLYVSVYNNLIKKVVKKYPHLLRQLDGPNVQRTVDSNGVFQYQVVE
                     GPFKGFTPSDRIGLPTVLAALVPGFDGLPIDFLKYVATHEYGHHYTLDQGQAFIDRDN
                     PVIVGGLSTRNGASEASFFSYRALINYLDARSNLEVVRVNANNQITPSGKFIRFRFGI
                     LDENGNVLRYETEPLEDIWGTADANDSLSEVLRNKKRRFLQDFSGLTEAAKLRNVAIR
                     DLFFANSFDSDSGTINPSISGLAKAFVKSQTEGGTSEYKWAPVTGGTSEYKWAPVTAA
                     SIISQLTDGAGNPLLNRSVFVSQNDQLSFRIFETEPNKPNVITRINMFNKDGSPVIQV
                     PLNVELSPAELAYVQRQAKVISDSISATINKNLADNGWDSAGTVLGGEISASVGSAIE
                     SEGVSALVEKIKTRSQPSELSPFANRFDDKSRKGFSYLALENSLSLQLVTLINNYLSF
                     SDIDTQQRAGSRQGTSASYIRSDANKIVAVEKTTASPKQFSNFDTYVFPFVRGNKFLG
                     EISNADDDGLIKGINGIASDNQLRTTQGLYNLNFTNTILTALGLFAPQGRNNLISYAT
                     KSSTQNGSNAQNSYVLEGATAFYRKIADVLNSATSTGMSYVDKAATGIAKLDDENVLV
                     VNPFGTDLTASDRSLLATVPTDKKINVTASSTAQTQTMSTFNSKNLSELLSFVSLDYS
                     KATYDSQTKQYNWDVNYVKTKFDLNAIEKLPAPNLPAAATLRAAITAAGTNTTAKNQA
                     LANYAIYLFRHSNLFMSVKDFSPATDLVKNRAVFSQLYGVTMLDRNFTRYYVEDLTLE
                     LDDGVNFDTKRLQAFFAKFVKDNKLEAVQSQLSFHDLLLLTGNIVYYANNGNVGLTLS
                     SFIFGYFSPGLSSDDVINYNATRVEPLLADKFTDYVYNIAETLTRDYVQTTYAPNIKE
                     FENVPNFLGGLSEAMSGLDYIVDATNINKVNDTRTSQTDLAKALQTVYLGRKYTAFYD
                     ELIKIQPDAVSKFNDAVYEFFAASDEVTRLRQATPNDTNAIAQALANQIVARQKVTDA
                     QNVLNELKAKARGMFFKNNDNNFFQTNERRTSSYFGQFISKNNGYFKDHFEKQTIGAQ
                     LYDDNLNPVIDNNIRTVDFNGNKVNKRPEAFFLSQLYNYGVSKRMVSGLFRNQSLDAL
                     ALYGYVPTELASKIGYLRFTNVLTNQAVYLKVNTQRTNNIFWLQKQGDPNSKRTIEDY
                     GYTSWLSDYALMGKYRDALLRPGNAYTVDFVDKNHNFLQTVDLGDVQYISENAKAVEQ
                     SPVKIENQNTTVDGNKRIKTVISIDFQFNVTN"
     gene            381626..384730
                     /locus_tag="MGF_RS01575"
                     /old_locus_tag="MGF_2239"
     CDS             381626..384730
                     /locus_tag="MGF_RS01575"
                     /old_locus_tag="MGF_2239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014574535.1"
                     /db_xref="GI:504387433"
                     /translation="MKFRFKKVIKLVGLAVVPLSFVLSSCTNAAPSKDQPVLSGSSNV
                     NRNDYDLGLVTNPLNTLNYVKYNSIDRVLPSLVDPYLKNGPSDALKRVLTAKRRYNFS
                     LLNIPQDRSTSNFDNYYKTNLETIQSDNGTGVIGSSFYALDDFNIVGGTADDSGVGDD
                     LRSRSTIYAFRNPRNTNNFMALTGYTNVKKNRWSNGDFSTSQDIRDYLEYILDLNTGS
                     QKLDTIRRYGIRGVDRFIDAQRDYLAKFNKSYKNPFGRRNYVFNQDLKIWVQDPNQTD
                     LYQSQTVDDRNQPLDTKEVEAIKNAAKDLGFYTGQLFLDYDNSFVARFLSMNPNFSLD
                     SEVQDFRVMTSDNQPMTIKLVKNPYVNPYQKFDLSTPDLQGSLQPLSKDENSFTLIFD
                     ENQTPNLSFLIGTILENLYPVNRRYIETVGGGIDRYGSEPDKFLTNGPFVIPRDNGIL
                     LGPNGYINLIKNLDYFDAENTISNRIRIFFSQNPNTNALFFEDGLISQTLIPANRINR
                     YWADPEIKQFLNKNQGFGTIAYGLNLDLETNANSYIQDQDLRNAIYYAINRSDVLRFV
                     GWDFSFPTSTWTAYGTHKAYDGRNLELFFEGQKSKTKNNKEFDLLNYDFVVHLSKRFN
                     FEKTVRHDLAHDLKTARFYLDRFKAKHPELKQVTLNFLDNSSDEQVRGATYLKQAMLE
                     AFGGYVNIEEKSLPENIFASYIEKGQYDIIYQNYDRFSGGQPQDGVLTFFKNDGIDSF
                     RQKNIGFKENPVGSYTYLDYLSNLVLEALQKTDPNFTRQTILKPDIDRIMMIINGDPA
                     MLAAYNNAVNSLNAFNLNTFSTDHLAAIIARLNQVNPEFQNTRYSNQYVNALLDYMII
                     TNWRRDPDQFNQRRNENIATARLHTAFNLILPSFKTVDEIAQLTDDTRVRLEIDTLDQ
                     VGSDTKKVQPNFWKKFIELSLNRFNESTIDYTSRLSSFFSGNFTDEELKENWSLDYVY
                     QFIGAIEKIIRDSGLIIPLMEVDTNWEVTRVGGVSSLFTFSLQYAYDYTRPPRDGLPR
                     TREA"
     gene            384739..385791
                     /locus_tag="MGF_RS01580"
                     /old_locus_tag="MGF_2253"
     CDS             384739..385791
                     /locus_tag="MGF_RS01580"
                     /old_locus_tag="MGF_2253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_011113772.1"
                     /db_xref="GI:499426308"
                     /translation="MTEKIILDDKSYQLNDNAVIFRKKRVEELTLIQRLLAIDSPVLR
                     TLWKFFKIILEFFVIGLIVISITFFLINSVPGENPLTQGLDEASRRAIEQRYGLDLPL
                     FERYLRYLRGLFQGNFGISLALFPEQSINSFIWARFYKSFLVGIFSVALTVVIGIPLG
                     IWVGKNPGGWVDNISTILVSIFSSIPSIIFALLLVFIGRAMGIPYVYDQANFVTYILP
                     GLALSLGSIIVYIKYIRTELNRELNSVHAKFAYLKGVSKDRFVWKHALKPSLFPIATF
                     FPAVIFGSFIGSIFIEQIFLIPGSGDTLLQAIQTKDYNVILFLIVMFALITVLSYAFR
                     DILYELIDPRIRRRTS"
     gene            385801..386877
                     /locus_tag="MGF_RS01585"
                     /old_locus_tag="MGF_2261"
     CDS             385801..386877
                     /locus_tag="MGF_RS01585"
                     /old_locus_tag="MGF_2261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014574536.1"
                     /db_xref="GI:504387434"
                     /translation="MTKFKEDNLKTKPPGFKTKFKNWVARVANKIRSHSDVETDEFVD
                     PKSAPNPIIQPFNYQSWKLVGKIVDFQADQHMSPQAKPFREFVNRYSRSFAGVLGMVM
                     LVLIVLLAIFIPFFTQDPNTTNIVDRNLIFNSTDSRNIYHFLGTDDLGRDFWARLWWG
                     LRYSIALAFAVTVIEVFIGLTIGIMMGQFEFFDKVMTFIIKVISIVPTIIILILLTII
                     IAPSFWVIVFALSLTSWTGMANQIRAQVKRAKHSEWVMASRILGTPTWKILKNYVPVI
                     LPILITQLVFTIPGVVLAETSLAFIGLAIKDIPTLGNIISEGQKLFPTYARYVFIPAT
                     FLILITTSVQLIGATVQDSLRRQR"
     gene            386892..388091
                     /locus_tag="MGF_RS01590"
                     /old_locus_tag="MGF_2271"
     CDS             386892..388091
                     /locus_tag="MGF_RS01590"
                     /old_locus_tag="MGF_2271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011113770.1"
                     /db_xref="GI:499426306"
                     /translation="MKDIQMNKKSFGYRIKDYFANLFGFITNRKFVFNWEEFSKNVRY
                     KEFENGEKLRIVAEIKDIELSFLNPSRPGEKNKVLRGPSIEIYEGKVHAIIGESGSGK
                     SVITSLLYGLTGDNAVIDSGEVKLFNNNVEKFSFRDWERSHYRGRVVSAVFQNPMSTL
                     NPTMKVGEQIMEGMLINKIVKNKKEAYARAVEFLKLTKISDPEAVMKLYPHEMSGGMI
                     QRVVIAAIVSLEPKILVMDEPTTALDPTVQALVLDVIKDLQQKLNLSIVFITHDLGVV
                     ASISDYISIMYAGQIIEEGTAQEILKFPQHPYTWGLILSMPDLNQGDRLATIRGSVPS
                     NLNNIVGDAFAVRNDYALGIDFVEEPKFYWVSPTHRVKSALLDERTEKYTPPKHIQEL
                     WDSFKAS"
     gene            388094..389461
                     /locus_tag="MGF_RS01595"
                     /old_locus_tag="MGF_2285"
     CDS             388094..389461
                     /locus_tag="MGF_RS01595"
                     /old_locus_tag="MGF_2285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011113769.1"
                     /db_xref="GI:499426305"
                     /translation="MSTVENKKDSKPYIEVKKKLLFFKKRYARFNTPGIEEMLKVPEN
                     KEVLASLRNVDITYGVGSKAFRAVVDMNLNIYTGEVLGLVGESGSGKSTIGRAIIGLV
                     PHSFGKINILDKTLPQKMTRGFKFGKALKEYKEIEKFMVNKVQMIFQDPANSLNPHVN
                     VESIVSEGLTNLKNAKEIYLYNIDQDVIKHVYEQWLDQNDPQIKQAFYGGYEHKLEEL
                     INKDEITAYDAIYHGFINKLKEFNQLNEAVAYLTKEQEKRNELNKLSEVDCKKILVRN
                     ILASVGLDESVLKRYPLEFSGGQQQRIGISRAVVLRPRLLIADEPISALDVSIQAQVV
                     NIFNDLKRKFNLTILFIAHDLRMVEYISDRIAVMNKGRLLEVGTTQEIMKNPLHPYTK
                     SLLDAVPSIAGHKGSLVGYKYDPSIHGYDHNNQPVWQKVNDNHFVLATDQELADWKQG
                     KYQEA"
     gene            389898..392591
                     /locus_tag="MGF_RS01600"
                     /old_locus_tag="MGF_2297"
     CDS             389898..392591
                     /locus_tag="MGF_RS01600"
                     /old_locus_tag="MGF_2297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574537.1"
                     /db_xref="GI:504387435"
                     /translation="MRYRNKTIIKIGSLLSFAVLSTSALASCVNNSTNNDFARGYVFE
                     NNDNVKIKAADGIRDLALNKESFVKALENMGATKANPWRIIDKSLSITTLTDDQRTMI
                     NNKTAALRSLSDGLIEYDFRLRGSTTPSVSEYFLRANTTAGTYFWTVDYPAVGSFIEG
                     WIANTKGAKVDQYLVQRIIDVANNPAAYVQEYTQQYVDLTASLAKAIIKSNLTQLKAP
                     TMPAATEGEPAQSSSASDMDYLNIFKGKTLAEVLTTNQTTLDNFQNSIGKYLGEWTAS
                     NTPRALYLNSFLDDQFSFIPLPSSNNTTINHLLVKSPEWKIRTDWKAGELLLRDSNGP
                     ANQGFVSELPENPAEGEELALQKAFSPGNTSNFPGSFSYLISSETTGEINYDANTRTR
                     TSNLTGTYKLEGAKGVKLYDANDKLLAVVLRPTTGTGAEMWAKSVEDQAKKENPDVYI
                     SKTGVVDPEVDSNLQKYIDQAVRYDWLIDHNVKWTDQNENPVASLSGRDFERGLESFW
                     LAAGIDYTVNGYLLDLLGVDLEKSVNGTVSDSNGKVTVTPGTEKITSSTYDIGKFTST
                     DDTFRIYLKQPYAFAMQTFKISFLTPMPYWDTRVRALRISGQADSTVSNLGTTNTEFK
                     TTASTNWTEGTVPGEIMVNADSSIDKEKTGWTKLFGYISASDSSQNLNNAYYSGSYYL
                     SAYSANQFTQTYNPNYQKAFSADYYANKTPVQKAITNFGGKRSADIIFQGYRDDDSSP
                     TQLTVPRSSITSASTTARYRQFYWSSQVTTPSSQMNYTVWAASPQGGEPEYQDAVTRN
                     IFRNWNSDDSRIIRAGIVNLINWYRLAQVVQSRGTFQYTSIPYRSLTDNTLFATVPLH
                     DAVLAIQENKLPAAFKVNGYSGSLRRPYSDFQPTRTNNQNN"
     gene            392711..393916
                     /locus_tag="MGF_RS01605"
                     /old_locus_tag="MGF_2312"
     CDS             392711..393916
                     /locus_tag="MGF_RS01605"
                     /old_locus_tag="MGF_2312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014574538.1"
                     /db_xref="GI:504387436"
                     /translation="MLTYILKRIGFAALAVFILLTLTYLLTGLLPYLPISPGQNESPA
                     AFQRRVDALGFNEPIIVRYGKYLHDLFVNHSLGQYYSNSAINIGQWFFETVPNTLLIT
                     AISFVISIILGVSFGVLSAVYRGKALDTTLNTLSVVFVSVPSFVIAIVLLIIFRNTGV
                     PTRYVAPGSNGYTVGRFIASLTLPILSLSLGGFSSMTYYMRNEMVEVLQQDYIKTARS
                     KGLSESAIIFKHAFRNASIPILSIIVPSILGLISSSFIIETFFSVPGTASLLVAAIQR
                     NEVNMLAFQVLFFSSLGFLLQILLDFIYTLVDPRIRLAEANSFIFIRWIHNSIVRNKT
                     KKLWALVNETNAYVLSKDKDQSLIDSIKDNNDLSKHKVVVDKKFGLPTNIEYLILEGR
                     LYKLEKALG"
     gene            393921..395060
                     /locus_tag="MGF_RS01610"
                     /old_locus_tag="MGF_2322"
     CDS             393921..395060
                     /locus_tag="MGF_RS01610"
                     /old_locus_tag="MGF_2322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_011113764.1"
                     /db_xref="GI:499426300"
                     /translation="MTISELSKNYQFEKELFDRVDANEQLSKQSLVIGKPTNYIVEII
                     KRFFKNTAAGVFSVLLIIIVLLSIIAPLVSQYSATQPLGIDEIYFNLPPRIFGTNPTK
                     DLIIPRDLLFIYDGTIVSETDMGNNTVLIRFHPYMLEELRNVYPILGTTQGGVDVWTN
                     LWQAMAASLQSALVVAVFASLIGVIYGAISGSFAGKWIDTVMMRIVEIIGGLPSIILI
                     IILAQIFVRTRSTSGGNLSIGSINAALIALYWTGPAQVTRIYIVKSKDAEYVQAARTL
                     GASQWRIIFYHLIPNISGRLAVIFVNFIPVAIFVDAGLVFLGLKSSQDITLGTILSST
                     YQNVSPDLLHISLPPIVVFSLFTISLQIIANAINDAVDPRIIGRK"
     gene            395060..396391
                     /locus_tag="MGF_RS01615"
                     /old_locus_tag="MGF_2327"
     CDS             395060..396391
                     /locus_tag="MGF_RS01615"
                     /old_locus_tag="MGF_2327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011113763.1"
                     /db_xref="GI:499426299"
                     /translation="MRFKERYLVSDPNKKLKPGYMVDIDNLNVSFKTKDGMLQAVRGV
                     SISAKEGQIIGIIGESGSGKSVCVKSLIGFNDNSKITADNLNLYDIDITKIKNRDWCH
                     LRGEHVTYIPQDPLMSLNPTKKIGAQIKEALVIAEKRRYRQEVEQLKDQYLKQKQELE
                     KTNSNSAELFKHLEQLRVDHLTKLKEAKDKYRNEKSAKSIKTKIYQILEFIGIVDIKN
                     KINAYPHEFSGGMRQRIVIGIAIASRPKLIIADEPTTALDVTIQAKVLDLIKRINQIY
                     KITVIFISHNIALVANFCDYIYVMYAGKIVEQGNIDDIFLDPRHPYTWALISSIPDEG
                     IEGKLRSIPGSAPNLISPPKGDAFAARNEYAIKLDFNSQPPLIEITNTHKAATWLLHP
                     DAPKIELPELVKQKIETYKKSLSDLANIHDKDKTPEVVYNVFDIREKKIDE"
     gene            396360..398879
                     /locus_tag="MGF_RS01620"
                     /old_locus_tag="MGF_2336"
     CDS             396360..398879
                     /locus_tag="MGF_RS01620"
                     /old_locus_tag="MGF_2336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_011113762.1"
                     /db_xref="GI:499426298"
                     /translation="MILERRRSMSNKKDEQVKTLLDVANLSVVFNSRGSQFTAVDNVS
                     FKVNKGDFFGIIGESGSGKSTIGKTLVRLNKLSGGMINLDGRLIGNKKLSRADKSWLH
                     QNAQMIFQDPMSSLNPIKTVLKLVAEPIMINKMIHKKTKALYQKITYIKPYFHYVFQA
                     REFDLTNQYQRNYYQKLTDQYQQAINQINNFQLSSSDFTTGYKELVFLLDDWSEKVQS
                     NIELSKKYFSDYKKIIDDYILDYDLKKYDPIDLEFDQAKLNQSNKAKILKYSQPVLDL
                     KEKKVAKKALYKQTIKEFNELYLFRNFSELLSWLTTVESEVKSFKYKMIMANKPLDYV
                     YAGINYYWKKAELKIIKLIKKDKFFEKENLDLLIKKINGHFADIFEPLVSIVINFSVE
                     LNQDILKTHKLTNQANTYLDLAKRLFHSIDRELDLKKVNETINQISSLINLHNYLVDA
                     NYLDRSFDQWKNDIYKNFDGLINEINQHKQESKRIVNEKNVDLFNLKKEIKQLNHEIS
                     ENYQSYQISNKSDSINQLEQLKKVTLDKKTKRDQAIQDYKNKLPEIYANRNNLTQEVK
                     KLEETYLSTKHRFHKLVKEKIHHLARTNHWHNKDLKVLIAAIKLRFKSMDAVDFEHKV
                     TTKDKNIYRNLFLKLPKWLNWIYLFPLRSILIRDKVFDALNQVGLKPEHAYRYPHEFS
                     GGQRQRVVIARALITDPQIVIADEPISALDVSIQAQIVNIMKEMVEKRGVTFLFIAHD
                     LSMVNYACENVIIMHRGKILERGNVDKIFKNPIHPYTKSLMKASPKLSNIHLDLASFD
                     EGLNYYKDYSVINKPSFYQVSDNHEVFCTKEQFDLWVNQKR"
     gene            398858..399406
                     /locus_tag="MGF_RS01625"
                     /old_locus_tag="MGF_2349"
     CDS             398858..399406
                     /locus_tag="MGF_RS01625"
                     /old_locus_tag="MGF_2349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113761.1"
                     /db_xref="GI:499426297"
                     /translation="MGKSKALKTGYNHYSSKYVNSLNKNDLTDDKINNTINQKGLKYP
                     RGWFGFSFCLIIVVIALFLLIIVKRNVPPKTQILDATTISSGIGFLFHAVGFINRQKI
                     FMMLKFKFKKLELFFSLKKQREKRDFLYDHNNATNYIKSYEDYLTYAVEKNKASFKVF
                     YISFLIYAIWFLASVIISFSLF"
     gene            399435..399522
                     /locus_tag="MGF_RS01630"
                     /old_locus_tag="MGF_tRNA22"
     tRNA            399435..399522
                     /locus_tag="MGF_RS01630"
                     /old_locus_tag="MGF_tRNA22"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:399468..399470,aa:Ser,seq:gct)
     gene            400212..400778
                     /locus_tag="MGF_RS01635"
                     /old_locus_tag="MGF_2355"
     CDS             400212..400778
                     /locus_tag="MGF_RS01635"
                     /old_locus_tag="MGF_2355"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAX4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor P"
                     /protein_id="WP_011113760.1"
                     /db_xref="GI:499426296"
                     /translation="MASIIHAKDLRSGHTFTLDGKIYLVIENSFNKTAMREGIVKCKV
                     KNLRTGSITTEVLTGMKLEQANIEKVKMSFVYQDQNSFVFMNNETYEQIEVPAKLLEY
                     EKNFITENTEALIMRYEDEILGVNLPDQVVIEIDYAEDAVQGNSVNNALKKATLVTGY
                     VIEVPQFIKSKEKVIVSTVDGKYVSRAN"
     gene            400747..401079
                     /locus_tag="MGF_RS01640"
                     /old_locus_tag="MGF_2359"
     CDS             400747..401079
                     /locus_tag="MGF_RS01640"
                     /old_locus_tag="MGF_2359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113759.1"
                     /db_xref="GI:499426295"
                     /translation="MTVNMSQEQTNIKSILYNKFGSIKITDKAFRSFIKNKIDTYLEN
                     NKVIELIKVDLYHFYDDTNAQINIYVKYLKKKYDNKLIKNLSKQITNAINVELGLVIT
                     SVNFIQQF"
     gene            401079..401471
                     /locus_tag="MGF_RS01645"
                     /old_locus_tag="MGF_2361"
     CDS             401079..401471
                     /locus_tag="MGF_RS01645"
                     /old_locus_tag="MGF_2361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transcription termination factor NusB"
                     /protein_id="WP_011113758.1"
                     /db_xref="GI:499426294"
                     /translation="MKKQANQRSQYQIRYDRLTFIYQALLLDLNLDEIYQAISQLEDL
                     KDQEFLTNWTGLINQVPTIVSAHLKESWSWNRLDYMIKALFNLVITEAKVLKTEKAIL
                     ISQATKLIQEYGDLNSIKLVSAILNKVI"
     gene            401475..402131
                     /locus_tag="MGF_RS01650"
                     /old_locus_tag="MGF_2363"
     CDS             401475..402131
                     /locus_tag="MGF_RS01650"
                     /old_locus_tag="MGF_2363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113757.1"
                     /db_xref="GI:499426293"
                     /translation="MMKWKKWRNHYITFLANLFVFIGFSINAILLREINPIDNSRVAL
                     SPEIMIITALIGGLLGIAFIGFDIKFFIKDFFYQKFHYDKKYTRMYIGGISVYLFNII
                     LGMLFVVLSVYFYRQADLTSANSLVTNFTITRNLIYISIGITSAITIVNFVIIRLARL
                     FIEQALDKRKNNTDENPKPVNSDDKSVIISFDQNNNLVKEQPVGPKADQKPSGGLNEL
                     "
     gene            complement(402128..402538)
                     /locus_tag="MGF_RS01655"
                     /old_locus_tag="MGF_2370"
     CDS             complement(402128..402538)
                     /locus_tag="MGF_RS01655"
                     /old_locus_tag="MGF_2370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594403.1"
                     /db_xref="GI:753838786"
                     /translation="MTTTNCVFCKIINNEIQAHVVAQNHLAIAFLDAFPVSNGHTLVI
                     PKKHYQDFSHTPKEEMHAVTDLAQEVVKLLDRSDLNVHGYNYLSNQASIAGQEVFHFH
                     LHIIPKYATKEGFGFKTNKVNILDLKEVMKLIKP"
     gene            402599..403978
                     /locus_tag="MGF_RS01660"
                     /old_locus_tag="MGF_2371"
     CDS             402599..403978
                     /locus_tag="MGF_RS01660"
                     /old_locus_tag="MGF_2371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_011113755.1"
                     /db_xref="GI:499426291"
                     /translation="MVNDNSTVILAKLSNYLSNLNNAKVKEHCSLIKKQNSFATSSFA
                     FLFLSAFLGLLLTVNVFVIIWTSYHQKIDYDDQEAVKLLLTQFETNWLISKVLVSLLL
                     ISLVILISLICFGYYFNNYKQLDTPIKEIKKPVNFINRISLVCACFAIFLVSFGYFTF
                     FIYSNDYHNAIKRKQAFDYMLKPDSIVNTKTLISAILGISFCLALILLIASFLVYSVF
                     SVQYNYFSSLDKLRRAIIKLNAQTKLEEKVQVSTKINVEAEPIKEEVKVEPTQTTKIN
                     QEADLNDLFKKFNKQPFNKSATQTQSVEPNIRTNQVDDSTVKAQQTTEYVWNTQQANP
                     TQETQVNNNQNPTSSLKDIFKKMNSYTKTETVNNQTGPVEQEVNQTSSTSTTNVSPAD
                     LYKNIFKFKSPLSATNEINNQKETSSVDENNTPKQEDYGIGVKSINQAEKQKEELKNL
                     FKKIKDSKE"
     gene            404201..405628
                     /locus_tag="MGF_RS01665"
                     /old_locus_tag="MGF_2383"
     CDS             404201..405628
                     /locus_tag="MGF_RS01665"
                     /old_locus_tag="MGF_2383"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="enolase"
                     /protein_id="WP_011113754.1"
                     /db_xref="GI:499426290"
                     /translation="MAKTNSTSKNNKLEIKSVFAYQAFDSRGFPTVACEVVLNDGSKG
                     LSMVSSGASTGEKEALELRDGGTKYHGKGVTKAVNNINKKIGPKILGVDATLQTQIDE
                     FMIELDGTKTKAKLGANAILAVSMAVCRAAAKSLNLPLYQYIAKKVAKVKGADFILPV
                     PMLNVINGGAHADNTIDFQEFMIMPVGAKTMAKALQMASEVFHSLQKLLKAKKFNTNK
                     GDEGGFAPNLKSAEEALDLMSQAVVDAGYALGKDVAFALDCAASEFYSKEKQAYVFKK
                     AVKAGILSEEKGTKTTEQLISYLEDLTKKYPIVSIEDGLDENDWKGMESLTKKIGKKV
                     QIVGDDTYCTNPELTSKGVSLSATNSVLIKLNQIGTLTETIQTINIAKKANWTAVVSH
                     RSGETEDAFIADLAVALSTGQIKTGSMSRSERIAKYNRLLAIEMQLGNKAKYLGSKTF
                     YNLSTPAATPKKSPAKKTTKAKSKK"
     gene            405713..407083
                     /locus_tag="MGF_RS01670"
                     /old_locus_tag="MGF_2391"
     CDS             405713..407083
                     /locus_tag="MGF_RS01670"
                     /old_locus_tag="MGF_2391"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="RNA helicase"
                     /protein_id="WP_011113753.1"
                     /db_xref="GI:499426289"
                     /translation="MNQIYPWKEFIAKTLKAMGIHEPTKIQKEAIPPLLKQKNLIGVA
                     PTGTGKTLAFLLPILQNLDFAQNLIQAVIIVPTRELANQIKSVLANFVKTNKAIRIKS
                     FVGSTQFDEQIISIKNNPPHILISTPSRFNQAIDHAVNWNLKSTKYLIYDEIDMMIDQ
                     GFFSDLIKTQEYIFNANKKVSIAAFSATLHLDAINKIKRFIKNATPINVSDSIWVNEK
                     IKHYLIKNKSLDKLDSLHAVIKNIDPYLCLIFVNKIKDIPPIQNWFEQNQIGFATLHG
                     KLDKRVRKQQFDLIKNNQVKYAIVSDLSSRGIDFKAVSHVISWNLPKDDIWYIHRSGR
                     TARGDQEGESYVFYDPDDEAILKRLENKKLVFIPLKINRDLSLTRYQLVKPEHKKRVD
                     DHLTNEIKKVLRSAPKKVQPGYKKKIKEQINKIKSKAKREAIEAKVKQRLISSYKKKN
                     RKLKTE"
     gene            407230..413058
                     /locus_tag="MGF_RS01675"
                     /old_locus_tag="MGF_2404"
     CDS             407230..413058
                     /locus_tag="MGF_RS01675"
                     /old_locus_tag="MGF_2404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence-associated protein"
                     /protein_id="WP_011113752.1"
                     /db_xref="GI:499426288"
                     /translation="MRNMVEKKKPEKKSIKNKSAHDNEPASISLDGNSKKKVSKKGLE
                     SLNYSDYYKKYLESKKDDFELLAKKTSIDTIKDKEAIKDEIKAEAFYAESALDYTKEM
                     KDESYSDHFKEMKDIDKKNVVISNEMKHDNKKEEEGEFVVRNQYHPSFNHVVEANHYD
                     DLPDFDVDSSSLNFDLNKSNKVNKPSKQKLASPLNNNLDRFSNERFNQPIPSRMYIPK
                     GYVRPMNLYGRPPFNPYFNPYFVPPYYYPPMHPGFARPNANPYQQPPYLNQQPPYFNQ
                     QQKELFPQQNSYTEQLLDFDPFATTTELVPVNNYNVITPNQNDLVVVNKKQSELSHII
                     SSFNKRMKEQLRIVSKQNEMIERLQTKVIELTEEKTTALIGEARLSTEDFLPTTQHNF
                     ESVVADTSSQEAKPEVEVVAKVVQKPAEVEVITNIYDIESDDPVVDILSLEADDLINT
                     ENLDQELAAFEEFDATSLDDQLDLSLLDDDITNTIQPQIKYELPVAPEDVKSEEPVAD
                     KGAQFDLEIDLEVPGLEDSQEIYTPNQLLDLAKEQPEGIKNSIVPTKVMDEMFGDKQK
                     SDPARRFWEAYVGNSEYGFYNNKTWNWKGKFSKLQKWIPFTSDEEVPFYGTKHVILSS
                     IKASERKKLWKELIDDPVYGHFEGSSKVWIWHGVFDQELNWIPDPTHDFKTEEEVLVE
                     KQKQSFPKKKDVSKKTNAPKVLKTNEITPDSDLHKMLLDDPRYKKHIGNVEYGYYDND
                     GVWIWTGTFDDNGEFKPDKVDLEVISDNLQSESNFSTLFDSWKKNNQNNLEYEIESKR
                     FKTVKPKVVYVNEQEQPDDHHVEEEQLARSKATKNELIKKSKYEKPTDEDLGILTYDK
                     SKIHDDQIVDASVLEGSSAQQAPFWLEFVGNEEYGHYNAKGNWIFDGYFDEQYEFVST
                     RVQEEVKQPTSGVSKTSILDDHANLDEYFKPASKEEILSYTPKAKKTEPVVEKVEEEF
                     FTKFIGDKNYGYYNDKNVWVWSGYFNEYDQFVPDEAPKNNKLLDEIVSLAAEQQKEQD
                     LLKAKVESELAAKQQAVQEQIQRELELRDQFLREQQAKEEALKLREQSLNEKAIRLKE
                     EILKLKLQSLKNQEEAKKQALKEQEFAEQFKQIKATKFIKPNKDNYKSIHQFVGGLSE
                     LSQIPTKPVEFAQPTLKTAEFKFEPSVVEEKVEFVVKDKLIDSVDAIVVDTKEVELPA
                     EQFSADQFSQQPQAKPQFDFKEELVLTEIIPAIVSEEISTPVVEISKPDLFTKQELDL
                     SNVEVKLADQASDSEVVSVDLSSVELADSQFSLAQDQVEPVVVIEQRAHEEVVLSEPV
                     VEFEQVQLEELDVVPLVEEQPEFVKVVEQPAPEVEVQEQPVQEVVHEEVLEVVEVVEH
                     PAPEVEVQAEEVVEEQPVKEVVELVEEPTHEETVEHPAPQVEEVFEEQPVQEQVHEVV
                     DEPVHEEVVEEHPAPEVEAESVDEEVEFWEQYVGDEHYGHYDENEEWIWDGYFDENQN
                     FFRNDEGFDQPEEVELASNVEDDHLVPSSEDLSEYPEEVVQEDEITEDEQPEPEIIDF
                     SANAKSHEEVEAQQPAEEFLQEVEAQPEEEAEEVEFWEQYVGNEDYGHYDENEEWIWD
                     GYFDEDNNFFRNEDGEQTDQPEEVEHVEEPVVAEEETLPTQAVEFDDQAELEEISEDD
                     QPEPEIVDFSGSSESEQEVHQEPAVEEEVEPAHEEAVAEEEPVVEQESVAEEQPEVEP
                     QPAVEEEVHEEEPAVEEPAEEAEFWEQYVGDEHYGHYDQDGEWVWAGYFDEDNNFIKN
                     EDEAVADEEPVSEESEEAESTQEEAASEGIEEVEVEGEHYIYADENGEINFDNYIGNE
                     NFGYYLEDGEWEWYEGDFDEKGNWFVYVQGEPEEVNVEEDIPALKGVDTESVDADDWL
                     SQFDEDAASAIFENEESDEDLDDDFGLLSGKKKNKKAKKANK"
     gene            complement(413278..413354)
                     /locus_tag="MGF_RS01680"
                     /old_locus_tag="MGF_tRNA23"
     tRNA            complement(413278..413354)
                     /locus_tag="MGF_RS01680"
                     /old_locus_tag="MGF_tRNA23"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(413318..413320),aa:Arg,seq:tcg)
     gene            complement(413404..413922)
                     /locus_tag="MGF_RS01685"
                     /old_locus_tag="MGF_2452"
     CDS             complement(413404..413922)
                     /locus_tag="MGF_RS01685"
                     /old_locus_tag="MGF_2452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113751.1"
                     /db_xref="GI:499426287"
                     /translation="MFNKRYVINQHLELKKIDNYQINELYDFLNSLNNEHHLGFSKSE
                     VDLVNLEEYIVLAKKRWTEKSSYFFVIYLDKQIFGLIKINVDKTNGQIKYLLQTYDPK
                     IIEQLIDFFIRVAQSTNLKWLYLKVEQDNNQLDQILNSVCMYKLNSLELKEINIVRSN
                     TKLIDNYWAKRV"
     gene            413956..414807
                     /locus_tag="MGF_RS01690"
                     /old_locus_tag="MGF_2451"
     CDS             413956..414807
                     /locus_tag="MGF_RS01690"
                     /old_locus_tag="MGF_2451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_036447267.1"
                     /db_xref="GI:738498335"
                     /translation="MPFKKDLNLSDCFKIVDNQLVLSEKYKQEYGSKFKKITGSRFPN
                     VLGINEFNTPFIEWLKMVNLYYETMDPILSKAGVVIEPKVREYIMNKFKINYKTYDPI
                     KVGFDLFKDNQIFGGIPDGEPVDQDGNLLYDENHPMLEIKTTSIDKLSYKKVDGLLRM
                     MVDQSGLPIVKAKREKYFEWYDENKQIKVKKEYVLQLSLYLYLRNAKYGRFGVIFLRP
                     EDYQNPEAIDLSQRLIDVVDMKVEKSSIEPYIEQATQWYQDHIIKGISPKMTRSDLEF
                     LKLHKII"
     gene            414825..416015
                     /locus_tag="MGF_RS01695"
                     /old_locus_tag="MGF_2460"
     CDS             414825..416015
                     /locus_tag="MGF_RS01695"
                     /old_locus_tag="MGF_2460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thiamine biosynthesis protein ThiI"
                     /protein_id="WP_011113749.1"
                     /db_xref="GI:499426285"
                     /translation="MNTSNYQIMIKFGELWLKNNNRINFINQLKANLQQAISKFELKL
                     NLQYDHFLITNYHKQDQTELIEILKRIPGISYVCLVQQLQRDLNLLQDLVLEMVNDHD
                     QLAFEIKRKDKSYELTSLDLKKTLSAYCLKNRQIKINLTNPTKMISIDVVKNYFILYL
                     HKYSAAGGLPVKSSGKVLVLLSGGIDSPVASDLLYKRGMHVDFLTFITPPHTSKQALD
                     KTVLLAQTVSKHNEVSDAKIFIHNFTNVLKEISHTKYENYRITLMRRCFYKIANKLIN
                     QYGYDCIATGESLGQVASQTINSMKAISNASKDLLVLRPLLCYDKSQIIEHAKKIKTY
                     EISILPYSDACSLYAPKKPITNPRIEIIDKIEAKLDFLDIVIDNSITNDIIQFDLNKQ
                     WDNN"
     gene            416000..416986
                     /locus_tag="MGF_RS01700"
                     /old_locus_tag="MGF_2470"
     CDS             416000..416986
                     /locus_tag="MGF_RS01700"
                     /old_locus_tag="MGF_2470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113748.1"
                     /db_xref="GI:499426284"
                     /translation="MRQQLEVHDQIWAKVQEFDHLTFFVHERPDFDALGSAFAFKELI
                     NNMFPEKKVYVMGTYKLDPELGASLFPFEKEPVDIEFLERSLGIVFDTANAERILTGQ
                     HKLVKEIIRIDHHPKTEIIGSIEWVDPTFSSTAEMIGWFIKWMGFKLNSIIAKYIYAG
                     IITDTGRFLYLATTPSTFMMTAEILATGFNRNEVHDAVYLKPILEHKYYSYVVNHAKI
                     TPNGLAYIAVRKGAHKRFGIRSPMTMVHALNNIDGVKIWTAIYFDDQSQKWKGSIRSY
                     DIPINHFAAMFNGGGHKFASGFSLDNKQDFYKLIKVLDDYLKTIDNDQLSQN"
     gene            416958..417797
                     /locus_tag="MGF_RS01705"
                     /old_locus_tag="MGF_2479"
     CDS             416958..417797
                     /locus_tag="MGF_RS01705"
                     /old_locus_tag="MGF_2479"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="rRNA methyltransferase"
                     /protein_id="WP_011113747.1"
                     /db_xref="GI:499426283"
                     /translation="MTMINFHKINAKNNPIFKDLKIAFKNGYNKQISDYFCVGGIKNN
                     LIALNNNWLPHTIFVSKSFDQKLISNIKSKLKQHKVRWIMISDQLNDQLKAINTQAGD
                     CYFYYLLKDLNHPTFDLSDQHNYLFLDHIQDPSNLGTILRNAAAFDLTKVLIHDSVNL
                     YNPKLIRASAGAIFSNQISLIKNLDQFLNAIKKKGLRLVATANHEDATPLDQFDHQLG
                     NIIIFGNEANGVSEQLLNQADQTIKIVINNQYAESLNVATSSGIILYELNKLWKKRSL
                     SNQ"
     gene            417767..418759
                     /locus_tag="MGF_RS01710"
                     /old_locus_tag="MGF_2485"
     CDS             417767..418759
                     /locus_tag="MGF_RS01710"
                     /old_locus_tag="MGF_2485"
                     /EC_number="5.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="RNA pseudouridine synthase"
                     /protein_id="WP_011113746.1"
                     /db_xref="GI:499426282"
                     /translation="MKKTIVIKSVDDCIRIDKFLFKYLKNYTRTNIYKMIRKKDITVN
                     NQRIDFDYILKVNDKITYYDFLRTDHKKKVPEFFKAKPELDLIYEDENLVIFEKPLGI
                     PAQQTDEPSQYDHMQNRLVHYLVKSNQYDYLNNQAYLPSIVNRLDTYTTGIMLGAKNL
                     KAQQALNQIIKNRDLKKFYHCLVHGEINPKKATLTAYLTKDPNRSLVSIQKEKTNDNK
                     IIITRYQTLYYFKKQNYTLLDVELITGRTHQIRAHLASINHPVVGDYKYAKKQYQNNQ
                     GNFKHQLLHSYKIIFDLANYDQDFILKYLDQNQYQTKSPAWFHSQLHPNPYEEK"
     gene            418781..419053
                     /locus_tag="MGF_RS01715"
                     /old_locus_tag="MGF_2488"
     CDS             418781..419053
                     /locus_tag="MGF_RS01715"
                     /old_locus_tag="MGF_2488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113745.1"
                     /db_xref="GI:499426281"
                     /translation="METTKTIYNDELIKGWLKEIIKLVPGITSELSDDDIEIDEDTIT
                     ITVVCKLGIRPYQVCLMAQSMIYYELSRWDDHHPYFINVIIKEIKG"
     gene            419062..420786
                     /locus_tag="MGF_RS01720"
                     /old_locus_tag="MGF_2491"
     CDS             419062..420786
                     /locus_tag="MGF_RS01720"
                     /old_locus_tag="MGF_2491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dihydroxyacetone kinase"
                     /protein_id="WP_011113744.1"
                     /db_xref="GI:499426280"
                     /translation="MASDTLTTKQLQSMFIEGYNVIFNRYEYINNLNVFPVPDGDTGT
                     NMKITTKGGVDAISDLEFNSLQSLGKVFATGLFMNACGNSGVIFSQIIKGFTKSLPDG
                     DEVGIKQLINSFKEAKEVAYSVIQSPVEGTILTVVRLTADQLVQKQDEISSVEQLFEL
                     ATEFAKDALKQTPKMLPALKSANVVDSGGFGLVSFLEGMLTELTKDFSRLNNDKQFVN
                     KKALSSKAEQELVEEGHGYCTEFLLKLGLKAKDDQTKIKFNEEKFKKEISKDVESLVL
                     INDKEEGIVKLHAHTLTPDLVLKHAQPYGEFLKVKIENMNKQVTERKQDDSNLGQLAN
                     KPIDLLMDIDLSKIKDFKTETAIIATVPSRVLGKMIVQNYDVDQFIDTSATGNPTIKD
                     FVKNIYSVKSKNVIIVVDDTNLLLSAKEAIALLKKHINCELISCQNFIEALSAISGYM
                     RSDSLKSNVKVLHKIIKSTGSAFISTSVKNIKYPHLQVHKGDYIGVMKKKIIVSDSDI
                     YKCLLDTVAQLIDEVKKPELVLIIYGKNTSSSEVRTIVKLISEKFGIYCEAINGSQKL
                     YQYYIGVQ"
     gene            420729..421772
                     /locus_tag="MGF_RS01725"
                     /old_locus_tag="MGF_2500"
     CDS             420729..421772
                     /locus_tag="MGF_RS01725"
                     /old_locus_tag="MGF_2500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphate acyltransferase"
                     /protein_id="WP_011113743.1"
                     /db_xref="GI:499426279"
                     /translation="MWSDQRITKTISILHRCAIMFRIAVDCMGFENSVSEAVKAVIKY
                     AKKHKDLSFVLVGDENQIRPLVENKKYLNYRIVHTTNEIGMSDSVLTAYRKKDSSMYL
                     TIELLKNNEVDTIISAGSSSAYVALTYNLIGKIHHKIKVGFMSYVPTVTKRGFWFLDV
                     GANKEYLGEELYYLGKMANTFITSVFNYQPRLGVLNIGAEKNKGFEYHQVVYNLLEND
                     KTVDFLGFIEPRGLIKGECDLLVSDGYSGNLVLKSLEGALKSVGKILKKNYKINPLGA
                     LFSANVIYQITKTFDYKNNAGAVVLGLNKLVLKTHGSADAKQFYSTIRLAHESLLNNL
                     IEKITKECSTFLN"
     gene            421840..423807
                     /locus_tag="MGF_RS01730"
                     /old_locus_tag="MGF_2505"
     CDS             421840..423807
                     /locus_tag="MGF_RS01730"
                     /old_locus_tag="MGF_2505"
                     /EC_number="3.1.26.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:D3FI09.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease III"
                     /protein_id="WP_011113742.1"
                     /db_xref="GI:499426278"
                     /translation="MENLEKNTKKKIKKPNNFKKNNKDKTEELKDKPTPRMFKMTPKS
                     SKFLHQLGVTGRKHTEKPVPLNDPDYEKKIREIQAKEAKKIRSDEVVNNNSKKQNNNK
                     QAKKKANKNKKQKGNNNNFQNNKKPENWKQKPAANNQVKAIPNSEKSTAKTAINLIIK
                     RTFETLKQNNLIAPNLKQNPNKKDKPQQPNVAAKNNNQKEVKKPYNNFVNNQKNHNKN
                     NAGNKGDNKQPTKPLNQSKLSKSTIVELPFTPNFTSNQPKPTQKEDSKKVKAKKAENS
                     QPQESNKQVKKLEVKTNQQKQDQTKKKQPKENKNQQIKAVNLNNNQQKTNNNNQKNSV
                     DKSENDNNKKKSEANQKQENLNPNNNNKKKEDSKNESNNIPLINKNISDQQIVKISNY
                     IKDNYPVIYADLKEKNRLGFNSNLDDDKLIVYANYEAKDLELLLKKFKVVTNNIGLYE
                     EALTHNSYANEMHLKYNYQRLEFLGDAIINKIVAEYLFNHSDSSEGEMTKDRIKIIQS
                     NTLIKAATQLELINYIRVGEGLKIAPLSPKILEDIFEAFIGAMYLDQGEYAVRKILND
                     TIIGYYQKGQLTENTDYKSIFQEIIHSTGLNMKIHYERTYDRQKNLHTVSLYAGGIMY
                     GEGKDSSTHKAEIKAAKEAISKFRGLLKLEK"
     gene            423913..426066
                     /locus_tag="MGF_RS01735"
                     /old_locus_tag="MGF_2519"
     CDS             423913..426066
                     /locus_tag="MGF_RS01735"
                     /old_locus_tag="MGF_2519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase AAA"
                     /protein_id="WP_011113741.1"
                     /db_xref="GI:499426277"
                     /translation="MFASFTPTEEKNVLSKYSRNLNDEIARNAIDPTIGREEEIRRLI
                     EILSRKNKNNPVLIGEPGVGKTAIVEGFARKIVNGDVPDNLKDVEVVELSLSSLIAGT
                     QFQGSFEERLNKILKEVKNSSGKVILFIDEIHQLVGMGKNSSNSAMDAANILKPMMAR
                     GEIKVIGATTIDEYRKYIEKDGALERRMQKILVDEPTKQEALTIMRGLRERWEAFHKV
                     RIFDDALVAAVEMSARYISDRYLPDKAIDLIDEAAAKIKTLIHSLPPELDNIKQKIIH
                     LSTELAALEREKKENHSNVRLGRIEQLKKEIKDFTNKQNELTVKWTQQKTIYECINKL
                     KEEVTNLTAEIERLQAKGEYTQASKLLYLEIPKRQEEIEKKTKELSEFTDNLIKTSIS
                     RVEIAEVISQATKIPLSKLVASEQQKLLNLKNDLSKYIKGQDHAIKNVSDAVLRGRAQ
                     INDPNRPIGSFLFLGPTGVGKTEVAKKLAYCLFDNEKAMVRIDMSEFMERHSVDKLIG
                     SPPGYIGYDQPGVLSDAIRTKPYAVVLFDEIEKAHPDVLNILLQILDDGQLTDNHNRL
                     VNFKNTIIIMTSNIGAEHILANNPAKTIEELKRKIRPELLNRIDELITFKALNDKDLS
                     AIAQKLLSDLSDRIKKQQINITFDKKIVENVVKHGSNTVFGARPLKRYIQREVENFLA
                     KKIIENKLEKNKSYVCTFNAETNEYTLVNLRKAVS"
     gene            complement(426121..426747)
                     /locus_tag="MGF_RS01740"
                     /old_locus_tag="MGF_2533"
     CDS             complement(426121..426747)
                     /locus_tag="MGF_RS01740"
                     /old_locus_tag="MGF_2533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="deoxyguanosine kinase"
                     /protein_id="WP_011113740.1"
                     /db_xref="GI:499426276"
                     /translation="MLVAISGMVASGKSTLSNNLHLHYKNSKILYEYDEKDEVFNQFL
                     EWLYNKNAVVDFAFQSYVVQNYSRHLKQALSQNYDYIFSDRFNLEHFIFAKNKISKKP
                     KKFINAYEAMFDVLVSEDKIPDLVIYLDFNFDEFKKRIFKRNRIVETSTFNDNIDYWR
                     NLHSIYKKEFINQQQKYKFKVVYLDTNNKNEEDIFKQSVEIINLYSAK"
     gene            complement(426750..427397)
                     /locus_tag="MGF_RS01745"
                     /old_locus_tag="MGF_2540"
     CDS             complement(426750..427397)
                     /locus_tag="MGF_RS01745"
                     /old_locus_tag="MGF_2540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="deoxyguanosine kinase"
                     /protein_id="WP_011113739.1"
                     /db_xref="GI:499426275"
                     /translation="MLIGISGMVACGKSVLSKRIHEHYKTSLFLREFKEDDVVFNKFL
                     EWLYEKRPNTEISFQAYICENHSTKMNEIWKNYRSENKDSKKDHIIIDRFCIEHNIFA
                     RLILAKKGDKFLNAYQAMFDMMIDKNEIPDIAIFLDVNFENFKKRLFKRNRKVEVNNF
                     DENLDYWKELHQNYRKNFEILCEKYKVNAYYIDTNDMTEIEVFNKAVEIIDNHNR"
     gene            427574..428911
                     /locus_tag="MGF_RS01750"
                     /old_locus_tag="MGF_2543"
     CDS             427574..428911
                     /locus_tag="MGF_RS01750"
                     /old_locus_tag="MGF_2543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="TlyC"
                     /protein_id="WP_011113738.1"
                     /db_xref="GI:499426274"
                     /translation="MTSEESSSVTDNNSIVTDNSSIAIYIIYGVLILLFLFISVIFSA
                     LETAFTSLTSFKWNGYIKEHNIQKKLRTKIINKLIKNFTLTLSTILICNNVANIIIST
                     LSTLLFNRIVENQAVGSSLAVFVTTFITLFFGEIAPKSIAKFRPIKTVLLFSFVMIFF
                     YYLVFPVTFLISKVFKKYSKTQTSEKEVTFFIDEAKNEGVLENDEALLIKNAINFDET
                     LIQQVYTKWKEVVYVHEHSSIGLIKKRFLSDNVSRIPIINDENKTIGVLHLKDYLSIV
                     ENKDEDNWTEYLSEPIYVLTDYKLDKVLYLMKRERVQIAIVVNNFNEYESIGIITMED
                     LLEQLVGQIYDEQDEVGQVQEINAYTWMVDSSINAQYFLHKYINKNINVKKNIKLLDY
                     INNNTQHNARYEDGIYHDDFMTVKYLEYDEETKVKLVEIIKNEIQVTEISTNY"
     gene            428913..430679
                     /locus_tag="MGF_RS01755"
                     /old_locus_tag="MGF_2548"
     CDS             428913..430679
                     /locus_tag="MGF_RS01755"
                     /old_locus_tag="MGF_2548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cation transporter"
                     /protein_id="WP_014574540.1"
                     /db_xref="GI:504387438"
                     /translation="MLKINGKNRKNSLSKRNKIIKWLKIIFTGETISQKIAHFYIYFI
                     LIGSILLYLPISLKYSDTYEKATNVTFQGLAAEPIIEKAKYSFIDSFFIATSAFSDTG
                     LSTLVVRETYTIFGQIILAILIEVGGVGFVVFWYLIWRIFAKIFKDQSSLEKTLLLQS
                     ERGGEKLSTTSKTIMVAVTAVMIFQIIYAIFYSLYFYFVPSFEQQNIIDLQNSDVNGL
                     LIDFKASQITVDNPYRKFFTYHNAGSAIWAGIFHSVSSINNAGFDIFGPFSLSSFRND
                     HHIVLLFITATQFFIGGIGYPTIFDIYEKIRYKRLYKNRVKYKFSIFTKLSLITSAIL
                     LMLPIVIVAPVEVLSKNGSFNVTSQIFEQSLKNNLKFEPSLNIQTPEQLYQTIYGKNS
                     KLDYVLNLWFMIFSSRSAGFSTISMYNLTDVSKLIFSLLMFIGAAPSSTAGGVRTTTF
                     ALVMVVIFQKFKGYKQVRLFKRSIPSETINSACLITLLSAIFLIVAAVGTKITFDFVL
                     PDVRFSIMDVFFEYSSGYGTVGLSVGITSYLTSINLVPLVLLIALMIIGQLGVSTSIL
                     AWVKSDAIKWNYSYVDEDVKIG"
     gene            430800..431966
                     /locus_tag="MGF_RS01760"
                     /old_locus_tag="MGF_2562"
     CDS             430800..431966
                     /locus_tag="MGF_RS01760"
                     /old_locus_tag="MGF_2562"
                     /EC_number="2.7.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884673.1"
                     /note="Enables the production of acetyl-CoA by
                     phosphorylating acetate in the presence of ATP and a
                     divalent cation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="acetate kinase"
                     /protein_id="WP_011113736.1"
                     /db_xref="GI:499426272"
                     /translation="MNKILVINAGSSSIKFQLYDANEKVLAKGLCERIFIDGAFKYEF
                     EDGSKDEGNSAFPTHKEALTHLLESLKKHKVINDLSEIVGVGHRVVQGAYWTDSTLIT
                     PQVLEKIYELAKLAPLHNKPEADVIDVVQKLIPKAKNVAVFDTSFHTSMPEVAYEYAI
                     PREWKEKHLVRRYGYHGTSYRYVTKRFEQLLNKKAVNLVICHLGNGASIAAIKDSKSI
                     NTSMGFTPLEGLVMGTRSGDIDPSVVQYIAKQTNKTLDQVIDDLNKKSGLLGLSSYAD
                     MRDVTSNLPKTQLTLDVYTQRVADYILKYANQINASIDGLVFTAGVGENASLIIQEVV
                     NKVHLLKVSLDPKAFEQKYSDYRKLSDDKSQLNVYQVRTNEEIMIMRDVVRLSK"
     gene            432136..433554
                     /locus_tag="MGF_RS01765"
                     /old_locus_tag="MGF_2572"
     CDS             432136..433554
                     /locus_tag="MGF_RS01765"
                     /old_locus_tag="MGF_2572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="NADH oxidase"
                     /protein_id="WP_011113735.1"
                     /db_xref="GI:499426271"
                     /translation="MKVIVVGINHAGTSAIRTMLAENPKLDVVAFDRNDNISFLGCGI
                     ALAVSGVVKDTTDLFYSNPEQLRSMGAKVHMKHEVLSVDHNRKVVVVCNLEKNSTFEE
                     SYDKLILATGAWPITTADASLPFTEKYCGGIEGLVACKTYQHALEIIDQFKKPDVNNI
                     VVIGAGYIGVELVEAAHQKGKKTLLVDMLPRPAANYFDKEFGTDLMTTMKKEGVDVRC
                     GTKVMGYLVDTEGGKKVIRGITLEKDGVQTKVEADLVIQCIGFLPNTSLLADAHKVKN
                     GALIIDQYCQTSVKDVYAIGGAAAIMNAATGEYQNIDLATNAVKTGVVAASHINGMTN
                     IKLENVVGTNAIHVFGHHLASTGISEEVAKIRGIQAVASYFEDADRPEWMNTYDRVKI
                     KLVYDPKTLRLLGAQVGSTKNNHSEVIYLLALAIQRKLTLVDVAFADVFFLPHYNKPF
                     NFIISAILQALGLNYFKESIKK"
     gene            433615..434694
                     /locus_tag="MGF_RS01770"
                     /old_locus_tag="MGF_2578"
     CDS             433615..434694
                     /locus_tag="MGF_RS01770"
                     /old_locus_tag="MGF_2578"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="pyruvate dehydrogenase E1 subunit alpha"
                     /protein_id="WP_011113734.1"
                     /db_xref="GI:499426270"
                     /translation="MAIIVKNKIPELLHRVIDNEGRVIDPSYVQKLSDERVIEAYYYM
                     NLSRELDKKMLTWQRSGKMLTLAPNIGEEALQLGTSLAMTKKDWLVPAFRSGALMLHR
                     GVKPYQLMLYWNGNEKGNVFDEGVRVIPINITIGAQYSQAAGIGYALKQNKERAAAVT
                     FIGDGGTAEGEFYEAMNLASIHKWQTVFCVNNNQYAISTRTNLESAVSDLSTKAIAVN
                     MPRVRVDGNDLLACYDAMLEAIEYSRSGMGPIFVEFVTYRQGPHTTSDDPSVYRTKQE
                     EEEAKKSDPIARIKKFLTAKGLWDEAKEKTMFEQIEAKISEEYDVMLQHIQTTVDDVF
                     DHTYATLPQNLVEQKAVAKKYFGDK"
     gene            434719..435696
                     /locus_tag="MGF_RS01775"
                     /old_locus_tag="MGF_2585"
     CDS             434719..435696
                     /locus_tag="MGF_RS01775"
                     /old_locus_tag="MGF_2585"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="2-oxoisovalerate dehydrogenase subunit beta"
                     /protein_id="WP_014574541.1"
                     /db_xref="GI:504387439"
                     /translation="MSDKIIVNNIEALNNALDIALSKDKSVVLYGQDAGFEGGVFRAT
                     KGLQQKHGADRVWDTPISEAAVTGAAIGASYAGLKPIVEIQFSGFSYPAMQQLFCHAA
                     RIRNRSRGKLNAPIVIRMPMGGGIKALEHHSESLEAIYAHIPGVKVVMPCNPYDTKGL
                     MLAAINDPDPVVFFEPKKLYRSFKQEIPAGEYVVEIGKANVLTQGSKLTIVTYGANVI
                     DTLEIVNQYPAGDLELIDLRTISPIDWNTVLGSVQKTGRLLVVHEAVKSFSVSAEIMA
                     RVSETLHSSLKKAPVRVTGFDITVPLAKGEAIQFDLKKRTVDAINELLA"
     gene            435854..437170
                     /locus_tag="MGF_RS01780"
                     /old_locus_tag="MGF_2592"
     CDS             435854..437170
                     /locus_tag="MGF_RS01780"
                     /old_locus_tag="MGF_2592"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="branched-chain alpha-keto acid dehydrogenase
                     subunit E2"
                     /protein_id="WP_014574332.1"
                     /db_xref="GI:504387230"
                     /translation="MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVT
                     TDLPAPEGGKVTAILASVGQTVHVGEVMLVLNGDGSSAPAAAPATPAFVAPTPAVTPA
                     PTPAEAAPSGGGGGASVVGEVKVSNTLFGLFGDQRAASTPTPAPTPAFAPTPVPVATP
                     LAQAVASDLNVNLHNVTPANGAKIFSSDVFASAQQSSPAASVAANDNETYKEITSIRK
                     AIAKAMTTAHEEIPATVLTFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITK
                     AVVAHPIFNSHYDKASNRLVLKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVN
                     NLAEKARSKKIGLADLADGTISVTNFGSIGALFGTPIIKFPEVAIIATGTVEEKLART
                     PENQIVIKQIMPITIAADHRWIDGADIGRFAKTLKEIVENLNGLLI"
     gene            437187..438572
                     /locus_tag="MGF_RS01785"
                     /old_locus_tag="MGF_2598"
     CDS             437187..438572
                     /locus_tag="MGF_RS01785"
                     /old_locus_tag="MGF_2598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="WP_036447271.1"
                     /db_xref="GI:738498339"
                     /translation="MYNYDLIVIGAGPGGYVAGEHAAKNGLKTLVIERGTYGGVCLNV
                     GCIPTKTLLQSSKVKHYIEKAAEYGLDLVNNQLSVNWANILKRKEAVVNKLVNGVKTI
                     LKVAKADTIVGEARIVDGHTVTVNNQTFTTKDIIVATGSSPRKLPLPGFDQGRAEGVI
                     IESTKALELPQIPQSLVVIGGGVIGIEFAMLYASLGTKVTILQAVDRLCELLDQDASD
                     FIAKRMKSLGVNVVYNAKILGYQNNAIIYEDNGTAYQLPSQYILESVGRVVNDQVFGS
                     FNVARDDRNRIKLNDKLQTSTDSIYVIGDAAGQIMLAHYAYHQALYAVDTILNRKTKK
                     LSSLTTPGCIYTYPEIATIGYTEQQLKEKNIEYVVSKMPMAVNGKAIADGSTEGFIKF
                     MFGKKYGEILGCVLIASTASDMISEIALAMENELTVFELEQAIHPHPTIAEIISECAK
                     QAIYNHFNKKH"
     gene            438632..439627
                     /locus_tag="MGF_RS01790"
                     /old_locus_tag="MGF_2607"
     CDS             438632..439627
                     /locus_tag="MGF_RS01790"
                     /old_locus_tag="MGF_2607"
                     /EC_number="2.7.7.63"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="lipoate--protein ligase"
                     /protein_id="WP_011113730.1"
                     /db_xref="GI:499426266"
                     /translation="MAHFYLSDSNNCYINAATEEYLLKHLNLSLPIIYIWQNADTIFI
                     GRNQNTLAQINTNETTKDKINLIRRFSGGGTVFQDLGNICYSYIDYLDEKRANAYQFF
                     AQPIIEFLNSLKINATFKGRNDLEIEGMKFSGTAQYLYQDKILHHGTLLYNTDMSKLA
                     KYLHVDKAKIQAKGIDSIKKRVTNIIDHLQEKRSVTWFIDELIKFYFKKYNLTKIVLD
                     DQAKQWIKDRANNHFKSWEWIYGSSQEYKFNNKKRFSGGELELSLNTDQGVIKQIKFN
                     GDFLSVKQIEEIEEKLQNTKFDYQSFSQVLDQFDLPLYLGTITKEELLSLLFDNK"
     gene            439665..440663
                     /locus_tag="MGF_RS01795"
                     /old_locus_tag="MGF_2611"
     CDS             439665..440663
                     /locus_tag="MGF_RS01795"
                     /old_locus_tag="MGF_2611"
                     /EC_number="2.7.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="6-phosphofructokinase"
                     /protein_id="WP_011113729.1"
                     /db_xref="GI:499426265"
                     /translation="MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEG
                     YKGLVEDQIVLANQQEVIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLV
                     VIGGDGSYQGAKLLSEMGINVIVMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIIST
                     SVSHNRVSISEVMGRHCGDLAVYAALATKADLVITSENIKTTQEIVDLAAKRMLQDHK
                     RTFTVIVCEHIYGEDGRDSLKTIAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAM
                     KFAIKAFECINEQRYGVVLGLSGDEIVAYNFQEALNKRNPSRIKLINLSNRINGGF"
     gene            440672..442198
                     /locus_tag="MGF_RS01800"
                     /old_locus_tag="MGF_2614"
     CDS             440672..442198
                     /locus_tag="MGF_RS01800"
                     /old_locus_tag="MGF_2614"
                     /EC_number="2.7.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="pyruvate kinase"
                     /protein_id="WP_011113728.1"
                     /db_xref="GI:499426264"
                     /translation="MNKKHKDFDLNFLKKTKIVATCGPSITYKLFSLADLEDPSKQEI
                     VQKAKENLRQLFLNGVSTVRLNFSHGNQEEQAVRMILARSVANELNLPISIMLDTNGP
                     EIRLNQISETDNTVKKDQIVKIYTNREIVGNATEFSVSDSSKKYNMAKDVSLGSIVLV
                     DDGKLTLQVIEVAEDFSYIRAIAKNEHKIITKKRINLPNAKYSIPFLSQKDYNDITFG
                     LKNKVDYIAASFVNSADDIYEIKAILKQYGMEHVQVIAKVETRHAIKNLDEIIDVSDG
                     VMVARGDLGLEIPYYEVPYWEKYIIKACRFKNKRVIVATQMLDSLEKNVQPTRAEVTD
                     VFFAVERGCDATMLSGETANGMYPIIAVETMKKINKQSELLFDYKRAITHYFPMTDVC
                     KTAFGERVLDIAKKICPNREIENEDFSTHFLVHFTNNREEIFALSNAKLAASVIIVTD
                     DQNVYTGHGVDYGVFTYKVDDLTKALSNYQLVAKKAILHYSELFEIKPDNKTNFVLLK
                     "
     gene            442208..442501
                     /locus_tag="MGF_RS01805"
                     /old_locus_tag="MGF_2625"
     CDS             442208..442501
                     /locus_tag="MGF_RS01805"
                     /old_locus_tag="MGF_2625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone GroES"
                     /protein_id="WP_011113727.1"
                     /db_xref="GI:499426263"
                     /translation="MNIKPLHDNVLVEVLAEAKTSKLGIITTIQNPDKATSTKGLVIA
                     LGDGMIYAKQQKVDYQIKVNDHVYFKEYSGTEIVVNDKTYKILSYEEIIGVIR"
     gene            442501..444105
                     /locus_tag="MGF_RS01810"
                     /old_locus_tag="MGF_2627"
     CDS             442501..444105
                     /locus_tag="MGF_RS01810"
                     /old_locus_tag="MGF_2627"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7MBB2.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_011113726.1"
                     /db_xref="GI:499426262"
                     /translation="MAKELTFEQQARAKLLEGINKLAKAVKITAGPKGRNALIEKKYG
                     APLIVNDGVTIAREIELKDPVENMGAKLIAEAAISTNDIAGDGTTTATILTHEIVNKA
                     IEAINNGTNPVNLRIGIENAAKLVSEYLTSVSKPIKSIDEITQVGAISSGSKFIGELI
                     AKAMDIVGPSGVISIDDAKSFDTTLDTTDGLEFKGGYSSPYMVTDSEKMLSELANPKI
                     LVSLNKINTVKEILPLLEASVESSAPLLIVASDIAEDVVTALAINKLRGTLNVVSVKC
                     AEFGEAQKNTLEDLAISVNTILVDSAAGIEFKDLELNKLGSAEKVIISKDKTTVINGA
                     CHKDVLAKYLNNLKAKSANLTSKYDKERITKRIANLSNGVAVIHVGGATEVAQKELKL
                     RIEDALNSTKAAVEEGIVAGGGIALMNAIEVLKQVKESNPEIALGYEIVRSSLTAPAR
                     QIIENAGQNSSKIINNIINSKQLGYGYNAETNEFVNMINNGIIDPTKVTKTALEKACS
                     VAALLITTEVAINDELKEEKPSLNHL"
     gene            444208..444669
                     /locus_tag="MGF_RS01815"
                     /old_locus_tag="MGF_2632"
     CDS             444208..444669
                     /locus_tag="MGF_RS01815"
                     /old_locus_tag="MGF_2632"
                     /EC_number="1.8.4.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884644.1"
                     /note="this stereospecific enzymes reduces the R isomer of
                     methionine sulfoxide while MsrA reduces the S form;
                     provides protection against oxidative stress; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methionine sulfoxide reductase B"
                     /protein_id="WP_011113725.1"
                     /db_xref="GI:499426261"
                     /translation="MKKYKKKPIEVLKKELTPLQFDVTQNSATERPYTNEYDQNFKKG
                     IYVDITTGEPLFLSTDKYDSGCGWPAFSHPIAKSLINEVKDLSHNMVRVEVRAKNSDS
                     HLGHVFTDGPTDKGGLRYCINSASLKFIPYEDLKKAGYEEFIAILDQEAKH"
     gene            445112..>445252
                     /locus_tag="MGF_RS01820"
     CDS             445112..>445252
                     /locus_tag="MGF_RS01820"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885993.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_041594305.1"
                     /db_xref="GI:753838688"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LVD"
     gene            445373..446371
                     /locus_tag="MGF_RS01825"
                     /old_locus_tag="MGF_2641"
     CDS             445373..446371
                     /locus_tag="MGF_RS01825"
                     /old_locus_tag="MGF_2641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_011113723.1"
                     /db_xref="GI:499426259"
                     /translation="MKRIRGENQDSQIIPKYQRIIHDKFILDVLSLASTRLSNNEIAD
                     QITSMYGFKVSPSVISNCIQTVQDEMRDWHERPLENNYPIIMIDGKVFKIKTEESGRS
                     KYVNKTLYVVVGINADGQKELIALYVSNTESATEWMNILDNLKERGLSEACIIVSDGL
                     KGLKEAIENVYPKAMHITCTVHMIRNAAKYVSHSMKSDFLRDLKNIYGADNWESAKHS
                     FEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALRTLVYTSNIVENYNSVIGSFLA
                     AKKSFNNINQLLLDLYVHFGYNPRYKKLNQKSNRVRNWYRIYEELMDVFPNLLKKN"
     gene            446552..447613
                     /locus_tag="MGF_RS01830"
                     /old_locus_tag="MGF_2649"
     CDS             446552..447613
                     /locus_tag="MGF_RS01830"
                     /old_locus_tag="MGF_2649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113722.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_011113722.1"
                     /db_xref="GI:499426258"
                     /translation="MYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIPKYKRIIHD
                     KFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDWHERPLENN
                     YPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNTESATEWMN
                     ILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAKYVSHSMKS
                     DFLRDLKNIYGADNWESAKHSFEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALR
                     TLVYTSNMVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQKSNRVRN
                     WYRIYEELMDVFPNLLKKN"
     gene            448220..449275
                     /locus_tag="MGF_RS01835"
                     /old_locus_tag="MGF_2661"
     CDS             448220..449275
                     /locus_tag="MGF_RS01835"
                     /old_locus_tag="MGF_2661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="recombinase RecA"
                     /protein_id="WP_011113721.1"
                     /db_xref="GI:499426257"
                     /translation="MFNKKNYDKIMNNIKNSKRNNDRITNITNYDVLKLLQQKFGKTN
                     IYLNEKDELKDLEAISTGSIKLDHALGTDGFIKGRIVEIYGNESCGKTTLALSTIKQA
                     IDRNMRVAFIDAEHALDLRYVKRLGIDLTKLIIARPDYGEQGFEIIKSLIKTELIDLI
                     VVDSVAALVPKVEIEGKMEDQTMGTHARMMSRGLSRIQPLLAKHNVSVIFINQLREKV
                     GIMFGNPEVTTGGKALKFYSSTRLELRRAEIIKDAANNAIGIRSKATITKNKLSTPMT
                     TTYIDFYFKSGISEVNEIIDLAIDYQIIEQSGSWFSYQKEKIAQGKANLITKLGESEE
                     LYKLIKTEVLNKLKDCQ"
     gene            449291..451072
                     /locus_tag="MGF_RS01840"
                     /old_locus_tag="MGF_2667"
     CDS             449291..451072
                     /locus_tag="MGF_RS01840"
                     /old_locus_tag="MGF_2667"
                     /EC_number="3.1.4.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NB09.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease Y"
                     /protein_id="WP_014574543.1"
                     /db_xref="GI:504387441"
                     /translation="MITISILLMYLIVGLLTALTVLIFVFILLKFYEFRFFKQTETYQ
                     RELEQEILKINKQEELEEKLKEHYLFQSNHKVFTKRDLREIRNFFIAVLSDKILLENK
                     KKLLSNEIIEKKKENEELKTKLDAKKVEEKITLLKEMNLTHEEAKKRLLEEYRGYVRN
                     DLDKMVKEEEKAANDKKNAITNELNKLLINAMGNVSLLTETVRMNTVKTIKYEYVDVD
                     PIKVKKVTDDFFGKIIGKEARNKEYIERLFNVEIIIKPESSRISISSFNTIKLEVAYN
                     ALNKIIEAVNDQGTHVLDESLIRKSWYGALNEFSAEAKRIGEETLKELGLYESAFIPT
                     KEISEFIGRLKFRGSNTQNVLTHSIEAAQIAESIADQLNLNKEKAKVCALLHDIGKAI
                     DKESVSSEGKWKNLKYAANDHVSAGVAIAQYYKFDIDIIDAINCHHGRKKIYEKSKNF
                     YAKITKIADFLSAARPGVRFVKDNDIERRFDTISNILTKYVDEKIISTYKILKNGYNI
                     NLMINPDITESEYSQLTLDLKKDIESDKELSKYPITITYVQNITRSETTNAIAHAKKT
                     VEIYSEDKAELVNDEELSTVEFLDEDI"
     gene            451136..452620
                     /locus_tag="MGF_RS01845"
                     /old_locus_tag="MGF_2678"
     CDS             451136..452620
                     /locus_tag="MGF_RS01845"
                     /old_locus_tag="MGF_2678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113719.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113719.1"
                     /db_xref="GI:499426255"
                     /translation="MDDNKKKSRLIGDALINRTEDFLIEEDDILSDEDVKKNDENLKD
                     GSFSESFNQDSFFNNGSSEPLDSTDRILITEEYDDEDLLNVPSEIIVPDKKHSKTATE
                     YLNIEHITDLYSPNTGTFNTMSVHDVSFVKRGNEIDLEKSNSFSLSPKNQEVVPSLHK
                     VIKSAKPPVIQKADKPIQKKKVLDEIDFEKLSTVEFKLEPTNHDNSKLNNPLVLQSDS
                     VKQDQILKDHDLDFDSKTLDTLVSKPVTKNNIFESSSIIKEFNNKEILVSKPNYRDDK
                     FEKTTGIDFDLGDDDYLIKEISFQKEHEDLTETNSRIQLSLENDPAVIPRKMTVNMQN
                     IESDIDQITNGDKSNLYRYIKTGNSNLATANFLKQTVYKQEKDKSIEHRTDAADSEEL
                     KLVLNRKDNNALVFKDIDERIKKEAQPKKQVKERSYPNDYDPPIQNTNAESHIPIRNV
                     GNKQARKRKNGGINWVVFLVLVLIMIAIAAILFAIVFLLQNRSR"
     gene            452976..454505
                     /locus_tag="MGF_RS01850"
                     /old_locus_tag="MGF_2687"
     CDS             452976..454505
                     /locus_tag="MGF_RS01850"
                     /old_locus_tag="MGF_2687"
                     /EC_number="3.6.3.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_014574544.1"
                     /db_xref="GI:504387442"
                     /translation="MEDKVFIQLRNVNKTFDDGFVAVRNLNLDINKSEFVTLLGPSGC
                     GKTTTLKLLAGFEQPTYGQIKINGIDIKDMPVHKRPFATVFQDYALFPNMTVYNNVCY
                     GLKIMRVPKENTDPKLAVEAENIKKEAEKKAAAKIKDLSRKKNDLSNKLDKIRKEYEK
                     NDWMLENDEMRFAQYQEELIKLEAQLSEAYEQSEINKLNQEIVELKTNYQKKIPIDNR
                     YDKVLKELENADGWTSYWETYPIMKKEHFENKVLTRRLTKKEIEERANNMIKLVGLTG
                     KEDKYPSELSGGMQQRVALARALVIEPETLLLDEPLSALDAKVRKQLQNELKRIHKEL
                     NITFILVTHDQEEALSLSDKIVVMSQGDIEQVGKPNAIYDSPINEWTAKFIGAANIFD
                     GKYLGDYKIELNSGDIIDTDEEYEFKKGDNVRVLIRPEDFDVVEKDQGFFNVEVIKTS
                     YKGVLWEVECLMSDKTKIKVDNIDEVKVGAIVGLKFDEMDVHMMRKEEEEEEEEEEED
                     V"
     gene            454432..455427
                     /locus_tag="MGF_RS01855"
                     /old_locus_tag="MGF_2698"
     CDS             454432..455427
                     /locus_tag="MGF_RS01855"
                     /old_locus_tag="MGF_2698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_041594404.1"
                     /db_xref="GI:753838787"
                     /translation="MTKWMFTWWGKKKKKKKKKKKKMFKNFRSIKNFNAIAQTLKAPK
                     KTWLILPYFLLLLVLFIIPLIIVLVNAFSPFSVQTQDGKTIPVDVSENFSIIDSFTIT
                     KMLKSFGLAIACTIICLVIAFPFAYILSITKSKLFKYSVVALVTAPIWNSFLIKVIGL
                     KSLLDLIFGEANSTFGDGWSLLGLVYIFMPFMILPIYTVLISMPKNYMLASQDLGYNY
                     FMSFFKIVIPYCKNAIISGVTLVLLPSFTTAGIGRFVNNANNGELIGGYLLSLGANGL
                     ESRVAISQASALSLTLAILILVFYTLFFVVPKIFGYLKKRSVLKNKIKAAVDHNE"
     gene            455420..456265
                     /locus_tag="MGF_RS01860"
                     /old_locus_tag="MGF_2705"
     CDS             455420..456265
                     /locus_tag="MGF_RS01860"
                     /old_locus_tag="MGF_2705"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_014574546.1"
                     /db_xref="GI:504387444"
                     /translation="MNKLKSILRQSYIFIILLFIYLPLLIIVVLSFNGVTERGNVNVT
                     FSQFDPNKAFETYLALAEGDFLTPLTTSLIVAFVSTPISVFIATITAFGIWRNKKVYQ
                     KLMISASNTSIVVPDIIAGLSLIIFFIAVWVSLAQPLGLFTIIISHISISTPFALVSI
                     YPRMLKMNPNLILASQDLGYNKIQTFFKITLSYLTPALIVGGLIAFATSFDDFIITSY
                     VRGSARTIATELYSIAKGIKGWAIAFGAILVFIGILTTAISVIKKAITERINYKEKVA
                     RSIHN"
     gene            456243..457682
                     /locus_tag="MGF_RS01865"
                     /old_locus_tag="MGF_2711"
     CDS             456243..457682
                     /locus_tag="MGF_RS01865"
                     /old_locus_tag="MGF_2711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014574547.1"
                     /db_xref="GI:504387445"
                     /translation="MLDQFTTNVCIKMKKKPVKLIVSALALSSVLLTSCEAGANLLNR
                     NFVYANFESYMSPNLQSELRQTYNNLQFDAFASNEKALTNFKNKTYTIGTLSTYAVLD
                     LIHQGILQKLDWSKFNLSYLNDQDQEVPIHNANDALGLFTDEVQEILTSYSIDNKPVN
                     LLDYAVPYFFQSLVFAYRGAKIDSLVDHQSSWYDILSTISSEQYRDRFNNNKLGIVED
                     ERSLYSIANLIKTTKENQTVTVNPPPSQLTLSDFYNVYQEIADAGINYRNLATNNRST
                     ALLNSDSSVILNNLDSGRIDGGIMYNGDAIFSAQGGEFHAEKDDPLKPKSEDFHIVTP
                     VNTPLALDLIVVNKLNIEQFPGFLDQAYQVIKKVGLEGVNETLADFQAVLTEKPETIY
                     KNGPLENFNYVQYTSPLKKISDPENGLVAVEGWLEVADQEELSNNINSAYFIQDIKNV
                     TNFIEAPLNDIQKASLVNAFARFKNNWLR"
     gene            457711..458673
                     /locus_tag="MGF_RS01870"
                     /old_locus_tag="MGF_2719"
     CDS             457711..458673
                     /locus_tag="MGF_RS01870"
                     /old_locus_tag="MGF_2719"
                     /EC_number="3.4.24.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA threonylcarbamoyladenosine modification
                     protein TsaD"
                     /protein_id="WP_014574548.1"
                     /db_xref="GI:504387446"
                     /translation="MYYKVILGIESSCDDLSIAIAIDNKIVTTKTKSSSSVHANYGGV
                     VPEIAARYHEEILHQTLNEALTEANLTINKIDLITYTENPGLLNCLHVAKVFANTLGY
                     LLKIPAQGINHLYGHIFSPMIDDGDCLYQKSDLIYPALGIVVSGGHTAIYDVQSPSKI
                     TLLDETLDDAIGEVYDKVGRALGLQYPAGAKIDQLYNPEQAETVEFLKTNKLSAFSYS
                     GFKSAVLRYIELNKDQPDFNLVQVVSSFQKFIIDDFIDRIKNVINKADSKYQTILLGG
                     GVSANSYLRSELKELAIKTLVPKPIYSGDNAAMIINYAQFLLNE"
     gene            458782..459906
                     /locus_tag="MGF_RS01875"
                     /old_locus_tag="MGF_2728"
     CDS             458782..459906
                     /locus_tag="MGF_RS01875"
                     /old_locus_tag="MGF_2728"
                     /EC_number="2.5.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="WP_014574549.1"
                     /db_xref="GI:504387447"
                     /translation="MYTAESVGSAHPDKLCDQIADAILDACLKQDQNSRVACEVMACN
                     HLIIIAGEISTKASVDYVGTAWKVVNQFGYDRSDFTIIANINQQSSEIAQSVDQKNHK
                     IGAGDQGITVGYACDETKNQMPLAVMMAHDLVRLAKELIDNKTFNHAKYDMKAQVSLN
                     YLDNNQVELKTILMSIQHKENVDLSVFKLFVKKFIMDEVATKYGFNKNYEALINPSGL
                     FVSGGPTADTGLTGRKLLVDSFGIYAHHGGGAYSGKDYTKVDRSGAYYARWIAKHIVK
                     AKLASQCEVIISWAIGLTKPLDIVVNCFNTNTVELELINQIVKKIFNHDLATIIELLK
                     LKTTNYSGLAVYGHFGKSEKQYRFEDTIYLDQILKISNKE"
     gene            complement(459988..461106)
                     /locus_tag="MGF_RS01880"
                     /old_locus_tag="MGF_2742"
     CDS             complement(459988..461106)
                     /locus_tag="MGF_RS01880"
                     /old_locus_tag="MGF_2742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574550.1"
                     /db_xref="GI:504387448"
                     /translation="MNPFSQWIKLVEKLHYDSGYVFCNIVDLVLINHLNFHKVSKPLT
                     FFLIYDQNLNELSIFDNSNGFSYYELISLSNFFQGDNEQYHGYFRSLIKLAYQFEFFN
                     QSASEEVGYYFKLHNVNQQLIFNDLKQIQRGEYYNRTSFANGTLIRLKQLKAPYELND
                     FKVIANQLKLIYQKFINTDKLKFYILYKKGQEFFDLSTNPLNKLTTLDKAKSLAKTKK
                     PALANLKNGKKRILIQETIDWNNQKIYLSGYLGVLSEPDFKKAGLYLYNNNKLVKGIN
                     VYDRYRPELLFGSASHLNNAYLYGELELANLSTGLSSDIFEYDARFEKQLLKILLSIV
                     GDQRYNQTDKISGLIKALAKQKKANRPPTKVTNKEKMK"
     gene            461177..461950
                     /locus_tag="MGF_RS01885"
                     /old_locus_tag="MGF_2743"
     CDS             461177..461950
                     /locus_tag="MGF_RS01885"
                     /old_locus_tag="MGF_2743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_011113711.1"
                     /db_xref="GI:499426247"
                     /translation="MYNTVLLYIYLKIQSKQWLPNKRIPSERQLSIKFGLSRNLIRKV
                     FSVLCNYNVLDNNTKPGYFVHKDYKTGFFINFLDFDKVISFDHTELYRTPFSQYDINM
                     FKELSNKDDFLSSAFPKVNQVVYYDQNKEVVFVNQVLLNRKLLVYHNTNAMSFQDFVM
                     FAENGQPIVRHKQISMVCTDMGPVKEFIKPNKLNNNYLVTYSVYFNIENEILAISKIF
                     HLLPDSKINSLDVKLEFHDYQSRIESKIKNDTLVKRGRK"
     gene            462032..462973
                     /locus_tag="MGF_RS01890"
                     /old_locus_tag="MGF_2748"
     CDS             462032..462973
                     /locus_tag="MGF_RS01890"
                     /old_locus_tag="MGF_2748"
                     /EC_number="1.8.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thioredoxin reductase"
                     /protein_id="WP_014574551.1"
                     /db_xref="GI:504387449"
                     /translation="MSYRVDGKNDLFDLVIVGSGPAGISAAIYAKRANINVCVVEGSA
                     PGGKILKTGFIDNYPGYTSIKGPDLAVNMFNQLNSLSVPIFYSQVNAIEKQENYFFTY
                     LDSKTLLSKAVIVATGTLERKLGLANEAKFETKGISYCAICDGPLYKNRDVAVVGGGN
                     AAVEESLYLSGICNKVYLVHRRDEFRADSYAVAKLKEKKNVHFLLSHVVDSYLGDQTL
                     KGIKVKNLKNNELTDLTIDCLFPYIGAVPNTSFLKPFNILNEEGYVLVDANQKTSVDG
                     LYAAGDCVHKKIRQISTAISDGTIAALAVNDFFKLHK"
     gene            462974..463861
                     /locus_tag="MGF_RS01895"
                     /old_locus_tag="MGF_2751"
     CDS             462974..463861
                     /locus_tag="MGF_RS01895"
                     /old_locus_tag="MGF_2751"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574552.1"
                     /db_xref="GI:504387450"
                     /translation="MVTFSQEVKSEICDQSLDEKNAKYFLNGMIFDKLQLVDESYQSY
                     TSQHPKTIIFLKKILILLNQELKNEIRHTHRINQLKKHEYELIFKLDKSLLSLDNHEL
                     EEQQLRAFFGGLFLSVGNLSKFSAKDHHLELIFNYEHKALLTHDFLVQNGFSNFKLIT
                     RKNKYILYLKKTQEIIDFLAYINAFSCMFRYEDSNLKRKLVRKVQLSNNLDIVNLTKT
                     IDLNNKLIPMIEMIVNDQAFHEQKPLFKSYCYTKLNHPSASLAELSELLTKQGYQITR
                     TGLGHYNKKVRTLYKQLKN"
     gene            463906..464139
                     /locus_tag="MGF_RS01900"
                     /old_locus_tag="MGF_2757"
     CDS             463906..464139
                     /locus_tag="MGF_RS01900"
                     /old_locus_tag="MGF_2757"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_011113708.1"
                     /db_xref="GI:499426244"
                     /translation="MNPTEITFFVLAIIALIVGLGLSNSGTTGGLASLSGQDLEIFKK
                     TKDRGIIKILQIVMFILMLLFLILGLIYHFVIK"
     gene            464170..466344
                     /locus_tag="MGF_RS01905"
                     /old_locus_tag="MGF_2759"
     CDS             464170..466344
                     /locus_tag="MGF_RS01905"
                     /old_locus_tag="MGF_2759"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113707.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease R"
                     /protein_id="WP_014574553.1"
                     /db_xref="GI:504387451"
                     /translation="MNNNNNRRKIINDILQIVRLEDKKPIPPGIIVKKLDNRYTKTAI
                     YKEIDKMLANGELKKLANNKVVLGYQNSAPDLSKIMVGRLAIGTNGNGFIKLENEELS
                     KYYVHNSNLNNALNNDLVEFAPLSVQNDWYKHDLTDACILKVLERARTRYVGTYEDTG
                     DEYLVLPDDPKLIYKVVLDRHYLELKEHDRILFEIIEIKQGVIRAALVKKIGSKEDLG
                     IDIDAIAYNHLIEPTFSQEIINEAKSLKYELDDHQKAIRKDLRDLSFVTIDPASALDL
                     DDSIYLKKIDDDSYNLKVAIADVCHYVKFDGPMDRGARTKATSVYLANKVIPMLPEEL
                     SNDLCSLNPGVDKFVIVGDLMIDGTGKIMSHEFYPAIINSHKRFSYEEVNEYFSATND
                     LKDVDPSIRQMLDEARVLAKILRRMKIKRGYLQFDIDETSIELDDRFEPINIVKKPHG
                     EAQEMIEDFMVAANEAVCLFASKYNLDFIYRVHSKPAVHKLNSFANWARALEFEIFGD
                     LNSIKSTDIQKWLTNNADHKQIKLINKLLLRSMNKAYYSVENTRHFSLASKHYTHFTS
                     PIRRYADNIVHRILWMFIFDPQAYTDLQRNELKSHLVEWCDLINKQELVAVDCERDVN
                     AFLYVKYMSNFLGNWYHNVTINAITNFGMFVELDNGIEGLVRLNNINGDYYRYDPNTD
                     SLIGRNNHKKYQIGDTVDVKLLSADKRLKRIDFAIHEDNKCK"
     gene            466335..466967
                     /locus_tag="MGF_RS01910"
                     /old_locus_tag="MGF_2771"
     CDS             466335..466967
                     /locus_tag="MGF_RS01910"
                     /old_locus_tag="MGF_2771"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884601.1"
                     /db_xref="GI:500214437"
                     /translation="MQITTLLILILIAFLVIMVVSIIQFIIFIFTKKAEKESFFNFFK
                     KIFKKKQDDRSLNDFYDNLSSSLLKLSADKIGGIIAIEREDNLDYYINVGYKITGEFS
                     PEFIISVFYNKNSPLHDGGIIIRDMKMVSISSYFPMTQQLLDVSYGARHRAGVGLSEK
                     SDAIVFIVSETNGKISVAQKGRIKRLSNNPERLFDEIIKLLDDKKPRDFF"
     gene            467149..468897
                     /locus_tag="MGF_RS01915"
                     /old_locus_tag="MGF_2779"
     CDS             467149..468897
                     /locus_tag="MGF_RS01915"
                     /old_locus_tag="MGF_2779"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="VlhA.2.02 variable lipoprotein family protein"
                     /protein_id="WP_014574554.1"
                     /db_xref="GI:504387452"
                     /translation="MKKKSLFRLASLIGVGSFAAVVPASCNSLIRSVNHTEIAPDDSN
                     RSNNNQDGDQGGLSNQSETRNQLSGLLNKQANQVGMYNEYKQIQAGLKGAYEAAKAVV
                     DNANSTSEQLNEAKTALENTISQAERNKDSFNQNNAQLIGVYNQIKEQISGINESLDR
                     AAYSGIRAKLRPIYQAAITVLQNGLQTAGGSVVSLPYATKVSSDLSAALAKLPEWKQN
                     ADEFANFKKFALSPTNFVGPIANDNAEQPSDFGFSAFSVAVDASYKYAKNKIKVGDAT
                     NASEEVQALTDVGWIYNFGREANDGYEFSFDYYGPSKAWLYFPFKLSKQTNQTVSFYY
                     SLNDRNAAIERKVIINAPTVDSIQVAKVPLDDLKFGRNKVAFSSIEGTTTPMVGNFYI
                     SSSDHNDDSVYNSIFGNTLSEDKNSVTVNFLDGYGLADNSKTLLRQVSATLGDSTESN
                     AYYVIGWLGGNAGNNTMSATSINSTSRTYTFYVNAPKAGAYNVSGYTNSNQARDLVFK
                     TAPLPKNPQQTYTLTLSSLPASGENKVVKFDTATMGNDKTLTLQKGLNRIVVMGGTSF
                     EGNAPNLGNVTFTFKG"
     gene            469171..470988
                     /locus_tag="MGF_RS01920"
                     /old_locus_tag="MGF_2791"
     CDS             469171..470988
                     /locus_tag="MGF_RS01920"
                     /old_locus_tag="MGF_2791"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="VlhA.2.01 variable lipoprotein family protein"
                     /protein_id="WP_014574555.1"
                     /db_xref="GI:504387453"
                     /translation="MKKNLLKVISFLSVGSILGLTLSSCTSLSNSVEQKPVDPINQQP
                     KLNTGEQTKRQLNNLIDSQPTTLQMYEDYKNIRNTLNAAYQAARIISDSNNSTPEQLE
                     AAIVALRNAIGKASADRTAFNNQHSELVMAYNRLKAQMQSASLIISSLNQEKYSAIKT
                     NITPIYDQAKAIIANTLQSFGQKEKATITNIENITQSISKLVSEKQNADEYAVFKRFD
                     VKKENLIGTFANTGPVPEEYSFVAYSANINNYSYNFATPKIWVYPHEITDRSEGAIVS
                     NSSELTNVGWIYSLTPAAQAEAKYEFNFEYYGPSSVAYLYFPYKSINSLSNRIVFDYL
                     LNHQESSDNSFRDHLIIPTPSVDSISVIRLPITNLRYGMNTITLRSHKNLPFPVVGNM
                     YLSSAPDGDTNALDKIYNDIFGNIVSPDNPKEITVDVLKAYGLASSSTIVMRQFNPNV
                     NNKPLTLDGVAQNKPYYLIGNLGGSDQTGTASPNALRTFSPNTRTYTFYVNAPQAGSY
                     NISGIYNSSQSLGLEFKTTSGTGQTQSTSVVKITNLSSGSTDADNTLKTFDTAKTETT
                     VEDTTRVLTLTKGLNKILVTGLGSNAAPNLGNITFRLAS"
     gene            complement(471170..472285)
                     /locus_tag="MGF_RS01925"
                     /old_locus_tag="MGF_2806"
     CDS             complement(471170..472285)
                     /locus_tag="MGF_RS01925"
                     /old_locus_tag="MGF_2806"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="permease"
                     /protein_id="WP_011884597.1"
                     /db_xref="GI:500214433"
                     /translation="MSKKLISKKFEQVPLALSGLTLGTIGLGFSWETLLTHFKQVSSA
                     PETYKTATLVVLFMLMLLSLLYGTIVAIKYLTNRKQFVGYLRTPNQAGWVFPFFMALG
                     LFGNFLGYLNVNYLQTNFAFSVVINIIVVFSTLCHVLCLIYFVNVVLAKHDLEKDEVY
                     TSWNMPLVGLGISCSFYPNLGLNNEYYLAYYQILWLICSFLFVGSYFLFGYKQLFKGF
                     ANKEDIGTMSIMASPPNLLLVGFLRIFNPAVHQHALLINFSVTAFNILTYSFIFFSMV
                     GLFIYFLTAIKLLVMRNFGFAWTAFTFSGTINARALLDTVNQGGLPNSIYYILLGISV
                     GLISVVSLIVSLLTIKTFLNFKTWFEHETKVHTSGMV"
     gene            472434..473771
                     /locus_tag="MGF_RS01930"
                     /old_locus_tag="MGF_2807"
     CDS             472434..473771
                     /locus_tag="MGF_RS01930"
                     /old_locus_tag="MGF_2807"
                     /EC_number="3.4.11.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase M17"
                     /protein_id="WP_011884595.1"
                     /db_xref="GI:500214431"
                     /translation="MEKNTKKTHSSSKKMLLVQAKVNNKLKDYTFKTEGGVVLFEFTS
                     HYDGVKLYNKLVEMFCSQKEKVEVDLDSFLTATNADSETVALLVACAIEYASVIPFTR
                     KTKPDTKPSFLVKVSKEFKAAYDAAKNVAEAVTLSRRLQDTPSDVLYPETFVDLFKAE
                     FKDLKNVKLSVYNKEQIKKMGLNLLYGVNKGSERECRFLVVEYLNNKSSKEKFAYVGK
                     GITYDSGGMNLKTGPHMRNMKYDMSGAAIVVSTVLALAKNKVKTNVVALAPLTENLIG
                     PKAQRPDDIVVAYNKKTVEIDNTDAEGRLVLADAISYAALDVKATRIFDVATLTGLMS
                     YILGKTYTGVFSTSDKFWKEFEDNAFSAGEAVWRLPMHNDYLEMLKTPLADIANSTNA
                     PYAGSSRAAMFLNEFAEGVDLIHCDIAGTGSDKAGLGLSPMIRALYLQAKNQK"
     gene            473797..474078
                     /locus_tag="MGF_RS01935"
                     /old_locus_tag="MGF_2818"
     CDS             473797..474078
                     /locus_tag="MGF_RS01935"
                     /old_locus_tag="MGF_2818"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884594.1"
                     /db_xref="GI:500214430"
                     /translation="MLKEHNEPTNQPDLEQVKQSHTKLIQEQEQLDLDKKTDKHNEVY
                     EYQSNSKLDKLSKWTKILIIIFLILLCVGSIVGAVFAVMTARSMGLQQS"
     gene            474145..474783
                     /locus_tag="MGF_RS01940"
                     /old_locus_tag="MGF_2823"
     CDS             474145..474783
                     /locus_tag="MGF_RS01940"
                     /old_locus_tag="MGF_2823"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594432.1"
                     /db_xref="GI:753838815"
                     /translation="MIRYFYIISKYFMEYFKSSIYKKTNPLILTLFLLFFVVGYYVVI
                     WVLFGEFNLLKLNWLLGEGVIITQDQMINQRNFNPLILAFIFPPLGVYFLLILLIRYL
                     FKQTAYDLIPLTYSFSIALITIILSGLFKFANQGLIIFGRIVLVIVVFSISFFLLVFI
                     INKLMIRLDLKHDYVYLNDLLEENQNKNKRTEQIKQLKKPESSTITISDKNK"
     gene            474788..476092
                     /locus_tag="MGF_RS01945"
                     /old_locus_tag="MGF_2827"
     CDS             474788..476092
                     /locus_tag="MGF_RS01945"
                     /old_locus_tag="MGF_2827"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NB30.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase CgtA"
                     /protein_id="WP_014574557.1"
                     /db_xref="GI:504387455"
                     /translation="MQFIDRCQIKLIAGNGGDGIIAWRREAHYDKGGPAGGSGGKGGN
                     IILVADHNQSTLLSLKYSKIIRASNGDNGKPDLSSGQNGMDKYVKVPIGTTVYDEQTN
                     EVIVDLIRDKQEYIICHGGKGGRGNAAFKSSTLRAPNLYELGDEGEEKAVRLELKYLA
                     NVGIVGYPNAGKSTLISKLSNAKPKIANYQFTTLVPILGIVENNDKRLVFADIPGLIE
                     NASEGYGLGHDFLRHVERCEVLIHLISMNPLDHDDVIDAYEKIMTELRKYSQLLVNKK
                     MLVVANKMDVEGASENFNKLRSYLAKKGIDISSISAINGDVNNLVDRVFDLYQKTLST
                     TTETNPFSIPMVAEKVYYYDGEKTIDDDPLDVIKDGENRWIVSSKKLTYWFKKIPQTT
                     LDNITRLGQKIKSLGVEDQLKKMGAKPNDVIVICDYEYLIDE"
     gene            complement(476095..476379)
                     /locus_tag="MGF_RS01950"
                     /old_locus_tag="MGF_2844"
     CDS             complement(476095..476379)
                     /locus_tag="MGF_RS01950"
                     /old_locus_tag="MGF_2844"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884585.1"
                     /db_xref="GI:500214421"
                     /translation="MNFKLTHHSRIRAVQRLVLQEKNELFIDHEINEILRDLIPYYVD
                     KKNFAYFEIPKKFLIDRHKRTYAIVDQNNGIITSITPISPSKFIKIYSMN"
     gene            complement(476369..477013)
                     /locus_tag="MGF_RS01955"
                     /old_locus_tag="MGF_2848"
     CDS             complement(476369..477013)
                     /locus_tag="MGF_RS01955"
                     /old_locus_tag="MGF_2848"
                     /EC_number="2.7.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytidine kinase"
                     /protein_id="WP_014574558.1"
                     /db_xref="GI:504387456"
                     /translation="MKNVQPMIIAISGGSGSGKTTITQSIIAKIKSDTNLKVATVCLD
                     NYYKPFSDLSLEARKKLNYDDPNSFDFDQVYYDLLALSNNQTIKMPIYDYKNYTRSDQ
                     FTEINPSDVILYEGILSLYDPRILDLSKFKLFIDTPSDERLARRIERDSLERARDIKQ
                     VLNQWRSQVRVMHRKYVQKQKEDANLILPWYTLNHEGMSIIQNAIIKIAQGNEF"
     gene            477088..478458
                     /locus_tag="MGF_RS01960"
                     /old_locus_tag="MGF_2849"
     CDS             477088..478458
                     /locus_tag="MGF_RS01960"
                     /old_locus_tag="MGF_2849"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="arginine deiminase"
                     /protein_id="WP_011884582.1"
                     /db_xref="GI:500214418"
                     /translation="MAVKKKKTEKRSVKVSSKKVDNQPIVKVNNQLTTLDDRDARLKA
                     KTPLDFNVYNNSSKLKEVIIYRPGIEVERIIKKNQTTFSSAKHLERIQREHDILSAIL
                     QKNDVKVQYLNLMLASALDQLDEELKEEFIQRFILEAKITSLSAFNTLFNYFRSFDSN
                     LEMINAMIAGVRKNEVPSLIINRFSDLVLDDSAYYIQPLSDFLLQAKYFGTIGNGVVI
                     YQHNDDYFNRHTLFYEYLVKFHPRFNNVNLYFSRNTDKCYLSSDDILLINQDTLLISV
                     SEHTNILGIEVFARNLYNDPKNKILRIIVCARKNSDQFIRMNQLISSLDYDKFIVHQK
                     ALGEMVFFELLDSEQKDIDGLNKLEFKEIEISFESLIELIIKRRPKFILSGGGDELNG
                     ISEANNSALEVLMIKPTEVIVYDRNKITNQLLLQQGLVVHYLPSAELARTNAGVNNLV
                     IPLIRE"
     gene            478506..478582
                     /locus_tag="MGF_RS01965"
                     /old_locus_tag="MGF_tRNA24"
     tRNA            478506..478582
                     /locus_tag="MGF_RS01965"
                     /old_locus_tag="MGF_tRNA24"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:478540..478542,aa:Arg,seq:tct)
     gene            complement(479222..480481)
                     /locus_tag="MGF_RS01970"
                     /old_locus_tag="MGF_2868"
     CDS             complement(479222..480481)
                     /locus_tag="MGF_RS01970"
                     /old_locus_tag="MGF_2868"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014574559.1"
                     /db_xref="GI:504387457"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LIDGEHVGKLELLRENADNDENVYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIP
                     KYQRIIHDKFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDW
                     HERPLENNYPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNT
                     ESATEWMNILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAK
                     YVSHSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGGSNKRAVEVVERAMDNIEKL
                     FSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRHKTLN
                     QKSNRVRNWYRIYEELMDVFPNLLNKN"
     gene            481411..481572
                     /locus_tag="MGF_RS01975"
                     /old_locus_tag="MGF_2871"
     CDS             481411..481572
                     /locus_tag="MGF_RS01975"
                     /old_locus_tag="MGF_2871"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NB34.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_011113695.1"
                     /db_xref="GI:499426231"
                     /translation="MAQKRGTRLGCNDCNEINYITRKNAKKNPEKLSLNKYCSRCRGT
                     TVHKEVKRK"
     gene            481572..482633
                     /locus_tag="MGF_RS01980"
                     /old_locus_tag="MGF_2872"
     CDS             481572..482633
                     /locus_tag="MGF_RS01980"
                     /old_locus_tag="MGF_2872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="WP_014574560.1"
                     /db_xref="GI:504387458"
                     /translation="MLTADFQFKHDIIKKALKQHKADAILFTSDQNRLWFTEFKSSAG
                     FLLVTNTKSVLVIDSRYYLAASKEIKRTEVVLLAANVLSDVAKKLKIKHLLIEGDYLT
                     YQYQSMLDRISEKQTPIETQSLRAIKTPSEIKKLKKVIDITKEVGNKLTSMMKVDMTE
                     IQLAKLVTFALIDAGGEKNSFDPIVASGPNGAKPHHHPTNRKFKDGDFVTVDFGTIYQ
                     GFCSDITRTWVLNKPKNQRLINAYKLVDKSNQAGIKAAKADMTGQEVDAVCRKIIDET
                     EFKGLFVHSTGHGVGIDIHEKPNVATSYTDKLGVDSIVTIEPGIYIPNVGGIRIEDMI
                     QVKADKSIWLSKDIKRMKL"
     gene            482639..483379
                     /locus_tag="MGF_RS01985"
                     /old_locus_tag="MGF_2882"
     CDS             482639..483379
                     /locus_tag="MGF_RS01985"
                     /old_locus_tag="MGF_2882"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884562.1"
                     /db_xref="GI:500214397"
                     /translation="MFKFQHEDIDSKISELKKELEKNRKPSKLLTVLKVDLWRFISAA
                     IFSLSLLILSLLIFIGVVYPKQFALNSQNMIGLFWIYQPNNDPLIGTFMRTSASLQLT
                     SYGISCIIFFLINMVSVLFYYGYSFKDQNYLNLDKKARTIFNYKAFSYSFFILVSGII
                     FILGLVVTDFTQFPDSSRPIAINQSFGYAFKITKELSPNVYQLGIDLFGYLLIILFFI
                     FNLASIYSFFKLNTKLTDHLFKKKQPKH"
     gene            483379..483810
                     /locus_tag="MGF_RS01990"
                     /old_locus_tag="MGF_2884"
     CDS             483379..483810
                     /locus_tag="MGF_RS01990"
                     /old_locus_tag="MGF_2884"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011884560.1"
                     /db_xref="GI:500214395"
                     /translation="MRLLVNNKKAKYNYELLDKYEAGISLSGNEVKSLALHHGKLDDS
                     YVIIRKNEAYLLNLLIPKYKFDTSKVLNETRTRKLLLHKSEILKIDLIKKQQSLVIIP
                     YQIYFVNNKIKISIYLARPKKRYDKRQTIKEREINKKIRKY"
     gene            483818..485458
                     /locus_tag="MGF_RS01995"
                     /old_locus_tag="MGF_2888"
     CDS             483818..485458
                     /locus_tag="MGF_RS01995"
                     /old_locus_tag="MGF_2888"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="aminopeptidase"
                     /protein_id="WP_011884558.1"
                     /db_xref="GI:500214393"
                     /translation="MNKNNKIDFQKYLKKNLSYQKKREYLLTRNALVANDINLMAANV
                     FNPDKNLTEFLVDAHKPTLTITNQDMSGRCWIFAGLNPLRRQTAEKLKVSNFVFSQTY
                     MDFWDKYERANVFLNKMIEKADVELDDRDLKAELQSAGQDGGWYGFFENLVNKYGLVP
                     QEVMPDSFSGHNTFILNELLQVVLIKATKEIRAHKKASQKQKEVVDATLKKVLEMLVL
                     AYGPVPSKFDWQYVADAKKDEENKELANKEEKSTKTKVEQKTPVQQEEEKAKQELKEI
                     KTEFSFIKQITPLEFSKQYVNYQEYDFLDLWTIGNTTDYKINQRYSLKDSNNLFEASD
                     FNFLNVDRNILKFFALANLVAKQTMWFACDVNHYRNNKTGGFDNQQFDYQSLFNIDFS
                     VDRNKQVRSHFISSNHAMTLSGVDFDEAKSLLKQKELVKKYKNLKKFDQYQFVLDLSQ
                     TLVFKKWKIENSWGEKVGNKGFYYMNDQWFNDYLIDIVISTKAADDFFKNPKFIDPDL
                     IGLVKQLKTKEILKAGLSTEPILIDGYDPLGANNKGVK"
     gene            485458..486948
                     /locus_tag="MGF_RS02000"
                     /old_locus_tag="MGF_2898"
     CDS             485458..486948
                     /locus_tag="MGF_RS02000"
                     /old_locus_tag="MGF_2898"
                     /EC_number="3.4.22.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="aminopeptidase"
                     /protein_id="WP_014574561.1"
                     /db_xref="GI:504387459"
                     /translation="MAKLELKDSLKQLNNLSRSKFNKQLTNILNTVGVKGVSYNGYNF
                     SKNSLSFNLDLSAQPITNQFQTGRCWIFAGLNLLRYHLAKELNIDDLELSQSYLAFWD
                     KFEKANYFLETVTELRDKKVSDRTLSFILKNGVADGGQWTMLTNLIKKYGLVPKSVMP
                     DIANSASTNQLNYLINLKLNQAASKILDNKDKPVAELNKIKTKALDEVFYLLSSIYGE
                     LPTKFDFSYTKVIKKDSADRSESHFNYLPKKVVEINFTPLTFYQKYFKQLVEKQGFVS
                     VINAPANNKPFNQTFSVKYLNNVIESDEILHYNLEQGLFSYLTIKQLFNQQPVWFGCE
                     VKNIYLNEAKTFWDDQSFDYQTLFNVDLSLSKNDQLDYWLSSINHAMLITGVDLDLEK
                     FNQIDQEFNQLVKANKIKQAYQYLVEQMDQLTIHKWKIENSWGQDLGHAGYFVISDSY
                     FKRYTYQVAINQQLFNQLVEQLKLTKEFDKPVRLLEPWDPIGTLAK"
     gene            486918..487379
                     /locus_tag="MGF_RS02005"
                     /old_locus_tag="MGF_2902"
     CDS             486918..487379
                     /locus_tag="MGF_RS02005"
                     /old_locus_tag="MGF_2902"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884554.1"
                     /db_xref="GI:500214389"
                     /translation="MRSNWNPSQIIDEINNSIKNKKQPMILILVGFIIGMIVFGIGIY
                     LSLSNPNSNNANRSLETNDMNTKAENSTQSTASRLFLIAFIIIFGFVMIGFFIHIKER
                     NNFQDLAYKTNLFLKKHNYFFKITKYQIKQLIIAKALIKEIQESSINQDVK"
     gene            487369..487779
                     /locus_tag="MGF_RS02010"
                     /old_locus_tag="MGF_2908"
     CDS             487369..487779
                     /locus_tag="MGF_RS02010"
                     /old_locus_tag="MGF_2908"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884553.1"
                     /db_xref="GI:500214388"
                     /translation="MLNKLAEKLKMTKKELKERLNVSDDVSESQLLLALGFDKMAAYN
                     DLLNYTKNLVGSEQIDLNNLNANSFDGIFEKIQEDIVNDPRASDDVRKMAEFMEKLQS
                     MYGDAIFNHDYGAESDDEKEDKPISVPKDKKNLS"
     gene            complement(487849..488214)
                     /locus_tag="MGF_RS02015"
                     /old_locus_tag="MGF_2915"
     CDS             complement(487849..488214)
                     /locus_tag="MGF_RS02015"
                     /old_locus_tag="MGF_2915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574562.1"
                     /db_xref="GI:504387460"
                     /translation="MVFNKSKDLLISKPKIYINLKSNMISNLVGVDLSSVILQIEHNW
                     ATERKRKRNLIKKIDRLIDESWNNDLKKVISKFKRLHRWNRDEIDYFTSRIINLQNNE
                     LNLFLNNRRPDQLLARKKK"
     gene            488495..489334
                     /locus_tag="MGF_RS02020"
                     /old_locus_tag="MGF_2916"
     CDS             488495..489334
                     /locus_tag="MGF_RS02020"
                     /old_locus_tag="MGF_2916"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="2,5-diketo-D-gluconic acid reductase"
                     /protein_id="WP_014574563.1"
                     /db_xref="GI:504387461"
                     /translation="MKYNLLANNYKMPSIGFGTYKLEDGKQTVEAVKTALEVGYRHLD
                     CAEIYENQRSVSQGIKLSGVDRKEIFITSKIWNDDKGYESTKKAFDKILKDLDLEYLD
                     LLLIHWPIGKGFKDNWQEVNAQTWKAMEEFYLEGKIKAIGLSNFLVHHIEALKKSAKI
                     LPMVNQLEFHPGYLQPEIVEYCQKNNIVVQAWSPFSQSKVLENKTLVKLAKKYEVTVA
                     QLILNWIIQKDIVPLPKSKTPERIRSNFDVFNFGINQADLKVIDQLNDCGGLGLHPDQ
                     VDF"
     gene            489428..490003
                     /locus_tag="MGF_RS02025"
                     /old_locus_tag="MGF_2919"
     CDS             489428..490003
                     /locus_tag="MGF_RS02025"
                     /old_locus_tag="MGF_2919"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phospholipid-binding protein"
                     /protein_id="WP_014574564.1"
                     /db_xref="GI:504387462"
                     /translation="MRWIINMDMKKKHAIWSNCFTETGDGVYLKSETVKLNNNRYESL
                     DLTWDKIEGAKSYAVVMVDYEASRVIGQSFIHWVVANVKENKLAYAANINDKSIVQGL
                     NSTAQGQTESSRGVIIECVPGAFKNTAEAASDYLPPLPPDDTHLYTLRVYGLDVDHVD
                     LPKHFSLTDLNQKIIHHTVGEHELHFWYKPN"
     gene            490025..490693
                     /locus_tag="MGF_RS02030"
                     /old_locus_tag="MGF_2922"
     CDS             490025..490693
                     /locus_tag="MGF_RS02030"
                     /old_locus_tag="MGF_2922"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phospholipid-binding protein"
                     /protein_id="WP_014574565.1"
                     /db_xref="GI:504387463"
                     /translation="MKKYSIGNNSKIWSKMVGADGYLALHGGGHKNENQTPFPSFSLD
                     LSWEKIPNAKSYAVIVEDFDAAAVIGFSFIHWIAVNIKTNHIAENQSYLDHKKWLESK
                     QSAYGENLLWQGHNSSVNKTLVANNKTNKDLGGILPEAFTSTSLENSLMYFGCYPPNA
                     DHTYTVVVYGLDVDASELTYHKNHRTQKYHLNKPYYVGDFMQAIHKHVVDKHTLHFKY
                     KKVG"
     gene            complement(490783..493200)
                     /locus_tag="MGF_RS02035"
                     /old_locus_tag="MGF_2941"
     CDS             complement(490783..493200)
                     /locus_tag="MGF_RS02035"
                     /old_locus_tag="MGF_2941"
                     /EC_number="6.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="leucyl-tRNA synthetase"
                     /protein_id="WP_014574566.1"
                     /db_xref="GI:504387464"
                     /translation="MYNHNLIEKKWAKIWNDQKVYSFQIDKNKPKYYILDMFPYPSGK
                     GLHVGHVKAYMATDVISRWKNALGFNVLHPIGWDAFGLPAEQYAIQTNNHPAKFTQEN
                     INNFRTQLKRLGFNYDYRLEVDTTNKNYFKWTQWIFKKLYEHDLAYQADIEVNWCEQL
                     GTVLANEEVLTDENGNKISERGSYPVIKKKMRQWVLKITAFADQLIDGLENLNWPNSI
                     KAMQVNWINKSVGASIKFEIDQLDNQTIEVFSSRVDTLFGASFIALSFDHPLVKQKLI
                     TDKNDAIERFIKDNSIDQTVRYQGINTNYFAIHPITKKKIPIYLADYILSDYGTGAVM
                     GVPAHDDRDYQFAKQYDLEIIPVIKADQYPYLLDGEHINSDFNNGLNNEQAIQKTIAY
                     LKKHNLGDQKINYKLRDWIFSRQRYWGEPFPVLFDEEDNIYLLKDSELPLELPQLSDF
                     SPNKDGLPPLANADDQWLHPIIDQKKYRREINTMPQWAGSCWYYLAYLLKLTDLNQAD
                     GDQNYLALNSEKAKELFDHFMPVDLYVGGQEHAVLHLLYARFWYKFLHQIKIVSSTEP
                     FSKLINQGMILGEDNTKMSKSKGNIINPDDLVLSHGADTIRTYVMFMGPLNASLAWNS
                     NALNGTRKFLERVYNLFDRVEINDSINQNLNYDYHNFLKKINKHLENFEFNLVVSEMM
                     IFINACYKQTQINKEMITNFLIVLSFFAPYLAEELNSKLNNPTLLYKMRLAQWDEAYL
                     VKNTTTISCSINGKFKLVHEFDLDSDEQEVANYFLNQDLIKRNLEDKKLVKTIFVKNK
                     VINFIIK"
     gene            complement(493214..493885)
                     /locus_tag="MGF_RS02040"
                     /old_locus_tag="MGF_2943"
     CDS             complement(493214..493885)
                     /locus_tag="MGF_RS02040"
                     /old_locus_tag="MGF_2943"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="potassium transporter"
                     /protein_id="WP_011113682.1"
                     /db_xref="GI:499426218"
                     /translation="MKRADYCVIGIGRFGIKVASKLKELGCKVLILDKSKEKINLEAK
                     RFDFAIHLDATDIMSLADVAINNFDTVILSVSSIEESIIIATNLRELKVKNIIARAKN
                     DVHKRVLKTFGVKEAVIPEEIVGENVAMRVVHSINSEIISIDEDISLVRVYASSKDVV
                     NKKLIDVDVRNKTKANIISITREYKSIYPITADTVILKNDLITAACNNADISKFLKLM
                     SSDNS"
     gene            494044..495108
                     /locus_tag="MGF_RS02045"
                     /old_locus_tag="MGF_2944"
     CDS             494044..495108
                     /locus_tag="MGF_RS02045"
                     /old_locus_tag="MGF_2944"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574567.1"
                     /db_xref="GI:504387465"
                     /translation="MSIMFKRSANKKLRKNKIKRPVKVTLGLMGFLVVATTVPLANIP
                     LFGLYNNKKNNDKTRERIIKEKLFLAASKEKLLKDNPHAIIPNIVQDFHSPNQADGDK
                     NNEIVKTVYDNYPFKLVERLKSANIDPSDWVKFNEYIYKNMDRDLFLDLLNSFMSFYP
                     IYHQSWLSELTQRILLYRYQKIGITSGFFKQYHAEIDGAYYVDKNNFAFSSVTKADLI
                     AVHKLFGNVPTEVGITIRTAANSQLIIDPNTKGLVLTNASIFLESSAGALSPYTSIYV
                     KTNSPDTKNYYDYLGEEIPDQKAQEIPSFPITSILYSIINDKQLEKNDIKHYFYQWVI
                     PVLINFFNASYYEQQNVIKK"
     gene            495116..495811
                     /locus_tag="MGF_RS02050"
                     /old_locus_tag="MGF_2949"
     CDS             495116..495811
                     /locus_tag="MGF_RS02050"
                     /old_locus_tag="MGF_2949"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574568.1"
                     /db_xref="GI:504387466"
                     /translation="MVPQRLIPINNRLPKIWQDNKLAKIKKADHLNWQQFFYYSANKQ
                     AKHYLRQTIFNWFFIVPIFGFFYFILKSEKANEKLVYNKLKNQYLKSGGDNWLIFLIL
                     YLSVWLSFVIWVTLLIFLTDNFYPISDLNNQKRFISLFMVGNFGILLFFSYLYLIYWY
                     SFVYRKFKQVVFNTIRITRNQINPFSFFSFVLQCDDGVYLKELEKKQKKLKKKNVSNN
                     QRLLAARSKSYFS"
     gene            496430..496681
                     /locus_tag="MGF_RS02055"
                     /old_locus_tag="MGF_2955"
     CDS             496430..496681
                     /locus_tag="MGF_RS02055"
                     /old_locus_tag="MGF_2955"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594405.1"
                     /db_xref="GI:753838788"
                     /translation="MWCWQLLVVLHRSTQPEENNTPTYLVGYIGGRGPRTVNSAGKIT
                     TPWAIKENRTLTIYVNAPTQGEYYISGSYLTNINRELKF"
     gene            complement(496650..496928)
                     /locus_tag="MGF_RS02060"
     CDS             complement(496650..496928)
                     /locus_tag="MGF_RS02060"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594406.1"
                     /db_xref="GI:753838789"
                     /translation="MLALGVNVKLPIYGANPLSTLSFPPAITILFNPAFNLRVRVVPT
                     RVPSTSSVPVLAVSNVPNVVQLFFPLVVIVTELVESESVRILILYLYL"
     gene            497266..499338
                     /locus_tag="MGF_RS02065"
                     /old_locus_tag="MGF_2959"
     CDS             497266..499338
                     /locus_tag="MGF_RS02065"
                     /old_locus_tag="MGF_2959"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574571.1"
                     /db_xref="GI:504387469"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPTPNPEP
                     KPDPMPNPPSGGMMGDNPNPGNDGGMDNSAQQLSAAKTALTNLLNGQTEKVGLYNDYA
                     KIKDQLVKAYTAAKEISDKSDATLQEVNNAKTTLEIAITTAASSKTSFDEKNSELIKA
                     YNALKQTITSEEMQLNLLTGANFETIKNHISNLYKQGKDIITATLDPTTGDGPQTMVV
                     NQTNEAIVNATSKLDDWKNNASTLNTSFLKETLKSASLSAATGDGAATVQQQPGNYSF
                     VAYASDITSPNWNFAQRKVWVSTSGGRTSPFSNSDANNSPELTDVSWIYNLSGANSKY
                     TLKFNYYGPSTGHLYFPYKLVKSNDAQNVGLQYTLNNKPAQRIEFAPAQSTSPGETAP
                     ASSPQSPRAAATETDASGSAEGSQSQTDMNSSSMNKTPTVSDINVASVTLSDLNFGAN
                     TIEFSVPMGDSMVAPMIGNMYITSNPLNVNQIYDDIFGNSVSNSTDQNKAVTVDLLKG
                     YSLATNWSIYLARFTDLMEGTQTTPNPVYLVGYIGGSQGRNFTQGLQVQNNLRFPLAQ
                     NDKRTFTIYVNAPEAGEYYISGKYLTSQQRGLKLSADNINNSVTFTVQGKNNWTTLGS
                     FDTSKTNATDGNDATVSGNKMTLTLNKGLNKIILSGVNNGDTPFIGNLTFRLKSNEAS
                     SSSAESSK"
     gene            499669..501783
                     /locus_tag="MGF_RS02070"
                     /old_locus_tag="MGF_2969"
     CDS             499669..501783
                     /locus_tag="MGF_RS02070"
                     /old_locus_tag="MGF_2969"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574572.1"
                     /db_xref="GI:504387470"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPKPDSMP
                     NPGGGMNGGNTNRGNGGGMMGDNPNPGNTTPEQQLAAARKTLTDLLGTENTNVAFYAD
                     YAKIQSTLNAAYMTAKTASENTSASLENLRSASTTLQAAIDKAASDKRAFDSANQSLV
                     TAYNNLKTTLQFKTTSLEGLSENKYSGIKNHLSKLFDRGSAITAKTLDPTSGERPTLE
                     KVNEANNSIKMAISPESLKKWKDNADKFNEFEKNPLSKEKLSTGTDSAHNQEQPANWS
                     FAGYSVDLTTGSDSNSQNLPNWNFAQRKVWTSEGQQHGRTVLVSSPVSSTDVSWIYSL
                     AGEGTKYTLTFEYYGPDTAFLYFPYKLVKQADSSSVALQYSLNKTSSKLINFEPAETV
                     STNADESENEVATTSTTEARSSSENLVADEVATSNNEMNPTPTVSDINIAKVTLSGLT
                     FGENTIEFSVPTNKVAPMIGNMYLTSNSESQVKIYNEIFGNTSNSSDNSTSVTVDLLT
                     GYSLVSGWSTYIGEFKQLMDTQMGTSSDSQTRKPSYLVGFIGGPGRRQLVNNSNKIQS
                     PQTNSQQRTFTIYVNAPQDGDYYISGSYLTSDDRQLMFSSPTGDSTSSMNNVTLTIQG
                     KRNWTTLGAFNTQTNTNIVNPSNLSSGMQNAHTTLHLKKGLNKVVISGVSNGDTPYIG
                     NLTFTLNNNPSSNTESETRQST"
     gene            502116..504104
                     /locus_tag="MGF_RS02075"
                     /old_locus_tag="MGF_2981"
     CDS             502116..504104
                     /locus_tag="MGF_RS02075"
                     /old_locus_tag="MGF_2981"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574573.1"
                     /db_xref="GI:504387471"
                     /translation="MKRKNILKFVSLFGIGSFVMLAAASCTSPVNPTPNPTPELKPDP
                     MSNPPSGGMNGGDTNPGNSGVMDNAAQQLAAARTVLTSLLASKNANVEMYSDYAKIKN
                     DLTAAYTTAKSTSDNTSATLEQVKSATSTLQTAIDKAASDKKTFDDQNSDLVTAYKEL
                     KSNVNNKDNNLMGLDSTQYSAIRTNLEGYYTIGADVVKKTLVPVEGMSPTKDEVTNLN
                     TNINASVADLGSRKENADMYFNKFGKKVLVKSGVVAPKPMMADGVQTEHETPTDNSQP
                     VNYSFVGYSVDVNGSGSTPPAWDYVKRTVFNINGTLVDNQNGDANTAPLTDVSWIYSL
                     NNGSKYTVSFTYYGPTTAYLYFPYKLVQSSQSTTVGLNYSLNGTEAKSVEFTAPTTMN
                     PEGMDSPAGTTQTTPETTTPATPATTANLTPTVDTINVAKAILTNLKFGENTIDFTVP
                     AQKVAPMFGNFYITASEDNLDKVNDDIFGNKTTKSEESTSVTVDLLKGYNLAADYSTF
                     FAKYTGATLDGGNAGDYYLVGFIGSSNKRTYSGTGTQMNTPLNIGDKRNLIIYVNAPT
                     EGKYYVSGIYTTGSNRALRLWANNENNFMQFVNLNSGPGNTLKTFTTNMTDSRITNQT
                     ISLNKGLNKVVIRSTNGGKAPNLGNLTFTLMKPATPSA"
     gene            504383..506416
                     /locus_tag="MGF_RS02080"
                     /old_locus_tag="MGF_2992"
     CDS             504383..506416
                     /locus_tag="MGF_RS02080"
                     /old_locus_tag="MGF_2992"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574574.1"
                     /db_xref="GI:504387472"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPPSNGGGMM
                     GDNPNPRNTTPKQQLAAARKTLTDLLGTENTNVALYADYANIQSTLSTAYMTAKTASE
                     NTSATLENLRSASTTLQAAIDKAASDKRAFDSANQSLVAAYNNLKTTLQSKTNSLEGL
                     SENKYSGIKNHVSKLFDTGSAITARTLDPTSGERPTLEKVNEVNNGIKMAISSESLNK
                     WKTNADKFNDFEKNPLSKEKLESTNDTAHNQEQPANWSFAGYSVDITTGSASNSQNLP
                     NWNFAQRKVWTSEAARNNGSIDLVANPTVPTDVSWIYSLTGQGTKYTLEFTYYGPSTA
                     FLYFPYKLVKSADSSSVALQYNLNNTSPKLINFQPVRTEPANADSTTNETTTTGSSEN
                     RSSSETLVADEATSTNKEMNPTPTVDSINIAKVTLSNLNFGTNTIEFSVPTTAKEGTS
                     KVAPMIGNMYITSNDQNQRKIYNEIFGNTSNDSTSVTVDLLKGYSLASGWSTYVGEFK
                     RLTGANQTASDSQTSAPNYLVGFIAGHGQRTVDNVSNIIRNPSIEGQQRTLAIYINAP
                     VEGEYYISGSYLTNVARDLKFSTGETNNVLTITGLRQDNWQTLGKFDTSTMMTGITVT
                     QGSNNKTTLKLKSGLNKVVITGGTANNTDTPDIGNLTFKLMTTTSNSETNTPA"
     gene            complement(506663..506736)
                     /locus_tag="MGF_RS02085"
                     /old_locus_tag="MGF_tRNA25"
     tRNA            complement(506663..506736)
                     /locus_tag="MGF_RS02085"
                     /old_locus_tag="MGF_tRNA25"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(506702..506704),aa:Thr,seq:ggt)
     gene            507099..509510
                     /locus_tag="MGF_RS02090"
                     /old_locus_tag="MGF_3006"
     CDS             507099..509510
                     /locus_tag="MGF_RS02090"
                     /old_locus_tag="MGF_3006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574575.1"
                     /db_xref="GI:504387473"
                     /translation="MITSMKIKKIAKSILLGSLATLPLIGVSAGLMVNKTSTNTNYNL
                     TNQAVSLVEDSTNQDQPLKKWSNDLSKYKKIDNDQTLFLGKNYIRLNNTVVFDHEQRK
                     LVQQTTVGVYDSLNNELQAITLTNDYKHLYFVDDNDPTKGFVATDDLHNAIYYPIDLN
                     TGLIDQEHGWAITTQRPASNVAAYLSTQGDEQNDLVKNARIVSFSVDNNQLKAVVYNQ
                     NGSFVVQNIPATNKAFNNIQIVKSYSINGSLFTGINFYDVDNQLVGSQIINIKNGTYV
                     PGGASFDINRQINAMVYDADHNAIYVQYYFSNDNTTRMWYYSVSPIDQFGQIGTIPNE
                     NYFSDLIFIKGEGIVGVNKQKSNLTLYPFEKDRILTAPTFKDVASSYTNDFFKQNNDK
                     ITNLVFDQKDQTFSVFYNSNIYTDGLVKFSLADFKNKSDLYTDVVPIYVDEVKLIDEM
                     NTSAYQSSFASVYAKTQSQHDFDQFLVIPDFYKKLENQSKINQDNYWNLSYQADENLG
                     TINLQIKLLYEQKQLNLLDRNLFGFEQVNASDIKVNYNKNSPLLDKTPTEIKRLLDDS
                     RTVLETKQAIFDLYGFDPKYKQLPYDVQIKDSSVLGNITFIFKFLTIKDNSIQANFKK
                     DDLVTQASIVSPTVSNNFLTFDQNFKLSIERWFIPVVIIALVVLILIASALIYFLLIQ
                     RKYPRLLATIKQKLTAQAIDQPQEELAKTVSINDHILMSAKAEQVQVEKVNLLNRFKK
                     FRLKKTNQEVSFSVQELTNQNELKDQPTSPTTKKQATIDLFHQKMAKDELSWNPEIKL
                     TKQIQ"
     gene            509540..509839
                     /locus_tag="MGF_RS02095"
                     /old_locus_tag="MGF_3015"
     CDS             509540..509839
                     /locus_tag="MGF_RS02095"
                     /old_locus_tag="MGF_3015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_011113667.1"
                     /db_xref="GI:499426203"
                     /translation="MAKIKSLSAAEYLKEMADETNLKVQDIRLVVTSLQKVLAKELAT
                     TGEVRLFDIGKFKLVATKPRTGINPKTKQKIQIPAGKKIKLTVSKILTDAVDSHK"
     gene            509913..511814
                     /gene="gyrB"
                     /locus_tag="MGF_RS02100"
                     /old_locus_tag="MGF_3016"
     CDS             509913..511814
                     /gene="gyrB"
                     /locus_tag="MGF_RS02100"
                     /old_locus_tag="MGF_3016"
                     /EC_number="5.99.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q59526.2"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_014574576.1"
                     /db_xref="GI:504387474"
                     /translation="MVSNYNEKHIKVLKGLEPVRKRPGMYIGSTDTRGLHHLVWELFD
                     NAVDEALNGSANKIEVVHKKDGSIIVTDNGRGIPVGKNLATNLSTVDTVYTVLHAGGK
                     FDDQAYKVSGGLHGVGASVVNALSRKLIVNVHRDGGMYESIYQDGGKIIQPLKKMGSS
                     TKHGTIIQFWPDPTIFKNIQFNPYMIKERLHESSFLFKGLKIVFVDENNPELSQTFIA
                     KDGILEYLKYVNENKKTISKIIPFKGDYEKIVVDGCFQYTDNESELIISFANSVKTSE
                     GGSHENGFKQAMLETINDYSKKYKLINNKDKGFDWSDLKEGLSVVLSVQVPEKIIAYE
                     GQTKNKLFTQEVKVAVAKILTQQLFYFLEENQADAKQLIERFKLIKEAKEAAKKAKEN
                     TKKLKSAKSERVLYGKLTPAQQKNPLQNEIFLVEGDSAGGTAKSGRDKRFQAILPLRG
                     KVVNVEKSRLQDLLKNEEILSIISCLGCGIGNNFNIKNLKYHKIIIMTDADTDGAHIQ
                     VLLLTFFYRYMKELIEQGKVYIALAPLYKISAKNSNKSAFAWDDYQLDELRVKYGSYE
                     VQRYKGLGEMNSEQLWTTTMDPSKRQLIQVSIQNAVQAERKVSILMGDDASIRKNWIN
                     ENVDFSIEE"
     gene            511814..514204
                     /locus_tag="MGF_RS02105"
                     /old_locus_tag="MGF_3026"
     CDS             511814..514204
                     /locus_tag="MGF_RS02105"
                     /old_locus_tag="MGF_3026"
                     /EC_number="5.99.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_014574577.1"
                     /db_xref="GI:504387475"
                     /translation="MDKKKVFQKDLDDIMSLSFGRYAKYIIQERALPDIRDGLKPVQR
                     RVLYGMYNLGLYYNKSYRKSAATVGEVIGKFHPHGDSSIYEALVRMTQTWKNNIPLID
                     MQGNNGSIDGDNAAAMRYTEARLSHYGNLMLENINKETVNFVNNFDDSEVEPTILPSL
                     LPNLLVNGSTGIAAGYATNIPPFNLKELIDVIIHRIDSPNCKLESILKLMPGPDFPTG
                     GIILDDDGIKNAYLTGKGKIVIRAKIVNENDQLVVTDIPFETNKASIIRSIEEILEAN
                     KLPQLEEVRDESDRFGIRVVLQTNTKDEKVLATIKNYLYKYTQLQINYSFNNVVIDQK
                     KPIQMSIFNYLDSYLNHAYTILRNAISFDLKKDQKRLEVINGLIKATSIIDQIILIIK
                     KSKDKQDAINNLINKYQFSAIQAEAIVSLRLYRLTNTDILALKEEKKSLDTNIKQYQL
                     LLKDQNALNDHLKEILRSYKKLFNTKRRSTIGGNIEKLVINEASIIEKKELYLVSSVD
                     GLIKTIAYDQNKQLNPTSLKIKQDDYLSDLIKVSSLNKVAFITNYGNVVVINAHKIKQ
                     AKPREIGMDINELTTIKDNEKIVKLVELSDQNDRIVLVSKYGMIKQISVNDLVNIKST
                     KPTTCMSLKDDDELVCANLISDPNAELIIITKNAYALRFFINEVNLTGLKSMGVRAIK
                     LKTNDEVIGFDQIKNSIDQLVLVKNKQIKKLKASLIENQSRATQGKNLGLGKDKKPLV
                     NGYLLNTKEAALYGFNRDNELVNLELNQIMVGNLSSEYHDWKDEFKCFFLNKLNYE"
     gene            514197..515294
                     /locus_tag="MGF_RS02110"
                     /old_locus_tag="MGF_3044"
     CDS             514197..515294
                     /locus_tag="MGF_RS02110"
                     /old_locus_tag="MGF_3044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase"
                     /protein_id="WP_014574578.1"
                     /db_xref="GI:504387476"
                     /translation="MNKKCVGCGNYLSTDPNDLGYCLDINMFELCKRCFQFKHYKKID
                     QKLTVKKADIENYLNSLILDNYCVFYLVDPTNFIFDLEMIKRSMNANQFYLIFNKIDY
                     LAKKNNLSVIKSRLVDNFKDHGINFSPNQILFNSIYLTYDLRKIDRLMKKAYEKRKKA
                     IFLGQSNVGKSSLINKLLKLNNIDKKLALTTSPYLNTTLQINQIKRRDFCLLDTPGYL
                     DETNGFFDLVPRRIKRLVSYQWKNPVTYQITSNQIFYCEDFFKLKVYLKKDTTKTSIT
                     FYCPTALRIHRTSSKNEQSIDQKLTQIFSDLKAFSYLNNDQTNTYQITLNQDNLLVNG
                     VCLIKFNKGIDKVELYQKDKVHTYLLKTALI"
     gene            515302..516396
                     /locus_tag="MGF_RS02115"
                     /old_locus_tag="MGF_3048"
     CDS             515302..516396
                     /locus_tag="MGF_RS02115"
                     /old_locus_tag="MGF_3048"
                     /EC_number="2.7.7.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="WP_014574579.1"
                     /db_xref="GI:504387477"
                     /translation="MKKIIIFGGSFNPIHNGHVNIATKALEQIKADRIYFVPTYKSTF
                     KQAFNISDIHRKKMIQNIIKLNDRFHFNWYELNIQNEKSYLTVKYFKNKFANAQIYFL
                     IGSDNLEKFHLWDEAEMIAKDCQMLYYLRDNQFSDHENIKKFNFLKIDGDNYQISSTK
                     IRNGTQVIGCVSDKNLAYINEHGLYINDRLKHFLRSDERFEHCLRVGQLAKKLAQYNY
                     PNLAQKAYIAGCYHDLAKELDEKTMLSYRDQFDPKLFPDPYKKDLNYRVLHGYVGAWI
                     LEHQFGYDDRELINSIYYHTIINDDPTPLDKIVYLADKLEPDRVKQEINRYFKINKAK
                     ALAFKNIHQAFKLTHDEIRKYLQLSQKQES"
     gene            516350..517135
                     /locus_tag="MGF_RS02120"
                     /old_locus_tag="MGF_3053"
     CDS             516350..517135
                     /locus_tag="MGF_RS02120"
                     /old_locus_tag="MGF_3053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="5'-methylthioadenosine nucleosidase"
                     /protein_id="WP_014574580.1"
                     /db_xref="GI:504387478"
                     /translation="MKLGNIFNLVKNKNHKPIKRYVVVAAMSQEVEAIIKKYHYQKER
                     DSIFIYSSPELTDVDLAISGIGKANAASCIQNILDQNCYKQIINIGIAGSLNPKLKPA
                     QLVEVNKLIYGDVDVTYFNYQFGQIPKLPESYSLKSGEFTCVSTDSFISKFNYQEIVQ
                     KLNQPIDLFEMEACAIAQVCHLNNFKNLKVYKVVSDYVQLNELPNPLSDEFSEYVLDK
                     VDFRFKVFDKKTNQEYLVNREELVNHAYQTIFNWFEDKFDHKS"
     gene            517382..>517671
                     /locus_tag="MGF_RS02125"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            517738..>518602
                     /locus_tag="MGF_RS02130"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            519101..521698
                     /locus_tag="MGF_RS02135"
                     /old_locus_tag="MGF_3064"
     CDS             519101..521698
                     /locus_tag="MGF_RS02135"
                     /old_locus_tag="MGF_3064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574583.1"
                     /db_xref="GI:504387481"
                     /translation="MNKQFGSNNEQEDKFDLKTDQSNQINEQKENNHQADDYTFDYIQ
                     TNKSSSQSNLVNQQEEKNELLNKSAPIQKVETNLQELKADTPKVDDQKTSAPVEKNEI
                     KPQEQKVDSKLEAEPGAINLEDQKADAETQDQKAESKVEEQIEETQETKAFKEIPALD
                     EKTLLSIKKLLDQSNVALVPVPSAFNNYTSNTQQAADDKYHLNYANVTVDPINNFYQK
                     IVDSVNPLIDDYIKSLVNENHEPLKQQQVLITESENIEKNIKNLYKTQKILGRKVANV
                     FIIISFFLIFGLGLIPIFLKNKKIIKEFDSYRTIRQNELDQLWWASYSLSLQFASRLN
                     FNEMLKFITNKLNLGFSNYCSQDTYQFISHCMDNFLNLHSAFNFKYKNTEITDCVATY
                     KEWRMVTTSNAIQVPYIDFETYTTSNGQLATRRVTRYETLVGYHNEKTPFFDDKHFQI
                     LKTNFKPEFNFTTNLKTKSDKTKIKNFIMFENKEFSKKMRITNDKNEISAELLEFFTI
                     KSQEDYLKWAKELNHEFNITKNGRYLINDYIDSASELDSLTQPPKKTSKKDLENPLYD
                     YSSLDLNVAYHINKFSLKHLVSNKKQTVSELIEIFKQTTKYYLSDWAEQVTPFLLSPV
                     INREWYSSDHNYKIANSGTFDDHESTKVQPSYSYLLSKVYQNDLVYFNQNKASTKSWF
                     EINQLDLENHFLKYEITHKSYRAVKEIDYVVVVGVHVGAQTIPVPYTRYYPISEPKTV
                     YFLAKNRAKNNNFIISNKKWDGFFDLAQKANIPIINLDKIKLNPHTSIELQNPYQFLS
                     DPKNQAYLDLLEQIQNNCSNQIHVQANDDGYFIFVNSAKQEELEQENFVKSLAKLKNN
                     LLELRELEN"
     gene            521717..522391
                     /locus_tag="MGF_RS02140"
                     /old_locus_tag="MGF_3075"
     CDS             521717..522391
                     /locus_tag="MGF_RS02140"
                     /old_locus_tag="MGF_3075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574584.1"
                     /db_xref="GI:504387482"
                     /translation="MLVDPSKQTTEGFNPNVDNSTFSAQASSGDVALWWFLYCLSWLT
                     IIGGIILTVKWYQWGNMLRTKQTEINQAASGIDVNLVKRKDTLLKLLEQTKAYMKFEK
                     STLENITKLRSLPNGTTDVNKMNDAENIINSVSRDINLQFENYPNLKASSIVAELMSS
                     SQYIEAEISASRRLYNTKVTDFNQEIVSFPVSVKAKKMNCHSLPLFVASVEAKQDVKM
                     DSLSDL"
     gene            522606..523475
                     /locus_tag="MGF_RS02145"
                     /old_locus_tag="MGF_3081"
     CDS             522606..523475
                     /locus_tag="MGF_RS02145"
                     /old_locus_tag="MGF_3081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574585.1"
                     /db_xref="GI:504387483"
                     /translation="MMRSLNILTKTWDYGTAITEFGANFVLAFLIMFVFMIIRSKKIE
                     NKLVISSFFVFVVFISIISTWAWARVLMNSFPIVYLNPINVIFDAIVQMVNLQNSSTS
                     HLTDSLKGLGYILPMQLVGILSGFVCFYIFYILITKSKQTYIKAVAFNQILFKTDNQK
                     TVYFAFKDFIFILIYTAVIPMISLINPVASGLRRIDYLIVSMIVLFVIIYLSSFFEFY
                     TFDILLSFAFAIFSTFFLLIDQNSDKQTIKTELKNTWLHFLISLIITLVIAIVLAIIV
                     YQIFIQGQHRVTI"
     gene            523462..525702
                     /locus_tag="MGF_RS02150"
                     /old_locus_tag="MGF_3086"
     CDS             523462..525702
                     /locus_tag="MGF_RS02150"
                     /old_locus_tag="MGF_3086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574586.1"
                     /db_xref="GI:504387484"
                     /translation="MLRSKKSKIIWTLFKSFAVVISPIAFTTLASCYAPKDNSKPVQD
                     NKKEPKIGINLASFDKLNNATDLLEWKDPESKTSEMEIGNILKNKFIKNNLQLKVDQI
                     KQILADDYKVSQNDLANYSFDIKYNEVFYDRNNPDQLVVPTEILRKVQLPNLTSSNLY
                     QGHVYNLILAGFKPDNKYARFDEYKNKIKDFKAAHPIQKVDLDNLDLGDLLGYSQAKL
                     KSLKIEFKDFNNSDLYQGLSNQEKIDQANTYSSKKTFTPKYSAFVKSVKISDDLKKLH
                     FTIRIAYGFSSYQWNNDFNSYGEDLQFDQDINKELKLTEQDYQKIALANLNIQLADFS
                     SITNYDFANFNVDDFYPFSKNENLIKFKIIQAINPSVQNKNATFKVKTSSDLQQLNNL
                     DLEQIYGVKKHLNLFSDPQVDQSTKIYDLHTGLLGQEQLSKISSDLFTYLNNTNAIAG
                     GYGQIRGFYASNKTPAQLHLGEDILVNANTLLKSPVDADVVSVFDRKSDNIGAGIGTS
                     VILRIKAKDLSNMIDQGVYEDYFASSEYVYLGIIHLDGQKTQNQLNQILNNQGNVNRQ
                     LNWISKNQKDSYLDITLDNPLSLKANDAFAVVGESDQNGGWLPHAHIALMADSSLITD
                     PNGYVYPDRNNYLSPRNLDRINNPAKRLFFQVPGVAFGIGSTTYYKTDPNANEIMQEV
                     DGKQTKVLVNNDPFIDQNINIQSYETRGLLDPNLLFQFRNQDTYIAKLIDYFKESFPN
                     EPKLQE"
     gene            complement(525862..526857)
                     /locus_tag="MGF_RS02155"
                     /old_locus_tag="MGF_3095"
     CDS             complement(525862..526857)
                     /locus_tag="MGF_RS02155"
                     /old_locus_tag="MGF_3095"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease HIII"
                     /protein_id="WP_014574587.1"
                     /db_xref="GI:504387485"
                     /translation="MSNNTYSIKNLSNETIKRFVNQLKTYEIDNNIASIYKRFNYLDY
                     LIISVYKSNSILIQLTKLANSSHLDEFIDKYCFWTNNNQNKQVKKTTNNKKSKLTNNK
                     LNLSNVSLIGCDEVGVGEYLGPIVTCCALVSDDQIDQINRLGVKDSKLLTDDKIVNIA
                     NELRKFIKFQIFCFDPKKGALEFNQMYDQLKNINALKAYMHNAGLILFKQKYGINNMI
                     VLDQFVNEKKYYEHLNNYKVTPIIKIDVMEEKAESKYLSVAVASILARAYYLELCKKL
                     LDKINYQGDYKKMLGADNKTFELIKKHIKANPSYNWKKVFKVFFKPFQEFLESLK"
     gene            526926..527354
                     /locus_tag="MGF_RS02160"
                     /old_locus_tag="MGF_3096"
     CDS             526926..527354
                     /locus_tag="MGF_RS02160"
                     /old_locus_tag="MGF_3096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574588.1"
                     /db_xref="GI:504387486"
                     /translation="MAQNNKKIDLITARELEKISFKYNNEGEYDSQEVDKVLDCVIDS
                     LKFYENQVKRLDQYEQHVKKLQDEIERLKQINGDQRVQIKEMSDNGYDRVAFMNKTTQ
                     LEKSLMSLSAIASQVTRMENMVSRIFSEVDMIKKILSHQR"
     gene            527426..527761
                     /locus_tag="MGF_RS02165"
                     /old_locus_tag="MGF_3098"
     CDS             527426..527761
                     /locus_tag="MGF_RS02165"
                     /old_locus_tag="MGF_3098"
                     /EC_number="2.7.8.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="4'-phosphopantetheinyl transferase"
                     /protein_id="WP_011113651.1"
                     /db_xref="GI:499426187"
                     /translation="MIIGVGIDVVSIDRFQAKKSDEFIKKLLTEHEQNKYKTVIGESN
                     QNIFLAIRWSLKEAIFKALKTWDEFTQLEIRKIHGAYECSLNEKIKLHLSISHEGQRL
                     VAMAVAERI"
     gene            527761..528558
                     /locus_tag="MGF_RS02170"
                     /old_locus_tag="MGF_3101"
     CDS             527761..528558
                     /locus_tag="MGF_RS02170"
                     /old_locus_tag="MGF_3101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_011884474.1"
                     /db_xref="GI:500214308"
                     /translation="MPLFLRLLSFLIFPFVGIEFIFRYLIALIKASIYKNNESFYTKE
                     NRFKTVYILACRVIFFKGVKIEIKNADLIPKKPVLFIGNHKSNIDPFVMIWLANHLKD
                     ITELTFVAKAELKNKSIGKIMSLIDVIFIDRNSIKQTAKATLNEIELLKNTSVCVFAE
                     GTRVFSHQLGEFKPGAIKAAYKAFCPIVPFSLFNTQGRMETISDRDRAVQPGFQKART
                     NKIYIEFLKPLKPIDYSRSESTFIINIIRELIQQTYQKQLTEFNNQR"
     gene            528690..530462
                     /gene="scpA"
                     /locus_tag="MGF_RS02175"
                     /old_locus_tag="MGF_3104"
     CDS             528690..530462
                     /gene="scpA"
                     /locus_tag="MGF_RS02175"
                     /old_locus_tag="MGF_3104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574589.1"
                     /note="functions during chromosome segregation; may form a
                     condensin-like structure with SMC and ScpB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="RNA 3-phosphate cyclase"
                     /protein_id="WP_014574589.1"
                     /db_xref="GI:504387487"
                     /translation="MIKLIWCEDLNHGIAKNNQIPWRIDEELNHFHQTTTNHPIIMGY
                     NTYLAMNKILANQANIVISKKHQHELKNKNELFLYSDLKKALIDFSIVDLFIIGGKKT
                     IEQAIKYADQLVISKLNADYGCDLFVNLNYDDFSLVQTKEYDQFVVEYWERKPNTKKP
                     EDLIEELNINLNDDFLNLSFKHFSGPFDLLLHLIKDKKMDIMALDLFELTNQYFAYIN
                     KHMINLDLVSDYLYMACELLRIKSDLSIPNFEDETKIDLNNDDERDRIVKRIIEYKRY
                     SELLPSLQKMQLERFSLFAKEEDDWDVFKLTSNDLLEAPLPDYVNPKKLKKAMERVFE
                     KLRIKTITEHKIVIEELSIEDVKNEILSIIRKLLNNQYDRFIDLEKIFEQIDPKKLSL
                     RYFVTSFVCLLILVREQKIDLNQKNDDESISACLVDPTKIVNSQESIQEVIQRQQEDE
                     KALQESIKQIQEERKQSFFKQREEYLKKKYGEYYVSREQYQKLTPEEKINIRINQRKI
                     DEQEKLNKAKAQNLVDENNQIIDLKTKKPSAKQILYEADLIIKQLDDLINDQQEDYDS
                     QAKLEALHTGLIKLDDEQDLIKEE"
     gene            530472..531347
                     /locus_tag="MGF_RS02180"
                     /old_locus_tag="MGF_3119"
     CDS             530472..531347
                     /locus_tag="MGF_RS02180"
                     /old_locus_tag="MGF_3119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="S-(hydroxymethyl)glutathione dehydrogenase"
                     /protein_id="WP_014574590.1"
                     /db_xref="GI:504387488"
                     /translation="MKTKIKKITKKFNLKKNTEVKPLSTQELIEEQKEFSQAVDKLMT
                     KKQKPTFEDIGSSTVDFETSDNDKFYESVRDAIEKTSEIVDDLDQSELTKNSSEQKEL
                     SAKAIIQAALYVAGRNGMTLQELNKIIPKIHQDQLFKELEEMIYSYDQNLNFGLTIKN
                     YGGRYKILTKTAVKKDMQRYVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVD
                     SLSLVDNLLEKGLIVEVGRADTPGRPFLYNVSEKFFDLFGIESIDDLPQIKHFDPDSY
                     QEGNFFDSNRYDENE"
     gene            531561..531989
                     /locus_tag="MGF_RS02185"
                     /old_locus_tag="MGF_3128"
     CDS             531561..531989
                     /locus_tag="MGF_RS02185"
                     /old_locus_tag="MGF_3128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein MraZ"
                     /protein_id="WP_011884471.1"
                     /db_xref="GI:500214305"
                     /translation="MFIGNYQHNIDPKGRLSIPSKLRSLIQDSVVLSRGLDGCLELRT
                     NQEFENYANKFLSQSNNKQQNRNYKRLLFANSLTVEIDSANRILIPANFKKMANLNKE
                     VVIIGMGDHIELWDVNAYEQFNEANFDKFNELAESMDDDH"
     gene            531976..532917
                     /locus_tag="MGF_RS02190"
                     /old_locus_tag="MGF_3131"
     CDS             531976..532917
                     /locus_tag="MGF_RS02190"
                     /old_locus_tag="MGF_3131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011884469.1"
                     /db_xref="GI:500214303"
                     /translation="MMIINNQIHYPVLLKEVIENLITIKDGIYLDLTIGFGGHSYNII
                     KILDQKARLIGFDQDLQAIAHCKQLFSEFNNVSLINDNFVNLKKHLQLMQIDKIDGCL
                     IDLGVSSYQLDRADRGFSYHSLGRLDMRMDQNKEVDATKLIQNSTVSELVKIMKNYGE
                     IKDPYRVVVALKKAFEKKELNTLEVVELIKKHVNKAELYANKHPARRYFQALRIAVNN
                     ELEVLEKLLSYLPSYLNKGGKIAIITFHSLEEKIVKKVFRHLASTSSLNNLPINNELL
                     KKYHNHFNKGLSPTQSELETNRRSRSAKLFVLEKINN"
     gene            532921..534210
                     /locus_tag="MGF_RS02195"
                     /old_locus_tag="MGF_3136"
     CDS             532921..534210
                     /locus_tag="MGF_RS02195"
                     /old_locus_tag="MGF_3136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884467.1"
                     /db_xref="GI:500214301"
                     /translation="MYNLKQTYCTLNFSKQKIDLVLSTHNDQSMHLLRQVSIENNNLY
                     DNTKILNQRLLLEKIQNQIDQITQRHKLVIQKVILNFDTLINDLKSKQINSGAINYLN
                     AQQFDNEIKKFVLNHQKSRGNTEQLVNYQVYQTLDETTKKPVDELVADQNYYAVILIY
                     TTKSSLVKQISELLDQLNLTITNISTQELNYQTSQQLKDITDTLMVDILDDHTNIGVY
                     LNNRYIINKKINLGINQIKQNVVNKLNAKNRNEDLITIVDQYFNNNLLTLNEDSSYNL
                     LIKTNVQFLSYQYLSKQDLDSCIQKQLVQIIDYINKELELIKRDFKKTIKQIIVNTNR
                     NSAIANNLLNKESELVNDVEISKLYSPKLSCAKSSYMQAYWAIKKQYEVDSSINKIDN
                     YVITPHDYNYDHESDKKAMLLSINKELNNILAKISFK"
     gene            534210..535595
                     /locus_tag="MGF_RS02200"
                     /old_locus_tag="MGF_3144"
     CDS             534210..535595
                     /locus_tag="MGF_RS02200"
                     /old_locus_tag="MGF_3144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein FtsZ"
                     /protein_id="WP_011884466.1"
                     /db_xref="GI:500214300"
                     /translation="MFDQRDKKPEKSLEEMQEELIKLQKEMQAVLMKDRAANQIRLGY
                     FDDQEFLIEPQAQPEEERIEYFVSKYKKNYKIKVIGIGGAGNNIVEDILRQYPDLVSE
                     NLMFYQLNTDSKHLNLLARNRSKAIRYLIDSPYTDGHGAGGDVQKARLAISQYFDKEV
                     DEILNECDICIVIAGLGKGTGSAGSTYIINKAATKKIITLAYVVIPPNTEGSLSYEKA
                     TDALYDLLKDANAISQLRMDDINKNLNYLSVVERNQEISNNIGLSIKTIVNLINEQTI
                     YNLDYADLITFFQKKDQLAYEFLVKEIKLSSSQENLVAQKLLSDDWLDVNQLIVIYQL
                     SKQLPGKLYDELNAKIKASVNRNAHIVFGSKYVDGDDNIITILGKKTSSLIHANNTLV
                     YDPYNLISRPDQKIKNVMTDHYLWNQAKLLEQKLAAINQDQTQNTFKNTNRADGKIET
                     SSILNLLDQDE"
     gene            complement(536013..536567)
                     /locus_tag="MGF_RS02205"
                     /old_locus_tag="MGF_3158"
     CDS             complement(536013..536567)
                     /locus_tag="MGF_RS02205"
                     /old_locus_tag="MGF_3158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574591.1"
                     /db_xref="GI:504387489"
                     /translation="MSNNDSEILKNNNNNKQVSNNQPSQRAQNPRVNELKDFLNRYKR
                     RVHKPIIVFFILHIIAFLLLVITAALVSAGIVKAGSSGRGSGVAESFNRSVIAGISGG
                     SLSLVSFVLFGIISFAFVILFIMGAFYTANKKVDGLMGSMILFIIAIFFPFLGSILGL
                     ISSILAKKNIERQIAELEGNLSAL"
     gene            536943..538940
                     /locus_tag="MGF_RS02210"
                     /old_locus_tag="MGF_3163"
     CDS             536943..538940
                     /locus_tag="MGF_RS02210"
                     /old_locus_tag="MGF_3163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="bacitracin ABC transporter"
                     /protein_id="WP_014574592.1"
                     /db_xref="GI:504387490"
                     /translation="MRLIKQTENNDCGIAVIRMLYNHYFYHDLNDFLIKANTHISSSG
                     ININQFEDIASKHHLLCESYQASFDELLKLNEKYLVCLLKAEDYNHFVIVKKKNSSFV
                     VFDPGSNNVQIITYEKFQERFAGIIIKVSPDYLNYTKPDYDTKFSFTRIISFKYIFIF
                     LLIELLITVTSIGLTFLFKILINDVINTSVINNILVIIVTFILIKVINLTGSGLLSIW
                     QQQLIKNQYQYWWSQLLSTFSLPKTIKLIKDDIGKIYKYDDFLLNCLEFYIKKIAAFI
                     NNILIVVVAIILLYRIHIFFLFITLFQSFVSLVYLILNLFWFKGYKQKSRELQIKQQT
                     YLYEFHKTIINTQHQSFYQQWTKDVKEVFSDNLNLNKKINQSANFSNAIFELIKYFIT
                     CITLVSGIALILNLNTIDLATLIYVSTLQGLLISSIDGLIKFINESYEFRIAKTNIHN
                     ILLLQKEPQFLINYSKKIKSIQFKNVYLFFDAKPIFNDLNLMINEPVFLSARNASGKS
                     TLIKSIIKRQLLSSGEIFINEMNINKYSNQWLLNNVIYLSDQKSNVELSNEWLIQFLK
                     KNKRPELLDIVEYFKLFDADKYNLSSGQNQVLKLLHSYNSRNKLFLLDEVLNNIDEAI
                     KHQVFQIVIKQIIKNNLTIMIEHDHSFSKYFKKQINLHEYQ"
     gene            538876..539301
                     /locus_tag="MGF_RS02215"
                     /old_locus_tag="MGF_3171"
     CDS             538876..539301
                     /locus_tag="MGF_RS02215"
                     /old_locus_tag="MGF_3171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574593.1"
                     /db_xref="GI:504387491"
                     /translation="MNMIIALVNILKNRLTYMNTNKIINSTIISLFIVLLTFLAIVFL
                     VRINLYESYVFQKQDQKIQVNLTQDSQLAKFIQNNKAKYLIGYYKNDSSALKFMIDES
                     NENQAILLSNQAIDQNVGMISFYLGKSLLYHHLIKSINL"
     gene            539310..539804
                     /locus_tag="MGF_RS02220"
                     /old_locus_tag="MGF_3173"
     CDS             539310..539804
                     /locus_tag="MGF_RS02220"
                     /old_locus_tag="MGF_3173"
                     /EC_number="3.4.24.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NB85.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="16S rRNA maturation RNase YbeY"
                     /protein_id="WP_014574594.1"
                     /db_xref="GI:504387492"
                     /translation="MINHFDLKKVPPSIKEDFSEILKIINQCFSSHFKVKNDLLYELS
                     FVSEKQSLQLNSSLRNKEYVADVISVCLWENAEIITPLLGEIFICSKKIAKDAIKYDV
                     NFWYLLIRMIIHGLLHLLEFDHEQSDAYEYVTLTIQEQIVNKVIKTAKKKIWKNQELL
                     SLLG"
     gene            539768..540670
                     /locus_tag="MGF_RS02225"
                     /old_locus_tag="MGF_3176"
     CDS             539768..540670
                     /locus_tag="MGF_RS02225"
                     /old_locus_tag="MGF_3176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein Era"
                     /protein_id="WP_014574595.1"
                     /db_xref="GI:504387493"
                     /translation="MKKSGIVVITGLASVGKSTLINKIANSKVAIISKYDQTTRNVIA
                     HKIVHDKIDYLLLDTPGFHKSFNKLSLFLNSEIKQAYKHAHACILIVDSTKKPTDDFT
                     NLLKIMKSYEMNNLIVIYSKIDLIKNEDHINEAQQLINESFKVVKTIKANLLSDHLND
                     QIDEGLEQLLDENYQLPESELDENEKDNFEIKEIIREKILNNTFQEVPHSVAVIIEAK
                     KYDQEKKLFNIECAIVTERESQKKIIIGKQGSMIKKIGTQARNELLNIYDCKINLKLF
                     VKVEKEWRNDDYLIKSLGHKKWVL"
     gene            540658..541383
                     /locus_tag="MGF_RS02230"
                     /old_locus_tag="MGF_3182"
     CDS             540658..541383
                     /locus_tag="MGF_RS02230"
                     /old_locus_tag="MGF_3182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="recombinase"
                     /protein_id="WP_011884455.1"
                     /db_xref="GI:500214289"
                     /translation="MSSITKKGYIIDYFDHNENDQIIKILFDDNTLTSLISVGSKKIL
                     SKNGRYITLGSLHDFEFFQARSIERLSKLKKIHKIDTKDATISESLPMVIMHYYLNKK
                     SGGLENNFFNFYDDVISYVIKQRYSNETIIIYILLNIINLEGIAFQLLNCGICNSKQV
                     ITLSFKKMYGLCEKCAYEQHEFLYDKNFMRNIFWLIYKNDYEVSTLESRKYISLIKGL
                     ASAIYHNAGIYLEPVFSYLIKLK"
     gene            541391..542782
                     /locus_tag="MGF_RS02235"
                     /old_locus_tag="MGF_3185"
     CDS             541391..542782
                     /locus_tag="MGF_RS02235"
                     /old_locus_tag="MGF_3185"
                     /EC_number="6.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NB88.2"
                     /note="Catalyzes a two-step reaction, first charging a
                     glycine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="WP_011884454.1"
                     /db_xref="GI:500214288"
                     /translation="MELKQDQIVNFLKNYGFVYQSSEIYNGLANSWDYGPLGALLKNN
                     IKQLLLKHFVFSQPNMKLLDSSIILNPLVWQASGHLDNFSDPLVDCKECKSRYRADKL
                     IEELNDDSIKITENTDPSYLEQILVDKKVECKKCEAANWTKIRKFNLMFKTFQGVVED
                     SLNTIYLRPETAQGIFINFKNILRTQRMKLPFGVAQIGKAFRNEITPGNFIFRTREFE
                     QFEIEYFLEPELVKEKFDWYINQIEDFLINKLLINKELIKRHEIAKDELAHYSSRTID
                     FQFNFPHGWSELWGLAHRGNFDLTAHSNQSGKTLDYHNEIEKTKIIPDVIEPSLGIER
                     ILYAIVCAHYHVEQLADNDSREVLRLPISLSPYQLAILPLVNKLKDQAYQLYLELLKI
                     SDTNLRFDFDSAGSIGKRYRRYDAIGTKYCLTYDFDSLEKGIVTIRERDSMEQIKLPI
                     SELKQWIRNNLHE"
     gene            542775..544763
                     /locus_tag="MGF_RS02240"
                     /old_locus_tag="MGF_3193"
     CDS             542775..544763
                     /locus_tag="MGF_RS02240"
                     /old_locus_tag="MGF_3193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA primase"
                     /protein_id="WP_011884453.1"
                     /db_xref="GI:500214287"
                     /translation="MSNDLNQLAKYLRKKISVSSIISKYLDLEKKGSNYKSLCPFHDD
                     NTPSFSVNDTKQVWKCFSCNESGGVIEFVQKKENLNFVEAVKKIVELEGIDLAAIGYS
                     LNFNKQKAVDESDQEFYKLNQFLAWRAHSNLRLEFSTNPKLNEFLNKRGLINEELLNN
                     FQIGFHPKSYSLNKLVEDLKVFYQKHLNKTYDDQIILSNLRYIKYISEKNVCYFSNRV
                     IFPIKNSDGQVVGFSGRAIDENNEIKYLNTPETDYFIKGHNLYNYSSLELDENNSTIY
                     LCEGYMDVIALYQIGIKNAVAIMGTALTDQQIELIKAKLNQIKRIVLALDNDESGKKA
                     TITCIKLLTRKRVHNLYQLDYSDLKQKDLDEIYHSPDGENQLKELIKKQLSTQKEQEN
                     VEYDDEKQLSTQLYQELNELKPEQDDQVDITTLIDYNLDKRITEQLRNFIQAVIKICR
                     YYLISFKYLTYKDLSNVRLKILSKINLYKPTRYLFNTMLQITLTNQVMKSLTTNEQLE
                     AILFCYNFTKRFLEGFTDLIFRKVNDLYLLNAKQNTLNDRIYNKIKLKLFDDTVYLMK
                     KHIENRLNLDLFHKLKNELLSHIKYSKYAALAHDQFVNEEELNAYLKSCTSGIDGFKE
                     LYDLKTKEQLVQWLAKGEIFKLAQIKNLNILEELLKRK"
     gene            544805..546745
                     /locus_tag="MGF_RS02245"
                     /old_locus_tag="MGF_3203"
     CDS             544805..546745
                     /locus_tag="MGF_RS02245"
                     /old_locus_tag="MGF_3203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014574596.1"
                     /db_xref="GI:504387494"
                     /translation="MLFIPLTFTRMAKNTNSTPKNKTVSKAKNISQLSLKQRLELAKK
                     QEKTPANKLVNKKIETVSKTKKTAKPTKVEKPVSEKKLSVATKAKKAKSEKVVVEQPE
                     AKTTVKKVKAAPIKKEVVLKDKKAKAEPKSVAKEEKKSKLSLKSAKKSTKKKVTSKKD
                     ENLDLNNEIDFADFDSKDEEIDFSDFKHENYSSAFKETDFSEQDELDDKEFNLSDFFS
                     DSKLDIDQPITAQKRQRGRKPKHAPSNEKNDLVYHEVLEASSKTKNNDQESIRAIKTL
                     LAKAKATKSLSNEEIIDVFKNYEFTEAEDLEILQELKDNKIKLEDNVEEKISLFRKNQ
                     DLSEIDKNLDDLISKGASTKDKVEDNVKAFLGTLGSSKILNFGEEIQIAKLLGSTDPE
                     TREYAINQLVTSNLRLVTSIAKKYLNRGLDFVDLIQEGSIGLMKAISKFNYKLGNKFS
                     TYATWWIRQAITRAIADQARTVRIPVHMVETINKLIKTERMLTQQLGRDPTLEELTEA
                     MGGQVNGFTPKKVADIKKLNQEPVSLDKPIGHDEESQFVDFVKDRDILKPDEYTEKLI
                     VTEHINELFVNTLTKKEEQIIRMRYGLHPWHQQMTLEEVGQKFNVTRERIRQIESKAL
                     RKLKHPSKNARLRSFLKHDSEN"
     gene            546729..547409
                     /locus_tag="MGF_RS02250"
                     /old_locus_tag="MGF_3214"
     CDS             546729..547409
                     /locus_tag="MGF_RS02250"
                     /old_locus_tag="MGF_3214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014574597.1"
                     /db_xref="GI:504387495"
                     /translation="MTQKIKVISQMIDDAFLVADVGCDHGHLSIELIKQNKAQYVLNV
                     DVNLSPLKQAIVNSKKIIGKERIINILNDGLSNLSIKNPIDYCVIAGLGVSKINDIIN
                     NSVVELKQLIVQPEKNHIKMRYYLTKNNYQIVDEIIVFEKNNYYLIIKAIKTEDKEDL
                     TDTDYVIGPILKNQNSPELIGYIKQQKELIERIPVAARKKLQLIAITEYEHFLNNQWK
                     LEESLIES"
     gene            547376..548152
                     /locus_tag="MGF_RS02255"
                     /old_locus_tag="MGF_3217"
     CDS             547376..548152
                     /locus_tag="MGF_RS02255"
                     /old_locus_tag="MGF_3217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574598.1"
                     /db_xref="GI:504387496"
                     /translation="MKIRRITDWVLKQFPLRNQLSFDNAKLINHKNLTNQLTKVLVCA
                     DYDRFNFELAKKHNANLIISHHPMFINHQDLKSDTFIAKTYQDFYQNNRSFLVLHTAY
                     DFNPNGAHSYFFKLLKIKKFDLNPINHYYQFEIDCSLEQLISNLKKIEYIDQVQYLSK
                     TKFKKKLKKGLICLGSGYSSDQLDLELFKRYDLLITGDLKWSSWINAINHEINVIDIG
                     HHVESIFVDHIGELLVEKFHDQLDKKQLILGHSQFKIIKR"
     gene            548159..548887
                     /locus_tag="MGF_RS02260"
                     /old_locus_tag="MGF_3221"
     CDS             548159..548887
                     /locus_tag="MGF_RS02260"
                     /old_locus_tag="MGF_3221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_014574599.1"
                     /db_xref="GI:504387497"
                     /translation="MNVAGYISLLVILSLLIGYLFGSIMFADVASMILKRNVRELGSK
                     NPGTTNSFRVFHKKVAIAIGFFEIIKSVIPFSIILLIYKYGLQPELTKLDPSVINKTY
                     YLTYLAPLAAIFGHMYPVYFKFKGGKAVATTAGFVFVVSPWWFLIIALTWWTITLITK
                     YVSLASIVCFIIFLFLPYIPWLDYLWWFSLDKITFLTYQSDWYIIVFFAIANTILSTI
                     IIWKHRGNIVRLINKQENKITKKV"
     gene            548891..549190
                     /locus_tag="MGF_RS02265"
                     /old_locus_tag="MGF_3226"
     CDS             548891..549190
                     /locus_tag="MGF_RS02265"
                     /old_locus_tag="MGF_3226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884447.1"
                     /db_xref="GI:500214280"
                     /translation="MARRKQTVIGEILDLLDDLRLLIRRDGGDLSFEGYEKGIVTIRL
                     LGNCDGCSLVDMTYKDGVETILKAEIPEVKSVVLIQSKQANSNLLGISKSPIFGD"
     gene            complement(549241..551229)
                     /locus_tag="MGF_RS02270"
                     /old_locus_tag="MGF_3237"
     CDS             complement(549241..551229)
                     /locus_tag="MGF_RS02270"
                     /old_locus_tag="MGF_3237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574600.1"
                     /db_xref="GI:504387498"
                     /translation="MDFEKKILEKLNISTTYPFYIDNVNVKFFNSLQQHPNKYFVSKI
                     LPKIKTKLDQEELEKLKELDELTRKDRIKLMLNLALKKIVSKTGSSNSDFFKVLGYDQ
                     FHEPLYISEKEVSVNELIHNEYEERRYKYYIDVNKNSYLYQYASRINLWFYLNEENKI
                     LSGSFSFEVVNLEDNPLNEETVFEKIYLVSLIKYFIYKQISPLSLNNIIDIIDNDDFL
                     SNFDKKSNKEQQNNLSNNIYKKSLSYEVLKSNWDNLIIDKFLAHKNYDQEKQCQIKDD
                     LFYAIMNLTMINLALYQELKSYFNSEQPELILSILKKPTQIKSDPDQRPFNDFIELSK
                     HLKDSYIKKHTTKIDLNKIDDIDDFVNEAKKHQAVQDYEAFNTSINFLELQVKDEEVF
                     ASSSDYLLKHQQIYLIYSLIINPNRFGLNFNTTQIVKYNDLMKNLKNMQISEGSRKMI
                     VRDLNQSEVEINKNYLSFINQSNDFVIIKKDNKQLLDFYVWAIIYSESRKWIHHDIEY
                     DFNNDRVVKNSSFYRQKIEALENLKFDWYDDFYGIPAIKTIVKKIDQISSIKSSIDIL
                     VGTIKQKDALLKKDFERKTMVIAYVVALFIGFINFFGMIFTILAVTKPEDGLNTTNII
                     VITIASLLISSLIGIISFFLFKMARNNGYYKPKKSTQK"
     gene            complement(551310..553169)
                     /locus_tag="MGF_RS02275"
                     /old_locus_tag="MGF_3246"
     CDS             complement(551310..553169)
                     /locus_tag="MGF_RS02275"
                     /old_locus_tag="MGF_3246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574601.1"
                     /db_xref="GI:504387499"
                     /translation="MALINNKNKNSCNLDIKNIVNFNIQKITKSFFDSNLFSSSSQNI
                     SKKHYKTLKANNEEFFDVQSLLNEESIGDIINFSFKKINSIIGATNLNHFDVIRHDEY
                     GEAVYVNISTINSDFEIQAKKSQDLRFVFEVYVKDYSYLKQYCDKIQINILFDETNRI
                     ISGNFVFFKQAVEVDLEQLIKHVYRNYFVKNFIKEHFMNNSLKNQVRLFEDLTINKQD
                     KSIYLSSKFKTQFISTLDHVDEVNNLQIDREEFFYAVNILNFIILMIYEDLKAFFQSN
                     KPISFLDFIQRKTNLSNVRSNAHAELDFLNLFNYVNSKYFFNHELDLHQEEVENLEDA
                     LDLINEFYDLYQFEQRSLSDQILNFEISWSDQEWDDNNKIILLLMYPELFGLDSVDYV
                     NSKYDQLVESFINFQISDTVDYQKKHDAVLCELNPNYESFINANKDFLIMKSNFESFN
                     LFEIYNWALIYENLYEAKYINISNKFYKLKNSQPQIMRVLLNQLNQLKYYTAKKIYGL
                     GHIEVVIRKLLKYNDFENTINQFIKTINRDDQMYGKSKERKYLILGIISAFLFGIMDF
                     LTTIFSILPVTQDNIKVSIQKVPSLIVIGAGSLLASILLIILTVTYFKKRRQK"
     gene            553231..554241
                     /locus_tag="MGF_RS02280"
                     /old_locus_tag="MGF_3247"
     CDS             553231..554241
                     /locus_tag="MGF_RS02280"
                     /old_locus_tag="MGF_3247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycosyl transferase"
                     /protein_id="WP_014574602.1"
                     /db_xref="GI:504387500"
                     /translation="MLCYIINRIMSKLSIIYYLSQEVMNLKSSLNSLFSINNLKDHEL
                     IFINDDANESVIKIWQDELGKYSDLNYQIVNVSQSLGMSEAYNLGARIANGKFTLFTN
                     QLIIFKPNFLDELSLAIEDLDEDVDLINFLIDEPAFYNQKKQLSNNKDKKLLVYDQFN
                     IDLIAKHSLNFYDKVFKTKMLVDHKIKFNVTHYQPGIFILKVYGKAKKAAVLKTILTK
                     RRKEINLNNNIYDVLFQINQFNQLKTYNEWNDSYDEKLEFCAIIMAFYHFVSLVINSN
                     FSDKEKRNAIKIAKELVFRLYPKYEKNKFFQLINNQNWKNYFIKFKPRLSWIQAKFDA
                     DK"
     gene            554241..554960
                     /locus_tag="MGF_RS02285"
                     /old_locus_tag="MGF_3250"
     CDS             554241..554960
                     /locus_tag="MGF_RS02285"
                     /old_locus_tag="MGF_3250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574603.1"
                     /db_xref="GI:504387501"
                     /translation="MYVIFHNEITNTKVEYEVASATKRIFAGLLDLVFISLISMGINY
                     LINFLFQKYWTNYSVALYILLVGITSFLFYGGYFILVPWLTKGKTLFRLAFKLQLVER
                     TTLKKYLKHLFLHNLLIFLFFVLVLIIMGLSLFAFNDREQREIVSLFTKNNILDQPVK
                     YIIFISFFRGIYSIYAIILFVIFIFVAISSKRLALHDKMANLVMIDLKTKKDANQQVE
                     DKNKTNKIDINLPGNMDLTDL"
     gene            554963..557218
                     /locus_tag="MGF_RS02290"
                     /old_locus_tag="MGF_3254"
     CDS             554963..557218
                     /locus_tag="MGF_RS02290"
                     /old_locus_tag="MGF_3254"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA helicase II"
                     /protein_id="WP_014574604.1"
                     /db_xref="GI:504387502"
                     /translation="MQDYLKSLNKQQYDVVTSDLIPIFVVAGAGTGKTKVLTSRIAYL
                     IEHFKIPEYKILAITFTNKAAKEMQHRLEKLLDKEKTQVSFRTFHGFCAQVLREEVNN
                     VDRLNDRFNILDEVDQAKLIEDLLKSQKYEYYYSQYTDFKKNKVMSIINDAKTYNLDV
                     AEFLASDLNKLGEDHILTPNLVQPLSNFYHDYEKALKELNAIDFNDLLNIAYNLFLND
                     PIILKKWQNRYEAILVDEFQDANEIQYKIVKLLREKNNNFLFVGDPDQSIYGWRGANS
                     EIGDSIRFDFNDLVVKYLTQNYRSKQSILNLANDAIKMNNSRYFKSLLSHDLTDLGPK
                     PVWINFSNIEYQNRFVMDKIKELVASKQYTYGDFAILYRTNFSSVSLERLIKENRIPY
                     EIFGGYKFFLRKEIKDLIGYLKLVDTNDDIAFDRIINTPRRMIGDTSIEIIKELANKK
                     SITEFEALDYLDESNIKANVKKSAQNFKKMIEDLRANQGNWSVYQTINEIIKRINYYD
                     YLNEPTKHDSVNEFIDFLNKYEREYENGFGTKLTINDFIQNLALEGDLDNNQPNHNKN
                     ALKLMTIHSAKGLEFKNVFIINMNENILPSSRSIAASNNKAKLAEERRIVYVAYTRAK
                     HNLWLCSNQDYDARTKEPYQPSRFLYELSDLVLDKQDQAKTYFDKHNFLTDDDGWFDS
                     KKSSSKLDAWNSTNEVEHNYFVGEIIYHQLYGEGIVREIDDLTIKVSFKDKKAGTKDL
                     IKNHKLITYAK"
     gene            557208..557759
                     /locus_tag="MGF_RS02295"
                     /old_locus_tag="MGF_3264"
     CDS             557208..557759
                     /locus_tag="MGF_RS02295"
                     /old_locus_tag="MGF_3264"
                     /EC_number="6.3.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_014574605.1"
                     /db_xref="GI:504387503"
                     /translation="MQSKQIVRKQLIELAKQFASTSKKQVIDQQLTKLVYQFIKTKDY
                     QKIGVFSSLFYEYDTSELINLLLEDYQIYLPRVDNNKINFYQIKQLNFSFDLKYQIKQ
                     PLVNEQLLNNHLDLFIVPLVGYNSNQLRLGHGKGYYDRFFNNLKYSNYKISVAYDFML
                     NNQFQARDHDVKIDKIFCVTNLE"
     gene            557768..558622
                     /locus_tag="MGF_RS02300"
                     /old_locus_tag="MGF_3266"
     CDS             557768..558622
                     /locus_tag="MGF_RS02300"
                     /old_locus_tag="MGF_3266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574606.1"
                     /db_xref="GI:504387504"
                     /translation="MNILFLGDIFGNNGRKIIKKHLKNLIKQHHVDLVIANAENCTHG
                     KGLNQEHYDELMNYGIEFFTMGNHTWAKKEVFEILKDQKNIVRPLNLPESFQYADLGV
                     GTNVIKVKNKTIRITNLLGEGVKLNFKVTNPFYCLEDLVKMSNQDLHIVDFHAETTSE
                     KNALAIYFDGQVSAILGTHTHVPSADLRVSPKGMVYVTDVGMCGPGFGSIIGAKAQNV
                     LTKFLHPTARFKLEVSKLGAQFNAILMEFDDKTNKAVNAKRIQILEDDEINYLKEDFS
                     VPADFERN"
     gene            complement(558730..560016)
                     /locus_tag="MGF_RS02305"
                     /note="4-hydroxybutyrate CoA-transferase; disrupted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
     gene            complement(560049..560567)
                     /locus_tag="MGF_RS02310"
     CDS             complement(560049..560567)
                     /locus_tag="MGF_RS02310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011283673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molybdenum cofactor biosynthesis protein MoeC"
                     /protein_id="WP_041594407.1"
                     /db_xref="GI:753838790"
                     /translation="MRRYKKVGENRYRETTGLYYEDFNVGDVFEHRPGRTVLDVDNVW
                     FTLLTLNPQQVHFDQHYADKTEWKKLLVDSTFTLALVTEMSVNSISGKVVANLGWDKV
                     RLTNPVFAGDMIYAESIIPSKRESKSRPTQEIVAVLTRGINQDNKEVISFKRTVLVHK
                     RDNNTIQDKTNY"
     gene            complement(560879..561829)
                     /locus_tag="MGF_RS02315"
                     /old_locus_tag="MGF_3292"
     CDS             complement(560879..561829)
                     /locus_tag="MGF_RS02315"
                     /old_locus_tag="MGF_3292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014574608.1"
                     /db_xref="GI:504387506"
                     /translation="MHNDKILEVINLTKTFKRNQPPVINNLNFVVKKNQYHVFIGANG
                     AGKTTTIKTIIGAFKKTNGMILINGVDSNNPQARKALGYVPEVSRFANTLNTFEYLVW
                     MGRLSGLSKLAAQTKVKSKLEEFNMIKLAKTNPNKFSSGQKKKIILIQSLLNDPELLI
                     LDEPTANLDPKARIEFMDFIKQLQKQSQTSIFISSHVLTEVDQYADSITILDGGRAVF
                     SGDLNEINQSNNHYKKYILKVKDQKAVIKLLNKAGLNWIFKPDQQVFYLYSSEQTKID
                     HLLHDLILEKNQIIEFRKHQFSINEIYERYIKIGSVQTAR"
     gene            complement(561822..563771)
                     /locus_tag="MGF_RS02320"
                     /old_locus_tag="MGF_3304"
     CDS             complement(561822..563771)
                     /locus_tag="MGF_RS02320"
                     /old_locus_tag="MGF_3304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574609.1"
                     /db_xref="GI:504387507"
                     /translation="MKQPKQFWIYFAFLIKQIVKKPFVWATYSAYFIMLLVILLIFPL
                     YQETSPANYWNNPVIHVSTFLIPVASIFGIMVAMFLFKDGVADGTEIIIISKPVSRKI
                     YVSAKFLVLILTCLVFSFLLIITAAIAKINPQFQLQNMKDLMLGIFIGNFINSLFFGL
                     ISILISFGLSKNSTIVIVFLATFLMNFQTPLSALFFKSPSRVLSDSQHTLVERSLLTN
                     KQDRNHQPVGETVAFQPTPSDAKQNIKQLYEQAEASTFYNQSFYFNLGNALNSIYNLN
                     SLSYENSGNINFLSANTKIVFERVFDPDNFYNIDFFLPRPDEKGLLQLQRFKVFLSAP
                     TPEKSSTSFIRISNPPSYSYLNPDQDSYTVTTADFDLYEKNPDNDNILANTYQIFFNE
                     VFTSTKNSQQRSIASLLSSLFNQYLTEIIDQNNTNLNDLFIKISPDLVNLNDLLRSPN
                     LMYQFTKSFEQSDVKTNEEKAIEVYKKRVNLFYALNDTNSLIKLKRFMTYSNAILQND
                     IIFNRLRSDTIQNIIGNSFTNNLFLRFLLQNSLRNLNLPNLNLDDLKLIFYQQIFNEY
                     LALYLTQVVNLSQIIEQIEGKGKKQDYFVNLYPSAIRQDQLSDTYIISKQPIVNPWMI
                     VLILSTISIALLGLSSVLYYSKDYA"
     gene            complement(563839..566277)
                     /locus_tag="MGF_RS02325"
                     /old_locus_tag="MGF_3325"
     CDS             complement(563839..566277)
                     /locus_tag="MGF_RS02325"
                     /old_locus_tag="MGF_3325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase"
                     /protein_id="WP_014574610.1"
                     /db_xref="GI:504387508"
                     /translation="MATSKSVQKAPLLISRKMVVFPYNQYVLSIGRARSMKLIKKIKA
                     QLIEESKKTKSGEAKKEFEKILVVVQKNDNIDKPTVSDIYKYGTLCEITRINEEVDQE
                     TGELTYEVSIRGIERIKISTSSLKNVSLEDYIDPISYSICKTYLSIKPDELWDTIQKE
                     GVFDETDLKEMAKTDLTTRELDKISLSLAANANATFGSELLSEHNKQAILERDDIKER
                     FDLYFKIWRKIQSNIKANERNEDIKQVERMIELKMKKQLTKQQNEYYLREKLKTIKEE
                     LGDITNKEDDVESIRAKIKANPYPQHIKDRILTEINRYEATAPLSQEGNVIKTYLDWL
                     INLPWWQTKEDNFEIEKVTKTLDNNHYGLSKVKEKIIEYLALAMRSKNAKGPIMCLVG
                     PPGVGKSSLAKSIAEALNKEFVKISLGGVHDESEIRGHRRTYVGSMPGRIIKGMKKAG
                     VINPLFLLDEIDKMGQSVNHGDPTAALLEVLDPELNNKFNDNYIEEDYDLSNAMFVAT
                     ANYVEGIPEALYDRMEIIELTSYTEHEKLSIAKNYLIPRSLKEAELSDSEISFSDEAI
                     MYIIKHFTKEAGVRSLERVLKQIVRKFLVASLRDKKLKKQVINIPEVKHYLKKEVFDY
                     TQKDEFSIPGIVNGMAYTQYGGDLLPIEVSIAQGGKGNVVITGNLKETMKESVNVALG
                     YVKANAAEFGIDYEIFQKVDLHIHVPSGGIPKDGPSAGTALTTAIISAFTNKKVSPSV
                     AMTGEITLRGKVLPIGGVKEKTISAHRGGVRTIFLPEKNENHLDEVPKEILKDLEIIP
                     VKEYKEIYKKLFCK"
     gene            complement(566381..567712)
                     /locus_tag="MGF_RS02330"
                     /old_locus_tag="MGF_3333"
     CDS             complement(566381..567712)
                     /locus_tag="MGF_RS02330"
                     /old_locus_tag="MGF_3333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="trigger factor"
                     /protein_id="WP_014574611.1"
                     /db_xref="GI:504387509"
                     /translation="MFKIREKTNADHKVKYIIDVNEKNWNEAYQKKLNAAVKNVKIQG
                     FRKGHVPYQEAIKHIDQIGLFDRAVNQLVQPIYLELVKQEKIKDSETVLEENPEVSVV
                     EIDDKKLALSYSFETIPEVKVGDYLKINGFLSETPVKDEDVQTELVRIFKSAGKLVDK
                     KEGATLEKGDIAFLDFSGEIDNKAFEGGKAKNYELEIGSNSFIPGFEDQMVGMKVGEK
                     RDLNLTFPKDYHEKTYAGKPVLFKVKLNSIKEVQLPEMTVEKLNELMKTKYKNLDEAK
                     EDIKKRMDRSQQEHANQMNTMLLTQFANEDCQFSHIPKSLLDREVNLLYQQFANQMQQ
                     IKMSVEDALKIQNQTKEQLYQRLTEQATRAIKLVLVLEEIGDLEKISVSEAEINQEIE
                     ERIKEISNNQELPKEQYDAIKNYFVTQKELIESMLTNKKVVDLIIKKNLAR"
     gene            complement(567768..568640)
                     /locus_tag="MGF_RS02335"
                     /old_locus_tag="MGF_3337"
     CDS             complement(567768..568640)
                     /locus_tag="MGF_RS02335"
                     /old_locus_tag="MGF_3337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574612.1"
                     /db_xref="GI:504387510"
                     /translation="MWLVGIMKKRSNLIKTMMTKNKTFHTINEIINDLSNSELANDQN
                     TQFYLSLLKMIKTDLDNKDFKKALTSIQEELDTDYLPLALIDYFKQAHVVTKRLMYEN
                     EFDWLEKLDKKELINKTIINFPENLWYFDYLATKEENFWNIDDFEFFRHIFITKTYDN
                     SDKLVAAQLLQKIEPFINLSFEIYNNKLKQTFTVTLKKDDIWAKNTQAYFNDVLDQIE
                     SSFYKDPSKEQLATEIVNNIMQDYYPSYPDFVSVKELASGIIQYVKNCFDNKKPNTKI
                     NSIVYDVIINCIDQ"
     gene            complement(568546..569058)
                     /locus_tag="MGF_RS02340"
                     /old_locus_tag="MGF_3341"
     CDS             complement(568546..569058)
                     /locus_tag="MGF_RS02340"
                     /old_locus_tag="MGF_3341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic ion uptake regulation protein"
                     /protein_id="WP_014574613.1"
                     /db_xref="GI:504387511"
                     /translation="MKNHNQLDYYLKILNKNKYRITKPRRLILECLLDDFNYHSIEDI
                     IQHIYEKTKNKPNVSSVYNCLQTFIQLNLVDSFLNTSCDLKRYYTIKHEVHEHIYFIN
                     NQKELKQNLSTIIIPKTINDQLKAYFDQLGIINPQYYIVVSGDNEKTIKPHKNNDDKE
                     QDISYDQWDH"
     gene            complement(569045..569956)
                     /locus_tag="MGF_RS02345"
                     /old_locus_tag="MGF_3348"
     CDS             complement(569045..569956)
                     /locus_tag="MGF_RS02345"
                     /old_locus_tag="MGF_3348"
                     /EC_number="3.1.21.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="endonuclease IV"
                     /protein_id="WP_014574614.1"
                     /db_xref="GI:504387512"
                     /translation="MKSNKIKYLGCFVGATKPDFMLGMVKTVVDYGATSFMFYSGPPQ
                     SFRRTPTDQFKLDLAKAYLAKHNLGDLGDNYVVHAPYLINLANGDSTKRERSFNFFLD
                     ELKRTNELGAKYFVLHPGSALNVKDKTQALDHLATELNRAISMTKETIICLETMADKG
                     QQICSKFEELRYVIDQISDKSRIGVCFDTCHVHDAGYDLAKTQELIDHFDQVIGLKYL
                     YVIHLNDSKNPMGARKDRHANIGYGKIGFENLLNFIYHKEICNKIIILETPWIDDPIR
                     GEVPLYKEEIEMIRNKKFVEGLVNEES"
     gene            complement(570026..570322)
                     /locus_tag="MGF_RS02350"
                     /old_locus_tag="MGF_3350"
     CDS             complement(570026..570322)
                     /locus_tag="MGF_RS02350"
                     /old_locus_tag="MGF_3350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_014574615.1"
                     /db_xref="GI:504387513"
                     /translation="MKKIWFQLDLQFFASKKGVGSTKNGRDSNPKFLGAKLADGQQAK
                     TGQIIYRQRGNKIWPGKNVGQGKDDTLFALADGIVRYTKFLGNKTKVSVVEQSK"
     gene            complement(570324..570638)
                     /locus_tag="MGF_RS02355"
                     /old_locus_tag="MGF_3354"
     CDS             complement(570324..570638)
                     /locus_tag="MGF_RS02355"
                     /old_locus_tag="MGF_3354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574616.1"
                     /db_xref="GI:504387514"
                     /translation="MITITFYASAIKVSGHAFFAEYNQDIVCAGVSAIVFGGINYFSP
                     EAVKAIKDSQNSTIFFELLEVDSKNLIAIDLIKTQLSVIASVYDQHIKIIDETNRIVI
                     GK"
     gene            complement(570649..570951)
                     /locus_tag="MGF_RS02360"
                     /old_locus_tag="MGF_3357"
     CDS             complement(570649..570951)
                     /locus_tag="MGF_RS02360"
                     /old_locus_tag="MGF_3357"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBB2.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_014574617.1"
                     /db_xref="GI:504387515"
                     /translation="MFAVIASGSKQYRVKLNDEIYVEKLNSQVGEKIVFDKVYFVNNT
                     FGKPFVRGASVTCEVLKQGKQKKINVIKHISQKHHLKKYGHRQPYTKLKVVAINHG"
     gene            complement(571105..572907)
                     /locus_tag="MGF_RS02365"
                     /old_locus_tag="MGF_3364"
     CDS             complement(571105..572907)
                     /locus_tag="MGF_RS02365"
                     /old_locus_tag="MGF_3364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="multidrug ABC transporter permease"
                     /protein_id="WP_014574618.1"
                     /db_xref="GI:504387516"
                     /translation="MKFKPMARLKQLFLLLKNDKKVLALTMILTSFKSIFRIGSSLIF
                     GYVIQNIFVNITTLDPVVAQENWIRLLQFSAILAAIYFLLFLCYISSTVITIKLAYKT
                     TVKIRDIVFKKIHKIDLLTLEKMMNGEVINKIAVDVDLISANLSTFLGELFSTPIVTI
                     FVFVALFVVSPYLTLITIGLMLIMLLVQLIVIKKANAAQEKSLALYEKLATFIEEHVQ
                     QYELIKSLDITNVVNKEFKQLSDDYLKVNLRSTKLFSMIYPINFLFEDTVIVSAFIFS
                     LLFQSFNLSSGSPIQFLNQINLALITTFNLMLRFALGELGYLFKVSADIQITFVSIKR
                     IQSFLNLKQKFSYQHTPIEQLKYIKFDNVSFSYDNKHLALDNVSFQIDVNTSTAIVGQ
                     TGSGKSTIMNLLSRYYQPTSGEIYFNDHNYQKLDEYQFNQKISVVLQDSIMFSDTIYN
                     NIACVKPNATKEQVIQAANEAKIHNFISNLKDGYETMIDENQTNFSAGQIQQIALARA
                     FLSDADILIMDEATSSLDSKTEKLIQDAIFNLMDKKTVILIAHRLSTIINVDKILVMQ
                     KGKIIESGSHDELINKKGYYYQLNQANVDESSLM"
     gene            complement(572897..573460)
                     /locus_tag="MGF_RS02370"
     CDS             complement(572897..573460)
                     /locus_tag="MGF_RS02370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041594433.1"
                     /db_xref="GI:753838816"
                     /translation="MIMIDNVDINKYQTRHIRQSVAIDFQKKQLFSGTIKSNILKANP
                     DADQDRINQVLDHSCANEFINNLDDKLEHNLIEFGNNLSGGQKARICIARTLIRDSKI
                     MIFDDSLSALDNITAKKVLNKILANYQNRTKIFVSQQIRTIKDLDKIIVLDEGNVVGY
                     DTHKNLLTSCEVYKQIYDSQKRIGDEV"
     gene            complement(<573680..574615)
                     /locus_tag="MGF_RS02375"
     CDS             complement(<573680..574615)
                     /locus_tag="MGF_RS02375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574619.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041594434.1"
                     /db_xref="GI:753838817"
                     /translation="MIFIGIIASIVYVVVAGFVVLIIQNFVDLISGIKQPDWLVPDPN
                     DKLRATINLTALSLGLIIISFFIKVIGRIILLKQTLLAANLLKNQLYYKINLISLEQF
                     YQYQRSTLINRLNVDYFKLEKAAINVLVYMIENIFEVFVYIGFSIALTGYLSLIYLFF
                     IPLVIFLIIQGSKKTKDHYKKSYQSLDNLNQVIRENIIGAKVVRTFNLEDFQSLRYDN
                     HHKQWLKSVLRADLILAMMWQLIFLAINIFITLTLVTAGYLNKTNSSLTPGVVIAFLN
                     YLTYTSYVVIGICDYVLNILKTRSAKQRIKDILDLK"
     gene            575003..575407
                     /gene="ssrA"
                     /locus_tag="MGF_RS03955"
     tmRNA           575003..575407
                     /gene="ssrA"
                     /locus_tag="MGF_RS03955"
                     /product="transfer-messenger RNA/10Sa RNA"
                     /note="MGF_tmRMA; tmRNA; ssrA, 10Sa RNA; identified by
                     similarity to Mycoplasma gallisepticum tmRNA at
                     http://www.indiana.edu/;
                     tmrna/"
     gene            575631..576074
                     /locus_tag="MGF_RS02380"
                     /old_locus_tag="MGF_3373"
     CDS             575631..576074
                     /locus_tag="MGF_RS02380"
                     /old_locus_tag="MGF_3373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884412.1"
                     /db_xref="GI:500214245"
                     /translation="MNCLAVYSSKPLNYLTLTIAIFGSSAIVFTLTSISVLWKNIRTG
                     ERIIFSPTKLRLIARIYRSEQFDLAKDINITKKIKTIDYQKITDEHNYLWEIITLKDG
                     SKEYFPIRDNDKRIVSFRYKEYQKENRLKEKYLESIMINLDLIHR"
     gene            576274..576819
                     /locus_tag="MGF_RS02385"
                     /old_locus_tag="MGF_3378"
     CDS             576274..576819
                     /locus_tag="MGF_RS02385"
                     /old_locus_tag="MGF_3378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="PTS system mannitol-specific (MtlA)-like IIB
                     domain protein"
                     /protein_id="WP_014574620.1"
                     /db_xref="GI:504387518"
                     /translation="MRQIDLLKFKINRTKHSDAKRVKVPIEENEIKAVDYLQEQMEFY
                     KRTIKFVDSIKQKDLDKSTVEQLKTQLATQISAIRSTDPTDRKIREDNLTAETDEKII
                     QLTKVEVDGKWINKPYYKDQIDFVPITSTKETLKSINLKDDISSTSTNNELRTYVAKA
                     KKSNVCLWSWYGFICDGCWDD"
     gene            576785..577039
                     /locus_tag="MGF_RS02390"
                     /old_locus_tag="MGF_3381"
     CDS             576785..577039
                     /locus_tag="MGF_RS02390"
                     /old_locus_tag="MGF_3381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594408.1"
                     /db_xref="GI:753838791"
                     /translation="MGSSAMGAGMIKKMINNLGVKGVEVANCAIKDLPNDIDIIITQK
                     TFVDYVSKKYKNSYVYGVNQYLKKDEYKELIDTFKQERLA"
     gene            complement(577171..579585)
                     /locus_tag="MGF_RS02395"
                     /old_locus_tag="MGF_3399"
     CDS             complement(577171..579585)
                     /locus_tag="MGF_RS02395"
                     /old_locus_tag="MGF_3399"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_014574622.1"
                     /db_xref="GI:504387520"
                     /translation="MLLSKKVIANFIPMITKIEDKKIVEALNAIGAEVESIKTFSMID
                     YLIIGKIFTIKKHPHAEKLNICSIQISDNKFINVISDSPNLFDQTKVLNKYVIVAMEG
                     AELPNGITVINRDIRGMNSSGVLCSYADLNPQSSEYLSEYDSKNIIILDKANLGDTEV
                     YKYLNIDDTIFDISIPSSRPDWHGIRFLAKELAAYLNLKYVELIGRAKQTDFHQINFK
                     VLDETDNKAKYFGGIHLRNYQLQQSSWNTKGILINNHIKPINDLVDLSNLIPLFVANP
                     IHIHDADKIVGDVRLVQATKKEQFLALDNKWYTVQENDLLVVDDEKIIALAGIIGSMA
                     TAVDENSINYFIEVGNFDRHQIIKSAAFHKINTNSANLFSKEISLYQTKKTFEYLYQY
                     LLTKVYNQQLSELSKTFSVDEYHQQVKVNYDKIRSLLGSMNYLPDAKIQKSLTNLGFL
                     VKDDLVYVPSYRNDIYNWQDLVEELLKILNINLFQPIPIKADYLLEVNNETNELLDRL
                     SKKLRSLKFNHIRTYNLTSKKRAELLNLFKYQDPVVVSNPISETRQYYRQNILTNLLE
                     VYELNQSYKNKLYPIFEIQSLLTKNGANHHIGLVMANNLFNHSYDPSSGIKLDLITIK
                     GISDIIVQNFGFNCNYQTINDDTYLVKNDSLKLVVYDETIGYIGKIKKSVLKEFDLAD
                     QDIYCLDINLERLITSINRYVRTYEAYDHHQEVTRDITFQLKNEVDFNSFINVINSFN
                     KLSKWEIISIFDATNQIDTNKTYQPTKYTVRCYLKQGDKTYTTKEINQIFDELIDLMK
                     TKQILI"
     gene            complement(579595..580611)
                     /locus_tag="MGF_RS02400"
                     /old_locus_tag="MGF_3409"
     CDS             complement(579595..580611)
                     /locus_tag="MGF_RS02400"
                     /old_locus_tag="MGF_3409"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBB8.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="WP_014574623.1"
                     /db_xref="GI:504387521"
                     /translation="MDQIKKIIDDFKQTISSVDNQKELIVTKNIFVKKHVTPLFQQLR
                     ELEELAAKKAFGKELNFLQEAIQELFEEKNQQLVINLDQNQKPTYDLMIPALDLVDGS
                     IHPLNLVVNQIVDFFKKFNFTIVNYPELVTTKHCFDDLNIPLDHPGRSKTDTFYVSEK
                     QLLRTHCTAGTIEAIAAMNKHKDIRVISFGNVYRNDTDDATHSHQFMQMDFMWVNKDL
                     SLANLKWFVTKFIEHMFGNDLKTRFRLSHFPFTEPSFEVDVECWNCQSGCFLCKKTRW
                     IEIMGSGILHPKVLEAAHIDPEKMVGIAAGIGIERIAMLKNNITDIRDFYLNDFRFIK
                     QFYE"
     gene            complement(580659..581183)
                     /locus_tag="MGF_RS02405"
                     /old_locus_tag="MGF_3413"
     CDS             complement(580659..581183)
                     /locus_tag="MGF_RS02405"
                     /old_locus_tag="MGF_3413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dUTPase"
                     /protein_id="WP_014574624.1"
                     /db_xref="GI:504387522"
                     /translation="MLLDLEKLIEKQAELDTIIFKKTKSSYKKNQKQRRLWLAVEIGN
                     LAKQIEAYKFWKNGPKEDDHAILEACANVLHLSLSFLIQFKTEIDQDKKTELNFVFDV
                     KQQKQKPSSLIASKRFLELYELCLSMEDWWSCQKFIDELLTLISLMRLNFNDLFKEYI
                     KQSANILKRIDEDI"
     gene            complement(581189..581536)
                     /locus_tag="MGF_RS02410"
                     /old_locus_tag="MGF_3418"
     CDS             complement(581189..581536)
                     /locus_tag="MGF_RS02410"
                     /old_locus_tag="MGF_3418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_014574625.1"
                     /db_xref="GI:504387523"
                     /translation="MRVKGGPTTRRRRKKWLNQAEGTFGTRHASYKVAKQTVIKSAKY
                     AFRDRKNKKREFRALWIQRLNGALRELGVTYSVFINLLKKQQITINRKMLSEIAIQDH
                     EAFKKLVKEVTGK"
     gene            complement(581561..581755)
                     /locus_tag="MGF_RS02415"
                     /old_locus_tag="MGF_3420"
     CDS             complement(581561..581755)
                     /locus_tag="MGF_RS02415"
                     /old_locus_tag="MGF_3420"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBC1.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_011113604.1"
                     /db_xref="GI:499426140"
                     /translation="MPKMKTKSAAAKRFKTTKSGKIKRKQAYTSHLAPNKTTKQKRHL
                     RKDGLVHKTDFKRIKQLIAK"
     gene            complement(581765..582394)
                     /locus_tag="MGF_RS02420"
                     /old_locus_tag="MGF_3427"
     CDS             complement(581765..582394)
                     /locus_tag="MGF_RS02420"
                     /old_locus_tag="MGF_3427"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_014574626.1"
                     /db_xref="GI:504387524"
                     /translation="MFVWHFLFKKDYMNQDNNQRNKRPKPNLPPINKNIKFDSFTLID
                     ENGTNLGVVTKEAALAMSDSKGLDVVVISNNPSTVIAKLMDYGKHVYEQKRKKRDSKK
                     KQTVVKVKEINFKAGVGDHDIEWRAKKSIEWLNDGFHVKFTIRAFSRMITREELIKEV
                     YDKFYQFIQDYADVQKPYTKVSRNMYEAVFIPTKNKKKAELNQPTSQES"
     gene            582715..583080
                     /locus_tag="MGF_RS02425"
                     /old_locus_tag="MGF_3430"
     CDS             582715..583080
                     /locus_tag="MGF_RS02425"
                     /old_locus_tag="MGF_3430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="proline dipeptidase"
                     /protein_id="WP_011884397.1"
                     /db_xref="GI:500214230"
                     /translation="MVELYFKNSRFIGIAHQISSKQELKLLTEQLRKQYKKATHICYG
                     YLFKDNGIETAGFSDDNEPKNTAGKPIYDLLRIKRLYGYVVFVIRFFGGIKLGAGGLI
                     KAYRKTASATIDLISASTF"
     gene            complement(583046..584824)
                     /locus_tag="MGF_RS02430"
                     /old_locus_tag="MGF_3443"
     CDS             complement(583046..584824)
                     /locus_tag="MGF_RS02430"
                     /old_locus_tag="MGF_3443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="excinuclease ABC subunit C"
                     /protein_id="WP_041594409.1"
                     /db_xref="GI:753838792"
                     /translation="MNFNLKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQY
                     FNGPKDLKTSKLVNEIFDVEFIEVNNENEALLLEANLIKKHKPRYNILLKDNNGYPYI
                     LITKEKYPRLIYTRNFDPKKGKHYGPFASSEMKAYDLYNLLLKLFPLKNCFNKKGRKC
                     EFYDLNLCMKACTHEVSEADYEVMKKKIDYFFHNGADQVLKGLKEKELIASEKFDFEQ
                     AKKYLDLQKAINLIFDKQIINLYSAKERIDVLAYQIKENVICIVLFSYVSSQLVSKNT
                     ICDFYYGEEQEVITSYLSQYYKDNIKPKILYASLDQANATLLKDSLGIEIINPTSGKM
                     NEIMSLALQNVTNELSQKYDSLVKKEQRINLALDQLKKLIKVDKLNHLEVYDNSNLFN
                     TDKISAMIVFENNQFNKKKYRKYKIKDQQALGDYHYMYEVIYRRLYQALKNNFVDLPD
                     LIILDGGKHQVLAAKKAIVDLQIDQRINLIGLAKNNKHQTDKIVTSNLDEISLDKSSV
                     LYFFLANLQEEVHKFAISFFRKTKAKSLYDSILDQIKGLGKKRKQQLIEHFKTIDEIK
                     KASIASLSQVLPIEIAKKLKQKLDQS"
     gene            584847..585896
                     /locus_tag="MGF_RS02435"
                     /old_locus_tag="MGF_3442"
     CDS             584847..585896
                     /locus_tag="MGF_RS02435"
                     /old_locus_tag="MGF_3442"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBC5.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="HrcA family transcriptional regulator"
                     /protein_id="WP_041594410.1"
                     /db_xref="GI:753838793"
                     /translation="MNNKLTERQILILKAIINEYISTATAVGSKIILEKYFNNEVSSA
                     TIRNEMSVLEKEKYIEKPHTSAGRIPTIKGYQYYEANLAETKISEQLKRKLIAILNKR
                     HHSIDEVIEQSVEFINNITNLPSVITKFKSYDLLKRMDLIKINNNTALILIVSSSGEV
                     IKKTIKYQNSIQYNDVSTCVQIFNDRLVDTPFIELKEKLTAIKEIVRTKVHEYEFVMQ
                     RIVNYIFDINEKSTINIKGTKKLAIHPEFHDHNKLSEILNLLENTSIWEQISFMQQKT
                     GKSVITFGQDIGIEGISVASTLIETEQNKHQIAIVGPNRMEYGKIKGLLNILKEQVEK
                     IDHLNLPLEEINKES"
     gene            585896..587641
                     /locus_tag="MGF_RS02440"
                     /old_locus_tag="MGF_3454"
     CDS             585896..587641
                     /locus_tag="MGF_RS02440"
                     /old_locus_tag="MGF_3454"
                     /EC_number="2.2.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_014574629.1"
                     /db_xref="GI:504387527"
                     /translation="MKLLSTIKSYADFLKIKKADLKQLATEIRDYLINLGKEKSIHWS
                     SNLGIVELSIALAYFFNLDQDKVFYDTSHQAYVHKMVTGRFDQMRSIRETNGLSGLQD
                     LNESKYDYYAGGHTSNSLSVASGLVFSNQLLDKEQLIIPVIGDGSIANGIAFEAINNI
                     SFHHHKMIIILNDNQMSISENFGEFNKLLTNLKDDQTNFFKQLNYEYLKIEDGHDLDQ
                     IFAGLEKAKELVKQKPMIVHVKTIKGKGIEQAEADLIGTYHNSNRSNKTYQDQSGFIA
                     ASHLEAKLKEKKQFCMINPAMTYATGFIDLIKKYPKNYIDVGISEEHALSMASGVSLN
                     QVPVFLPIYSTFLQRSYDQLIHDLSRLNLGINLLIDRCGLNGTVGSSHHGIFDVGMIK
                     NTPHAKIYAASNQIVLKKLLDQVINNITQVIAIRYNRYFVELNQYESYYQDFDHIDQW
                     VKLNPSNAKNKVALISYNNNPILFKRLLDQQQLNDVDCFDAILVHGDQLDQMITKILD
                     QYDQIYLYEEIYQNLGLANEFYRLIVEKKYQNKSLYPYNFKTIPQHGDNKDLLIKHEM
                     GHEQVIEAIKKNLKK"
     gene            587919..588368
                     /locus_tag="MGF_RS02445"
                     /old_locus_tag="MGF_3468"
     CDS             587919..588368
                     /locus_tag="MGF_RS02445"
                     /old_locus_tag="MGF_3468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574630.1"
                     /db_xref="GI:504387528"
                     /translation="MNKIKFRVVPFSTKLRWLLIGKLPVERKARPKILEYIFFILNNI
                     ITLICSIVISYWLIKLYLDNNKELLIGTFIKSLQTSFLLKLLFTIIIINELINFVLVI
                     HTYYILTKTEFNKIYPIIGTITAILLISPLTIILFLIAYQKNELAFE"
     gene            588361..>588545
                     /locus_tag="MGF_RS02450"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            591048..591578
                     /locus_tag="MGF_RS02455"
                     /old_locus_tag="MGF_3484"
     CDS             591048..591578
                     /locus_tag="MGF_RS02455"
                     /old_locus_tag="MGF_3484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013302029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574632.1"
                     /db_xref="GI:504387530"
                     /translation="MKIPKYKANISKKAFYTYVVILSLLTFLLIIWITIPFTLGFKQS
                     YLDRLVQQSDQTDKEAVRNEIIRSGRLIVFLSYVGNEISLIVFLLYISLARHKVKVGY
                     LFYFTWIVIYITLIAMPFYAGVERHEQIAIALGGVISALSFSMVISLIVNLFHYHAQR
                     RLFKYEQYKMQVGRVN"
     gene            591581..594622
                     /locus_tag="MGF_RS02460"
                     /old_locus_tag="MGF_3486"
     CDS             591581..594622
                     /locus_tag="MGF_RS02460"
                     /old_locus_tag="MGF_3486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015286938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type maltose/maltodextrin transporter
                     permease MALC"
                     /protein_id="WP_014574633.1"
                     /db_xref="GI:504387531"
                     /translation="MEKLKLYNWYGESFELKLPEASTNLKAYKKQVENLFLRMKDEIK
                     TRHNIEKNLFLKARQKITDNLQRELESHKVAYKNKLKVFKDSIQKLAHVTSLQALLNY
                     ELRKLELKKKQNKKYVDDFINSLRNSADSLEDKLRNIEDLKNKTNRSEAYIAKIFCLY
                     STILTYIKRTNDRQFDLTKINDSLNSYEKTLLATLDDPAKYLSELYNKIEARRLRLFN
                     TRQELQRKHDQTLSLIKKLYEVERKNIILNASQRLIEIENEYNHKYEQATLEANQFKQ
                     NALAKVQAHKKQILEVENANKIKVQKIYDQAHLARKQIKQNKRAAYLDQQLSLKIKNY
                     KDFYHLINNYSGYSNQIPQINWDLLEQKDQKLALLELKKLTDDFINQTNNDFALLAHK
                     SFFGIKNHYELKKEAKALYKSQYNQLLAKTYKKYSYESDYKEEISSAYKQYTIDHSIT
                     RNKFLEEKLVAKYELLKINKRSEQEEEKRNFNQQLNQIKTKIKDQLIELKNKLRTKEI
                     SKKAFKNKLIELKVSKKEAIYELKLDSKILKNKETLKSLFIREFAEQKINKKIFESKT
                     NEAQKSIPIETSINVKRFSWLLAFFIPGASELLFFKQYVKGTIMFLYTIVNYALFLPF
                     ILGKYADKMKGILGVIDLGANDRGDARYYLFGGVLSVILISAMLIYFIISAISANRVA
                     KALYYGNRPSQWSHSKRWLSSSGFPWMISIFGWVLMLFVVVSPVITSVFLSFTNIGFN
                     HIPPNREVNWVGLEQWGRWWTLRNSNLLGSISNVLLWTFIWTFASTLIPIGLGILVAI
                     LTNNPRIKGRKIFRIIFILPWAIPAFVTVGFIRTMFAAGETGYINTILNYIFQMQPKS
                     WLNDITWTRVLLIIVQTWIGYAWIFMLVTSNLQSIPRDIYEAGSVDGAKPRHLFWYLT
                     LPQLLLSISPLLIALFVGSFNNFTTIFIFNNGGPAYAKPTPFGEGSTDIIVSWVFKLS
                     NPQGVQFPGNQAFGAALATLASMFSIGIALRGFIKSMNRRD"
     gene            594665..595672
                     /locus_tag="MGF_RS02465"
                     /old_locus_tag="MGF_3501"
     CDS             594665..595672
                     /locus_tag="MGF_RS02465"
                     /old_locus_tag="MGF_3501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_041594435.1"
                     /db_xref="GI:753838818"
                     /translation="MQIDPNSLTKKRLVFNELDAKPPTKTELVWLGFNYLLLIFWALI
                     ILFPVISLLVASFNVNNPRIATVTPFKFGLDNLFYLFRYRNVDQLTAETVSSLQAKNA
                     SIFSLFGVNYIYDDQTRSYFSDWYKNTLYIAGFTALIATIAVALNAYAYSRFKFAGSK
                     HSLTIIMLIQMIPATSSLIVLYIIVQLGTDLKVSPILMLVLIYSGGAIAGNTFMVKSY
                     LDTVSTELDDSAKIDGCTNWGLFFKILLPIIRPALIMVALWSFLIPFTDILLPSLVLP
                     NQQDKTLASGLQLFLSNQQDLQAGAYTMGTLLASLPAFILFMYLQKYIIGGLSEGAVK
                     G"
     gene            595678..596883
                     /locus_tag="MGF_RS02470"
                     /old_locus_tag="MGF_3505"
     CDS             595678..596883
                     /locus_tag="MGF_RS02470"
                     /old_locus_tag="MGF_3505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014574635.1"
                     /db_xref="GI:504387533"
                     /translation="MNDKQINHEQRDDDQDLGFETIDLDQLIGELGEESKAVSGAHIK
                     LVNVSKKYEGNEKYTLKDINLEIKPGSFCIFLGPSGCGKTTLLRMIAGLNSITKGDLL
                     FNNKRYNNLLPNERNIAMVFQSYALYPHMNVYNNISFGLKIAKERKDVIDRRVKDVAK
                     ILRIYDYLYRKPKDLSGGQRQRVAIGRAIARKPLVFLMDEPLSNLDAKLRESMRREIV
                     NIHRMLKTTSIYVTHDQLEAMTMGNQIVVFNDGYIQQSGTGRELYFKPANIFVAKFIG
                     SPTMNTFDGFYEDKKIYSTNRFIQLDLDESTQAKLVNNQQLVVGFRSEDIKISTTPTE
                     NSLKGTIMNIELIGKDQLVAVALNDGSIELIINAPNDLEFELYGEVYISFVLNRIHIF
                     DKKTEQRVN"
     gene            596886..597938
                     /locus_tag="MGF_RS02475"
                     /old_locus_tag="MGF_3514"
     CDS             596886..597938
                     /locus_tag="MGF_RS02475"
                     /old_locus_tag="MGF_3514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013302025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574636.1"
                     /db_xref="GI:504387534"
                     /translation="MEQNKTISQLKLKKVVRFGQYHSRKILSILAIVLIVACACLFIY
                     YINIFPGFVSKDQEFVATHLSVNKDTSLGTLRDNRFTYQGTMIFIDQATNNQIIQKLL
                     ANSAQENSISFGSFLNFSNEKKYYIINLQTIASGLINNDQNIISSYLTNPSNYTSTVI
                     QEIGNLLNGYNHAILQTVPTSAPLKRIFDGLSAFILVLYLIAMILQILVLNWLFKGTR
                     NGDHIYKYIITLSVIALIATFFLISLKPIQTEVVDGSTVQRVVTMISGVEVVNEVTIP
                     NVIKNPDQINYWGMWLTLALALMITIFSVQAKKRYGYLTHSVVLNKKLNDTKKLSDQI
                     ETIMDSSVEHLPIQKQ"
     gene            597990..>599802
                     /locus_tag="MGF_RS02480"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            599925..600611
                     /locus_tag="MGF_RS02485"
                     /old_locus_tag="MGF_3529"
     CDS             599925..600611
                     /locus_tag="MGF_RS02485"
                     /old_locus_tag="MGF_3529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014574639.1"
                     /db_xref="GI:504387537"
                     /translation="MQITKSDKKTQLIIEYLFDLIHSGKVPVNKIMPSEHQLMKKFSC
                     SRNIVIAAYQKLSALGAVYSIHKRGRFVAENFHNLIKPLSVLLNVEKIEGEEVLIKDK
                     NKRFQLPDWAIKKHIIFIDGFRCFKRRYYIDDKLMGESDIYLSLKNVSEVETIDPTVP
                     VVDLLIQRKALTNVVYELEFDDLKKFGVKSALVIKFFGYDNDSICVAGKYYIHPKCFK
                     FHHQEFSLFG"
     gene            600751..602784
                     /locus_tag="MGF_RS02490"
                     /old_locus_tag="MGF_3537"
     CDS             600751..602784
                     /locus_tag="MGF_RS02490"
                     /old_locus_tag="MGF_3537"
                     /EC_number="3.2.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="alpha-amylase"
                     /protein_id="WP_014574640.1"
                     /db_xref="GI:504387538"
                     /translation="MNSVGDIIKNYQEFDQQFANKKATLGLAYDHNKIKLSLWQPIAT
                     KVELMIFNQNEDELPAYLFEMHKDQHVWSVEIDQSFDQKYYQFKVTNQDGSSKVCLDP
                     YAYSLAKFNWQTNEHKVAKAAFVNINSPKAGEKPRDLANHNLNNTTDPLIYELHVRDF
                     TSLLDQKDFSARLGTFKAAQELDIFNYLSDLGITHLQLLPIHSTYTINEYDTKIYLKG
                     EANKWATNYNWGYDPHNYFSINGIYIDQINDPYQRIKEFKDFVDQAHKNKIGIILDVV
                     YNHMMTNDIFNNILDGYYYRNDAKVLPVNYPPLADNRVMVRKLIIDSLKYFVLYYNVD
                     GFRFDLSSFLTKDTIDEIHNELVKIKPNIILHGEAWKFSDLDYHNTYVKGVSTNTIKF
                     AYFNDTIRDAIKGSDHKNDPGLIVHNDQRLLSKYLVSIPGGIKDYKFDHKLKLKFDDR
                     DYDQFANDVGINLAYSHCHDGMTLWDKLNVSTKELSFDERIQRYRQGLILSTLTMGRQ
                     LLLAGSELLQSKPNDESGMDSEKTVISNYPDSFNEHPDGNKYHSNSYKTSDYVNGIKW
                     KHLENYQVFRDVYLFIKKLNKFRNTTKYFRYSTNQEVIDNLKFELIDLTKGVVVFKVY
                     DHNKHVVVIHNFSDLDYHYNFELNDLILSSRTKVVKDIINGHSSIVLGEYENN"
     gene            602771..604408
                     /locus_tag="MGF_RS02495"
                     /old_locus_tag="MGF_3555"
     CDS             602771..604408
                     /locus_tag="MGF_RS02495"
                     /old_locus_tag="MGF_3555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sucrase-isomaltase"
                     /protein_id="WP_041594411.1"
                     /db_xref="GI:753838794"
                     /translation="MKTIKLADKIIYQIFPRSFYDSNNDGDGDLVGITRKLAYLKKLG
                     INAIWLCPIYQTEFVDAGYDVLDYQSVWKQFGTLDQFKQLTKKANAMGIDIIMDIVLN
                     HVSNQHHWFKKACQSRDHVEYNYFIWRDQLSEQEKQINSIFGGSAWEYVDSVKAYYFH
                     LFAKEQVDLNWNHPETIKALAKVIDFWYSLGVKGFRLDAIKHVIKNFKEVEHNQYFAW
                     CEGSVKALKAFEELAFKDKPDAYTLGEASGIRADELLRYGDGKDKVADNYFNFSWWWI
                     GWSKKTGRNGYDPNWDLKEFVWQQKPFQENEKIRPEMFTNFLSNHDTSRSISRWGDEG
                     LLRIQSAKTQALLLMTLKGVPCIYYGEEIGLLNTHFSSRKEFVDIDIHNGFRELVDQK
                     KVYSESEMILYCNINSRDAGRSLMQWNARTNGGFNRGHKPWIKQGRNHKTINVNQALK
                     DRNSIFYFYQKLIDLRKNKLRDLLVLGSSSININEQNLITVRRTYQDQAITALINFSN
                     KELKINPIKGKQLLSTYEDNKVVKTTLRPFESVLIKE"
     gene            604412..606781
                     /locus_tag="MGF_RS02500"
                     /old_locus_tag="MGF_3567"
     CDS             604412..606781
                     /locus_tag="MGF_RS02500"
                     /old_locus_tag="MGF_3567"
                     /EC_number="2.4.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="maltose phosphorylase"
                     /protein_id="WP_014574642.1"
                     /db_xref="GI:504387540"
                     /translation="MRYLTYDPKNNTISQTRFSKQVVAKTESIFSLGNGYLGIRSADE
                     EYSSYNKEDFFVNGIFNRDNENDVPELANLADCLTMPIYINGELFELKKSDQYLKTLH
                     IKEGLLTREVISTVGRNQLSFKYERFVSQDDLNVYCQRLELKALKAPKKVQITIEAGI
                     NGQVTNSGTQHFAEGIKSRVNDNTLRMEQRTLGSKRLVVHNLISNLYLNNELIKPGSD
                     DYLIDIKRRKIFFKINLQLKTGDLLVLEKLMSVHTSVDGVDQLLTDQQVFDQADQKIK
                     KLSQTTYQELKQRSIKAMQTKVWNRFYINIEGDEQAAYDQLALNFGIFHLNNFVPNNK
                     PNLNIGAKGMSGEGYQGHTYWDTEFFINPIFLYNDLSVVKNLLTYRYKGIQGARDKAK
                     EQKERLEESNLEGAQYPWEMAWPTDGEVCPYWGQADITTGQQVPIASRRQEIHTSADI
                     AYAINQYYQFSDDEQFMNDMGYEMVIDTAWYYTNRAEKQADGSYSILDVMGPNEYKGN
                     IDNNAYINMMAKHNIDLALKYLNYLTKNKPTRLEAIYQKIPYQIDPTKMLDVSKKLKQ
                     QQPNKDLIISENDSFLSLPLNDISDFQMLGDAGKKLFSTAAGQKLLGSQLVKQADVVL
                     LLNILPHLYSKQIRAANFDYYQAITTHDSSLSAATYMIEATRLKKLDLAYQLFEYGIN
                     IDMGQNMHSSDAGIHAGSLAAIYQMILFGFGGLDWHNDELHLNPILPKHWKELTYRFQ
                     YKNSQFKVVIKQDHFLIKTINNSHAQELIISDQKHLIDSELKRFEIKYD"
     gene            606774..607439
                     /locus_tag="MGF_RS02505"
                     /old_locus_tag="MGF_3581"
     CDS             606774..607439
                     /locus_tag="MGF_RS02505"
                     /old_locus_tag="MGF_3581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="beta-phosphoglucomutase"
                     /protein_id="WP_041594412.1"
                     /db_xref="GI:753838795"
                     /translation="MIKGFIFDLDGVITDTAKLHYIAWKKIVAQLGINFLEEENEKLK
                     GLSRLDTLKAILRLKKPKNDLSQAELIKICEQKNDLYKKLLTTEIYQNSILKGIDQLI
                     IKAKANKIKLAVASSSHNAPLILEKLGLLDSFDYIVNPSEINQGKPAADIYLKAAEGL
                     DISTDQAIGFEDAISGLKAIKAAKMKAVVITNGSCEDFSKADLIYQSTSELNFDLIMR
                     HFQ"
     gene            complement(607490..609328)
                     /locus_tag="MGF_RS02510"
                     /old_locus_tag="MGF_3595"
     CDS             complement(607490..609328)
                     /locus_tag="MGF_RS02510"
                     /old_locus_tag="MGF_3595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574644.1"
                     /db_xref="GI:504387542"
                     /translation="MNKKRIILKTISLLGTTSFLSIGISSCMSITKKDANPNNSQTQL
                     QAARMELTDLINAKARTLASLQDYAKIEANLSSAYSEAETVNNNLNATLEQLNMAKTN
                     LESAINQANTNRTNFDNEHPNLVEAYKVLKTTLERSATNLEGLSSTAYNQIRNNLVDL
                     YNKASSLITKTLDPLNGGTLLDSNEITTANKNINNTLSTINEQKTNADALANSFIKEV
                     IQNNKQSFVGMFTKTNVQPSNYSFVAFSTDVTPVNYKYARRTVWDGDEPSSRILANTN
                     SITDVSWIYSLAGTNTKYQFSFSNYGPSTGYLYFPYKLVKAADANNVGLQYKLNNGNV
                     QPVEFATSTSANNTTANPTPAVDEIKVAKVTLSNLKFGSNTIEFSVTTDTEKVAPMIG
                     NIYLSSNENNADKIYNDIFGNTINQQNNATSVMVNMVEGYNLASSYSPAYKLINVSAG
                     GGQTQPYYVIGWLGAHDQNARTAMGTNMNVQRVPATTSTQGGYARYVSFYVNAPQAGS
                     YYISGNYNSLAARGLAVSTEKTFTTNVIKITHLQVINGTNRILTFDTKTKRGTDSTNG
                     NITLEANKDTITLTKGWNKVYVSGNNNDSVGIGNLTFTLMPPQTNS"
     gene            complement(<609500..609745)
                     /locus_tag="MGF_RS02515"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(<609899..610813)
                     /locus_tag="MGF_RS02520"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(610852..611490)
                     /locus_tag="MGF_RS02525"
                     /old_locus_tag="MGF_3612"
     CDS             complement(610852..611490)
                     /locus_tag="MGF_RS02525"
                     /old_locus_tag="MGF_3612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family domain protein"
                     /protein_id="WP_014574649.1"
                     /db_xref="GI:504387547"
                     /translation="MSLLISLSLASCTSIISRHLRNSSGTTPQEPIVDPNINNNQSEQ
                     LQATRNSLATLLNGQTNTLSSYNDYAKLKQNLMAAYSAATTVQNNENASLENLRDAVR
                     QLKNALNTANQTRTTFNNENGDLIQKYHDLETALNNRGMVLEGLENPNYQLIKTHLTG
                     LYDNAQTVVDNTLIPAEDVNKPVLQNLQILTQSLGDSTTQESLMMQKLALIS"
     gene            complement(611698..612759)
                     /locus_tag="MGF_RS02530"
                     /old_locus_tag="MGF_3621"
     CDS             complement(611698..612759)
                     /locus_tag="MGF_RS02530"
                     /old_locus_tag="MGF_3621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="co-chaperone GrpE"
                     /protein_id="WP_011113576.1"
                     /db_xref="GI:499426112"
                     /translation="MLNMNNQEHKNQNEEVQKEVKENPAQEEVSQPSDSSNPTSESAP
                     TLNAQDPNNINLANENIQIKSSLDDLKNFVQNPKSQNQKIKAVNQLMYNEFVKIETAI
                     NNINNYIENLTHRLELTNENFKTKVQEVESKAQQKINDRIEELDKRKKEEIENAKKYA
                     IEKSIDSAINIVDQLEIALEFASLDPAVKNYVSGFKMVLNSFVNWLASVNIHRMDIKP
                     GDKFDEKYMSASDKASDPDYPADHVCKVMKSGYKLYDRVVRHAMVAVSDGVGYVEPAS
                     SEQEQPQTPAKSTQTPPAQETASAPAKTKPTAPPTNNLNANKPPVVSNPPHQKPVQPP
                     QSNTPGPKQPITHQVIKKS"
     gene            complement(612776..616210)
                     /locus_tag="MGF_RS02535"
                     /old_locus_tag="MGF_3643"
     CDS             complement(612776..616210)
                     /locus_tag="MGF_RS02535"
                     /old_locus_tag="MGF_3643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014574650.1"
                     /db_xref="GI:504387548"
                     /translation="MIKSEDFMAEKRDYYEVLQIDRDAEEQEIKRAFRKLAKKYHPDT
                     NKDDANAESIFREINEAYEVLSNPEKKERYDKYGHDGLDREDDLDFDPNIFNSFFETI
                     NAADEFDDITFDGDWLDDDKPSKKKKKKNKKGGFWAKSKEASKTIETEPEIIDVGASA
                     NQANETRLFDDTLDDQLEESVSTQSTDDGEQLFDDNKEPSFTAGLDEEVQSEHQPEEE
                     QAEEDLSWTRFIGNPDYGHYDENNEWIWEGYFDDDDNFISTRELEQKVEPEQIQPQDD
                     SEDDYVIPDAEIISSPTLEVTAPKEVEQPLQPEQVAHVEQKEAEEESVAQTKAEEVSQ
                     PTQTVETKPTSAVELTSTFDLKQLLKVMQEQPTEEALTTTELTNETTSPTTEVSELEQ
                     TQDKSEDQQEEKAEKIDDAFVESNLPEIVDFSTKSSASLGTANLYDLSFLIKNQPTQA
                     VQPTSETISTTPVEPTDQLKPKEVDQIQEELKRAAEELVEDNLIDDSSMITPPSVIKT
                     KEIEVEELPTKKNDLVEINFDDLEELKFELVQTNQEKLPEKAVENWAQDYQLDEPTQS
                     NIDWYKQEDPKDLEQLVQDQATLEITEENQISERKVEEQPSVESTKVEDQVVQAIKEE
                     EELLEQKKAAEFAELFGEQTPTTKEDDDYLSIEELLNNEQTQPTEFNEIIIENNLDNV
                     SVADDQNYQLKDDNKEFINISEPTIVSSNLSFDQQLVNEIESDDLIKHQEENQEEYQT
                     VDYDPLQQPVRPMHTSDSEMYDFSIKLLRKQVGAKMEGNDSSNKNLANKINDLSDFKS
                     RLLKRLSETDPSSQPPASKYQEPNLIQIERLTEINVVKEVEVHQVLLFNNAIKRIKYT
                     RHTPCNNCSATGIDLTSSQPYKLCPACRNVEGNVESCMVCNQYGKLIRIPCKNCLGKS
                     YTNEAITLDIKLPITSQLNISVNYPGFGHIFPNNLKGDLTVVFKVIPSNFFVIKNNDI
                     HVKALVDPILASIGGIIKVPTINKLINVRIPPGTKVGDQVIIKDMGLDARYDLETKTY
                     YDKGSLIIQVVYADIMKSNDRSLGLEEAAKLPNVQVEHFNKLALREIKELKYNQQELQ
                     QEQQNWNFQSNDSNGFDSLNDQKAHQNLAFNRVLNTIKDIRTLDDIKKIREKANKK"
     gene            complement(616286..617074)
                     /locus_tag="MGF_RS02540"
                     /old_locus_tag="MGF_3650"
     CDS             complement(616286..617074)
                     /locus_tag="MGF_RS02540"
                     /old_locus_tag="MGF_3650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="esterase"
                     /protein_id="WP_014574651.1"
                     /db_xref="GI:504387549"
                     /translation="MVSLTNSFFAHELSKKKHKYNAIFVHGFSSSHDRHSDIFKRLND
                     QLVNYYTFDLPGHGQKQVDEQQELKLNYFADLVVDFIKQKQLDNLILIGHSMGGGICS
                     IVNYLIPQKIKALILEAPLNPAIFAFDKKRIFDSFKSFGGRSFLSELKSQDQFSDQIS
                     LVGWIKKIYKTNKDKIPLLLNLISLKSKNLLDNAYKALNNKPVLLIFGENDPVIPPTK
                     TIKYINQYTNFLTTRIIDEAAHSPHSINKELYYYFVKDFISKLN"
     gene            complement(617123..619330)
                     /locus_tag="MGF_RS02545"
                     /old_locus_tag="MGF_3667"
     CDS             complement(617123..619330)
                     /locus_tag="MGF_RS02545"
                     /old_locus_tag="MGF_3667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574652.1"
                     /db_xref="GI:504387550"
                     /translation="MKGIVAMDNKNNNKRNRFYFNQRLPHQRPKMSNLSEFDLDIIKE
                     LGLDDDESTKSKQKSSFDDDADFLDDVISDYDNWEKKKPQEAKKAVNDDQTVLSDHQD
                     EDDDEDDLNFEIHRSKYFSSNTDQTKDKPVNNDKTRFVGQDFGDQELIQAYTKNLSSY
                     INDHDDEQVIEPKTEPTKDNKPTQSFSSKPIDELTNEKTDIITKTAQEDDDEYLITKN
                     DSDYSFESTDQPLEEPQVDLTDLLDDDQLVQQDPTRDLPSTSEVMNAKFDEYDSSVKQ
                     IKSDLIDDQNNQFEKTSLPEELVTKKTINHDDQLEEITDQEIIDATTPVNFEQIQETS
                     IKVQANDLPELTSNLSELTRLAMKDVQEHYLSNIWKLDQYKKQLEERSKQLDELNESL
                     DRRQIDIELISNNIQESIKTHKQEMSLEKLNLQKEKEEIIAKANTQAEAIIKQAYEQA
                     NQYKELIEKKQSEEKNEVEKQQLTQLEEGFDHKIQQLSTKISHQLEARLVKKDQVLTQ
                     LLSQIKIMAETTHANQLRINELFLAVNNKDKEIVNLKRDIAILKASSDSLINIKTEQT
                     REIAKKHYQDFELDNSFKDPYLEHKLNSLTRDYINLSGEVIYEPELENEPLPTKKILK
                     TFSLSDLNQSLEEDKEILASINKHFERPIQITKTDKRINKEKVHKPSIIKRYQKPAVY
                     DDEIDDFNLTFIDQDFGDEYNSLIKKDLNQKRSSDPNKKLTTKKVQLVFDSDN"
     gene            complement(619464..621158)
                     /locus_tag="MGF_RS02550"
                     /old_locus_tag="MGF_3673"
     CDS             complement(619464..621158)
                     /locus_tag="MGF_RS02550"
                     /old_locus_tag="MGF_3673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574653.1"
                     /db_xref="GI:504387551"
                     /translation="MMSNTDKVFSFDESSKEQILQDFDNYKAEYCTSTFLAQHPQASE
                     YDLRDFLESAKRSYLRAKRNHMSDELWLEHLHKFIKSYKLVAPLQRELDKLILNKDFT
                     NLELEKAELAKQKAELEKERIAFLNEQNEFIQNGKSKHFDHIVTASEYEATKKELELK
                     YYKEIEAIKNKHQEELVKNQEETKKIFDEEINNIKDFYDRKLEKVSSYYNKLKEKLAE
                     LKEDNNKLISEIYERDLASENQLALRTKDYYEEIEKVRKILRNYEVLSFELKTKIKEK
                     DYLLNQLKNKLKHKDDEFKKFIKDQPEIVNQLINDGIKQGVKVKFNQLETKLKEQVKQ
                     YEDTVGRTYEKHKNEVDKILIANETKVEVMKNALIQAEETAKLTTNELERIKSEYDLV
                     IYTNRELNEAIKVEQERAKELAAKVEMLTAENNDLDKLNNLLVKKYNDNDHLLSVSKS
                     ISEQLDKINASQLSLQKVLQTSDDDKTNQKIIDLNKAIDQVNVTYKRSKALKNEPIEL
                     PKTTPTKGKIIEYIDEDEGLDSQWARQFSEATKRIKEKKLNKKKKALLDKEISEFK"
     gene            621218..622204
                     /locus_tag="MGF_RS02555"
                     /old_locus_tag="MGF_3674"
     CDS             621218..622204
                     /locus_tag="MGF_RS02555"
                     /old_locus_tag="MGF_3674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ferredoxin--NADP reductase"
                     /protein_id="WP_014574654.1"
                     /db_xref="GI:504387552"
                     /translation="MNIYDLIVLGAGTSGIYCASYGAMKGLSSLVIEMTDRIGGQPAH
                     VYPFKKIYDFPTANGILAKDFVDQLYQQQKPYINQGLITYLYNTTIQEQNYLDDQQLF
                     ELKLSDNQHVKAKKIILATGNGGFEPIKLKDELIQDQNLDCIHYKINDLTQYQNKDLC
                     FLGGGDSAVELINQLADLKIAKSLSIIHRNHKYRAAQALVDLINKKPINQYLDQTIEL
                     IKDNKISFKDNQSGESTQLNFDYLIVQYGLKPLKSLECFDHLEQDLNNNFVINHHHQT
                     SDPNIYAIGLASNFSKRPNLILSGMYEATVAIKHINDTMNPYLRATDYLLKE"
     gene            622244..>622915
                     /locus_tag="MGF_RS02560"
                     /note="arginine deiminase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            623018..623455
                     /locus_tag="MGF_RS02565"
     CDS             623018..623455
                     /locus_tag="MGF_RS02565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="arginine deiminase"
                     /protein_id="WP_041594413.1"
                     /db_xref="GI:753838796"
                     /translation="MSNLMHLDTWLTMLDYDKFLYSPNMMGVLKIWEIDLTHQTLIWR
                     ELNESLEGFLSMVIGKKATLIPVAGEDSTQIEIDVETNFDATNFLVIRPGVVVGYDRN
                     YKTNQALRDAGVKVISWNGDQLSLGMGSARCMSMPLYRDPIKK"
     gene            623793..624557
                     /locus_tag="MGF_RS02570"
                     /old_locus_tag="MGF_3687"
     CDS             623793..624557
                     /locus_tag="MGF_RS02570"
                     /old_locus_tag="MGF_3687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574655.1"
                     /db_xref="GI:504387553"
                     /translation="MQNKQKMSDLYKEYEHLLMNLSKTIFFGWAVTHYLKNPRLKDTG
                     LEEFYKSNALVVKGKMFKENYIDVRKEEHPAICGGVSEYLTKIKLARNLNVDLEELKF
                     FDDVKKQKYKNLSDEDLAFYLYEPDIIYRSGMGYTEEIKEHKNLIINKARILSDIALK
                     LIYSKFPTITSIDFHPAGHVLYKNKLVIKGDSDLLINNCLIDFKTKKDASISLEDRAQ
                     LFAYSINKYARDGEEYDKVYVLNPRYNYIVELVRND"
     gene            624914..625204
                     /locus_tag="MGF_RS02575"
                     /old_locus_tag="MGF_3695"
     CDS             624914..625204
                     /locus_tag="MGF_RS02575"
                     /old_locus_tag="MGF_3695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113568.1"
                     /db_xref="GI:499426104"
                     /translation="MKKLTTSDKNKVHGGFFANALATGTLISQMFLGSISKTAVSISN
                     IVNDIKNQPDSNGYFVEVTNQTQQRPVSSSFASSRARYSFLSPYASAIYAGF"
     gene            625214..625834
                     /locus_tag="MGF_RS02580"
                     /old_locus_tag="MGF_3698"
     CDS             625214..625834
                     /locus_tag="MGF_RS02580"
                     /old_locus_tag="MGF_3698"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574656.1"
                     /db_xref="GI:504387554"
                     /translation="MPKKASSTTNSKKTTTRRSTKTTSEELSGVIPLANEAKVDMKIT
                     TKKTRTRKVKTDPDLNSSTLKQTLGGIDDDLGFGLSNFAFAGGNVDDLKSVTAEIKSS
                     KKAKTKSPKLGTSLWKLGIAANVAGDSISSAIEDFYNIYKQNTTKPPLGYAEAVDNSI
                     FGQYRNRDGGFKYLNNWTNIYKNYNEPDTKIPTLELHNKYLKLFDH"
     gene            complement(625959..628883)
                     /locus_tag="MGF_RS02585"
                     /old_locus_tag="MGF_3721"
     CDS             complement(625959..628883)
                     /locus_tag="MGF_RS02585"
                     /old_locus_tag="MGF_3721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886639.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574657.1"
                     /db_xref="GI:504387555"
                     /translation="MARTKKNKSETKTTKKRGRKARIEQELEQPIQDYGPKLLNVKVQ
                     SELDQEDDLDFSHKSIVNDENEIFSGEIKTNRSQLKNKYFDTVLDEEDLLQREFDEIK
                     EKSKKRLISKKAKETDQTAQAIKQSINKRFDDFFDETEKSLITNTIYDGDYHENELAD
                     QDLIEKAHDFENASVLIDEIINSSLSQEEKKQEEVYDSLAEITNLNEAELTELENLDL
                     NKLDFDHNQEQKPTTDQHVYQAIAIDEATLKHEIYEPDVLLNIEQPIEINQELSIPIE
                     IKQDLDLDRIKSEEVVIDNALINAITSPIQVEVAEITDLAIEVEAQIPKISPEMIQEE
                     IIDIKVHDLTKDQVIKDKLKSSYQATSEVVDYAVDEKQTNDEIIKVNDTTDKLSVQSN
                     LNDENIRYEVQQEENTKPKEVHIDVDQLNIKLNKELKKLAKPKKPLDQLEEIPAVIKQ
                     DKYVKQEVENIPTNDYRIKKPLDQLQQIPAIIKQVNFAKQEVKKLSIKKPLDQLEEIP
                     AVIKQDKYVKQEVENIPTNDHRNFDSLKAPLDQLKKIPVVLNKVDLATPKAKLSQLAE
                     LASSTTDKVEKQQVNSVVDLTEVQKLVDQLEELVKQNQQLLEEKEPQTTQSNDQVDLL
                     ENLINEFDYELEQLEELNKNFNTKELDQNSKTTDIIVEDLATTEIEFKPDYQALTSEL
                     LDDTIHPIKHYDSGWKPQEIDVKYNYSEFDFNDYHKILDQQTEFKMFCKKAIDYSSAP
                     MIKMADEQSQNQDDLIELDYDETTNSTDQIELTDNVADIEVSDWETIENHPMIDFQSL
                     INKHSEQSKYYLEDKSSTTELVEQLDETDQTQETDFNFEGLDENITRLIIKQKENIKH
                     RLISQGEYNPENLAKELNQRLKEETRKIVVKNINNEYTNINEINKFKKPLVSVEIKPV
                     HPFATKSLKDRLIASQKIEAKTVSKKVATKSILNDLKGYQFKGANLIFKKSEPKKLTN
                     NK"
     gene            complement(628897..630123)
                     /locus_tag="MGF_RS02590"
                     /old_locus_tag="MGF_3728"
     CDS             complement(628897..630123)
                     /locus_tag="MGF_RS02590"
                     /old_locus_tag="MGF_3728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574658.1"
                     /db_xref="GI:504387556"
                     /translation="MQFIHSEQIKTWISQNLTTNYTRGFFVDVLFSVKKTKKVSVISG
                     LDYSGQTEIISEIYSRFQALDRLNDLYLVDLSSVYVHEETKIDDFLDKIQTIDNAFVI
                     INNMNQQEGTRIWFKQIAKLAKKQNITFYLFVNNSGILYDKIIEHYNFNHFYLKPFKF
                     SEYLITKEKFSNLDFVDYYEYLNSYSPILARFSDKSDAQILFFNQIVNLFRHDVYELF
                     SKKFSIKTCMALLNIVVYAKIPCFNLNYLSKELEIDFEELLEIIRILDKAKILKMIRV
                     IESDLSKKREPLYFLVFYHPINYVIFEHNEHSISEMMNNTKVLLSAFISATNFQDQIE
                     IVYDYHVSWTEQIALIDKHKKRGYILGINHHEVGPIFNALSWKYQYRVNYLNQNDLVN
                     LIANWELKNFKKYQIL"
     gene            complement(630133..633309)
                     /locus_tag="MGF_RS02595"
                     /old_locus_tag="MGF_3743"
     CDS             complement(630133..633309)
                     /locus_tag="MGF_RS02595"
                     /old_locus_tag="MGF_3743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence-associated protein"
                     /protein_id="WP_014574659.1"
                     /db_xref="GI:504387557"
                     /translation="MNNKDQFNSLLEANKPRINRPEIIKKDEKAAFNSKFKHSYKAPE
                     VNYRINYQVPYTSEDEAQDDAIIAILTKQLEDLKAELLSDLNDHQQTLAQQELLNDDS
                     MIIKEQLNFLANLYKSFYHNDFELTNLEQLVANNDLVELKKQSYALNKTWSKAQIVFE
                     EINKYSTVIANEISKVDLKPWSLTFNDQEFSSPNQLLTYLFDLKVEAKAKLVSLEQAI
                     DFINVQIDSLIKTINKEQVTKPRTETPTVQGLTKEDLDDLNLNLKFDLSSIDKNDLEL
                     LKAQLANDNHKITKTDLEQLREELRVDINKINQQDLINKQDLELLKQSVIKTQLELIE
                     VNQKQLNELRQEHQAQLELAKNSQQYIVDQLAAAIIKQEKILEEKINVLRQLRPINLT
                     EMTIPSTEVVVQPATEFKHVDQPKEEVKHLDQSQEKVEQLQPNVLVVSEQAVVDQPVI
                     LTKEIDQLNPLTQTNIKIKPQEKIIPQIIDQELISDEVILNQPINDLNNLLKDIQVEN
                     QKFDQIKKLIKDQTIELSDIDSSYVLQEPVSVDLPKQELIKEHTQPKTNLANLKSNNY
                     QQVVQLNTPTTFKGIKVDELKPEILSPNLIIDQRSVLLNDQLHDDKIYQLKQKYQEDK
                     KLLELRQEESNAQIQVLNAQIDLLRKQLVKNQELNQSEIIKKTSEFKDVLQTQKVAYE
                     SILNQYKQQYENELVNSKNELICLINEKIQAKTNEFLKSDDQESDFVQIRDTYLKVLN
                     EQQKEYDKQIKQKQSEIIAKLNEQKDQLDDIIRLKNLEWNQYQEILINKNNKALAELE
                     KQKQRYQTLSQADQSKVNLINEQIQQLKAEQVQNQSIIDQYNDSKEQLIDQINNTYNH
                     ESINLITDQITNKISEKFNEELARIKETTYNYYPDLTAYYDYYPSYEQFDEGYVDENG
                     MYYEPVDVELDPRVLDQFNYDYELYDQVDDQPVRVEYEPQQEEEQPMISNDDQDDFES
                     LNHYNTEDVVIINDKIKEQLANDQSLKIRKPGGWFAKKIYLSQIGEKEKIPQKMSGRR
                     GVFKRVNKGRLTKEEIKKYANKIINSNK"
     gene            complement(633312..639107)
                     /locus_tag="MGF_RS02600"
                     /old_locus_tag="MGF_3775"
     CDS             complement(633312..639107)
                     /locus_tag="MGF_RS02600"
                     /old_locus_tag="MGF_3775"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBF8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence-associated protein Hlp2"
                     /protein_id="WP_014574660.1"
                     /db_xref="GI:504387558"
                     /translation="MQKDYMKLHSNSDFDADQLDEHDDNVFQDVYDTGFDDGYIKANQ
                     ENLIANQYKKLDKNSYQNGNNSFYTKDELEKLKKQSFQVNQYIDYYQQAQTEISSERQ
                     RLLQAIDDLEANQDQFHPEDFQAERQYLINELDRLDSELYHIEQYKNDSIDFVNELNQ
                     RLSAEQAKIDSYNSSLDKNIRKDYIQIDQLKNKLAEETTEYNDLLNRSTDEISEIDRQ
                     SERLQNLIDERIAKLNNDSYGVSSLDSSTRERLKKEIHDLSEQRKKLQSAKKLHLYNL
                     NLKKESIRRYRSQLEQYLESLKQMRNEHNKKLKGYAQNLDNIKNEVEKAKQNFNDQQL
                     KILQSKANADQYFALRKIELENSYKKAKNAILEANKAHAKNVQEEQTLANKNNKTQRL
                     LNKLKENYDRLKIASLSFESMRKQSLAALNNLQDELKQKHNLLERKKHEQDGIVNEKI
                     SELEGYRSDLVDQKLKIEREKENQERRYKAAEASLNKKRQEIDELFLEANTKLNEASL
                     KENDLNNQKREILAKLRNLEHLKSEIDQRRRDLDQRELIDQQTIRKIQLDVESERADL
                     QRMLLIERKKNDERQQELLQYERDIKRQQTDFENTVNWEQKKLSQREKELKDGYDQLQ
                     LKQSEVQEKIDELNEEISRAQKSKQNSLVLEQKLKSDLEHLNLSKNYLDKQQEELNQK
                     SDKMIEDLKVFERDLKRQKEDLSIYEKSLQQKEASLINFQNDVTVQKNEAYHKAQAIH
                     QELELKKAAIENELRKLTTERKAVDADKEENTKLKKFIDEEIRSLANERKELEIYQNN
                     IENFKNNAVDRLNVLESDLVKKRNELEQLKKEQQTHYNELNSNLTNELQELEEQKKKF
                     AHQKQQKFEELLQAKNNLSIKENELVLYAQKVNDRYNELKAIEKSNTAKSEMINAKLE
                     EFKHAEIDYLNYQNKIKQEQIKFDNQVKILESQYNQRNEILLIREEQIKQKKAEQQAQ
                     EKQIQKDFKRLQEEKNNFDDQKRNKFNKISNLYLEIKKQRDEVDLAQRQIEDQKEELL
                     IKAREGRLQKQEIEDRLAVLEKSEKRFRQEDELLAKKRIDLIERIGVLKADINKKHEI
                     LSLRSVQLTEKAKKQQEKDADLQRKFDLLESEVERFNEEKKSEFQKLKVERDKLAHRE
                     KNVSKNMNEINLALAKLDLIRKNNKVDKAKINEKLALLNDQKEKIDRENDLLDAKKTE
                     VITRLRKMENDLEFEKQKVLLDRSNIERISSDQQALARELETKYQTLEREKRSFSQRK
                     ENELKEIDDFYQQVQHKERTLNLKIEDLKQLRYLLEKESYNVNVNKKDLKVRIEHYQR
                     LERAIKNEQHKLNNQKNNFFNKVELLNDQLNKKSSKIALLRSKIYNTYKQQQQQKQIL
                     LEEKHKNSQLRKSLLKTQEELHQQKAQFSIAKKQEEKKLKNQKDLIQNTLSEVIKQKD
                     QITNIKQEVDLKQTQLNNLEKLIIKQRADLQKELEKNSENTYRLQKAERLLEEKKTKL
                     RLEYDKAKKVLSTAKATDQALKTKQAKVQDQFKKLVLINKKIIEARNNLLKQRNIIQK
                     EINNRNMANFQNPYPNFLNLAPNTQVVPAQTIMPVQTPQLVGVNYPNQPAFDFNNPLM
                     QMQQLINQQQMLMMQKEHQWALEEANKKNSRLAKQLKQLKHHKQALTESTSEHLNYHN
                     LLNADNSYKINSLQNLLSKVAYNTKRRINQLEHNLDPETADLNQLHELNANSQLLDEI
                     RTVLSNTTTNTNAVVPANSYSKELRMLFDEIKADFKKQAVLFNTQKEVFTKQINQLAQ
                     AVEQGPIEVRKTLESQDQKYQQMFDNFRDAYEQNISLLRNENNEVQKKLTDLYDEIAA
                     IKTNTQKIKKTTLRPEVRNNANEGLASFNSVNRDKKDYLDQTLPVHQNLRIDLNQNRD
                     LSHAKKERINQLANEIKTIKELIEKRKQTSL"
     gene            complement(639121..641697)
                     /locus_tag="MGF_RS02605"
                     /old_locus_tag="MGF_3794"
     CDS             complement(639121..641697)
                     /locus_tag="MGF_RS02605"
                     /old_locus_tag="MGF_3794"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="fibronectin-binding protein"
                     /protein_id="WP_014574661.1"
                     /db_xref="GI:504387559"
                     /translation="MDNNQNNFNQPGQQGFDQYQQQSGALVSYGYDANGNPVSDPSLA
                     VYDANGMLINQNQYDQNQQQEYDQYGNPVGMLSGNVYSQENDPYYQQYNQQQNQGYEQ
                     QYDEYGNPIGLLPGSENQQNNQQQYDQYGNPIGMLPGGTNDQAYDPNQMQYDQYGNPV
                     GMLPGGNANDQGYDYNQMQYDEYGNPVGMLPGGNANDQGYDYNQMQYDEYGNQPALYD
                     NNQQDYYGYDQNQQYDQNQQYDKANNQLAVVDENYEQEQQVESNEEPAHEQDLREFLN
                     NNSGTELVSYYEEEEDEMKPRNKKKQRQAAQARGLLPELATVNQPDQTPITPHLEAPV
                     HYDENEELSTDDLSDDINLDQNQAVHHDVEDDVINIPIEDIESALLPKFEEIQRHNLE
                     EIQKVKLEAAENFKVLQRANEELKSSNNELKTTNQQLKTSNEALEDSNKRIESQLQAL
                     LDSINDIKSKNNQPSQEEVDSRSKLEQRLEELAYKLDQTKEIIDETSESSRESFQKSK
                     DQLIENFEKKIELLTEKLNQTQESFNQSQEAKQQQDKEFAQKIERIIEQTKEANDSLQ
                     NRVKESSLDMESKLENKFESFADKLTEITSKKISEKMTEQQASKKEEIDSLQSSFQKA
                     LSEVVSKVENYANQSQLQSQHLNQTLSYHQQQINNSLRQSAQMAQMAQMQHMMPQQML
                     MGMNNPYGFNHHPMMPPVHQYQQLPPPPPVQAPAQQLLPTINNPLQLPNENPTLFEKL
                     MLANMFKQTINPPQPQALPQPHPQPQQLPPQILALPPTVVQQPNYLVPQPPRQPDYYS
                     NRLNERMMLDDAYNAGYDEAVYELENQYYPPAYEYPEYEEIQPSFRRRGGRAKFDPYN
                     NR"
     gene            complement(641853..642365)
                     /locus_tag="MGF_RS02610"
                     /old_locus_tag="MGF_3800"
     CDS             complement(641853..642365)
                     /locus_tag="MGF_RS02610"
                     /old_locus_tag="MGF_3800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="flavodoxin"
                     /protein_id="WP_011113561.1"
                     /db_xref="GI:499426097"
                     /translation="MKKIVIVYGTNLGTTELIAKKIEAEIKYPTTLIDVTKTNVDFIN
                     EFDVIIFGTSTWGTGDILDVWLEFDFKRLEVENKTFLLFGCGDCQTYPYTFCDGMGRL
                     FEILNRKKATIIGATEIKEYEYDFEESRALYKNKVVGLMIDQDSQPEKTDFRIKKWTT
                     WINEKLSTIL"
     gene            complement(642366..645059)
                     /locus_tag="MGF_RS02615"
                     /old_locus_tag="MGF_3813"
     CDS             complement(642366..645059)
                     /locus_tag="MGF_RS02615"
                     /old_locus_tag="MGF_3813"
                     /EC_number="6.1.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBG0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="isoleucyl-tRNA synthetase"
                     /protein_id="WP_014574662.1"
                     /db_xref="GI:504387560"
                     /translation="MNKNYKDTLLMPSTDFEMKANLATKESKIQQKWLDDRIYQLRLE
                     KNQNNEQKILHDGPPYANGDIHVGHTMNKILKDVIVRRWLMQGYYSPFILGWDTHGLP
                     IEHAVQSKLGQKEFFKLSVLERIEVCRDFAFNQVQKQKEQFSSLGLVTDFKVCYHTYD
                     KQYEIDQLKVFAKMINEGLVYQDYKPIYWSWSSKSVLSDAEIEYKETKSPSIYVTFKT
                     LDNKVIGKDVNLVIWTTTPWTLPSNLAISVHPKLEYTLFEVNGQKYLVGSNLYEQLIA
                     KFNFENPKVIQKLKGSSLDKIKYQHCLYDQITGIVVLGEHVSDSDGTGLVHTAPGFGL
                     EDFIVCKKYGIDAYVPINDEGCFDQTVHDPELVGVFYDDANKLIAQKLEARNCLLSLN
                     FINHQAAHDWRSKKPVIYRATKQWFINIKSIKDQLVENINTVKYPNERYAKRMLSMVA
                     ERSDWCISRQRTWGLPIPIIFDENHEPILDKELIDNTLRIMEAEGIKAWYEHDAKYFL
                     TNKYDPRKTYYKESDILDVWFDSGTSFNVLKENGIKDKATIYFEGSDQYRGWFNSSMI
                     CATVLNKTAPYEELISHGFTLDEKGMKMSKSQGNVISPLTIIKNKGADILRLWAASID
                     YSNDHRIGNHIIEQNSEIYRKIRNSLFRYILGNLNDFDFKPLDQYQLSLADLLTINHV
                     NKSFKKIDQAYLNYDYLEITKEVNQMVVELSAWYFELIKDSLYCNDENDPTRKAIQAT
                     LNYIFINSLFRIAPILVHTAEEAYSHYQATNKEKSVYLIDPPALFEIKTDLDLDQLAT
                     EFSKLKDDVYAEIEKLRKDKVLAKSNEAVVYLSKQYLDINKHLVKQLKTWLNVAEVHF
                     TKNDQITVEKTDFSKCLRCWNYFKELSKNNNEVCQRCSELV"
     gene            645147..645638
                     /locus_tag="MGF_RS02620"
                     /old_locus_tag="MGF_3814"
     CDS             645147..645638
                     /locus_tag="MGF_RS02620"
                     /old_locus_tag="MGF_3814"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="rRNA methyltransferase"
                     /protein_id="WP_014574663.1"
                     /db_xref="GI:504387561"
                     /translation="MSSKINVVLYQPQDPRNAGNIARSCVGFNATLHLIHPFGFFITD
                     ERFKRAGLDYWDHLNLKQYADFDDFIKQNQIDDNLFLFTKKANNYLSNINFKEYLDHD
                     QRIYLVFGQETNGLPEQLLNKYQNNLVKIPMHNAIRSFNLANSVICALYELSRQNQFK
                     NVK"
     gene            645644..646285
                     /locus_tag="MGF_RS02625"
                     /old_locus_tag="MGF_3817"
     CDS             645644..646285
                     /locus_tag="MGF_RS02625"
                     /old_locus_tag="MGF_3817"
                     /EC_number="2.1.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="WP_014574664.1"
                     /db_xref="GI:504387562"
                     /translation="MRIRNIKDAHLKINKAKNIIGVDDLKTKLDPKKFNALEIGSGKG
                     GFIYQKALTNPGINYFGIEKNATVILKMINKSERLEQLTNLFIIHGDFALIDHEFPNA
                     CFDQIYLNFSDPWPKKRHAKKRLVDLVFLNKYQRILKADGIIEFKTDNDQLFNYAIEM
                     INSLEQIKIIAYTNDLHSLDSSDALLKGNIITEYEQRFINLKKNINKIVFKFI"
     gene            complement(646287..648953)
                     /locus_tag="MGF_RS02630"
                     /old_locus_tag="MGF_3832"
     CDS             complement(646287..648953)
                     /locus_tag="MGF_RS02630"
                     /old_locus_tag="MGF_3832"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574665.1"
                     /db_xref="GI:504387563"
                     /translation="MGMKLFKKVLFGASLFGLGIGSIMSGLYFYQRENALDKLSSSEY
                     ASNEVISEQENLNGYDPNNPDAFLRENIAFNNHNFSDEKQAASHYLAVENNFVERKLF
                     IGDQFQKDPMTGEIISPDGLKPITDPSFANNNYKPAYLLNDNKYTSVQSEAAIQRIKA
                     SERYVKSANGLIYSQSEANNIPNGQAPTTQNQASVDEQLSRFFKDIYYYQFEDVTGNA
                     PRTVDINPLNLIDILKVKNLSVDSLNLKDSPFDLKLYELNNNKSQYAKVDNTALYSKQ
                     TISDISTKIYGIITDFLARGLYINVKGTINDNKKPFKIWYGIPYLSISATPSIEYRLP
                     EYLTSDTENINKYQSFSNLESFIDSIQAYTDPNTFRRVFSTLTPVYTAFSKVIANNYA
                     VNYDQASPQGLFGGYQNNLIRAIVHGDGNGIGWSGNVLGNNNVGIYSRPAAKFVNMTI
                     SLNVSQNGIQNYRVPTQLVNQLKEKLSAVIPSSSTQKDELIDQLVKAAQSVLTKKIFN
                     GFDINSNTSRADIKTYMSSVILNQLNLELTSALTQSGQTINLNAQNALQGLVNNQFSL
                     NDTLNSKDKIFVIQYNNQPLFGVNILSDENLKSLFLDKYNAEPTSSAIEILAESLKNY
                     KRQFPNRINSLLVNVSNSISYNPTSKEVTLKPLNDANLFVKYSSQNFNLNNLYQELGL
                     RQQNRNIRILNDPADNSNANLDPNGIVGPISTTLFSSSDNVNIKHLVNVYDVLLAWNK
                     DGSIKPTRLAMIFNQTVNPSISSANLIKYRSQIKPEIANVAQKSKDILVLRNWLGDII
                     FEGTYDKDKWPSDDEIKNVTASVASLMRINPSTRFLYSNNRLTQVNNLHLIYEIRLKN
                     TTKLFDNYQDAFNYIWRVIKVSATKINNQRTN"
     gene            649118..649194
                     /locus_tag="MGF_RS02635"
                     /old_locus_tag="MGF_tRNA26"
     tRNA            649118..649194
                     /locus_tag="MGF_RS02635"
                     /old_locus_tag="MGF_tRNA26"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:649152..649154,aa:His,seq:gtg)
     gene            complement(649322..649504)
                     /locus_tag="MGF_RS02640"
                     /old_locus_tag="MGF_3837"
     CDS             complement(649322..649504)
                     /locus_tag="MGF_RS02640"
                     /old_locus_tag="MGF_3837"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBG4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_011113556.1"
                     /db_xref="GI:499426092"
                     /translation="MPKIEVKDGDLELALRKFKRVASETKRSFLKHEYHLRKGVKRRE
                     KEKAARKRLQKKHRMY"
     gene            complement(649541..650587)
                     /locus_tag="MGF_RS02645"
                     /old_locus_tag="MGF_3843"
     CDS             complement(649541..650587)
                     /locus_tag="MGF_RS02645"
                     /old_locus_tag="MGF_3843"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574666.1"
                     /db_xref="GI:504387564"
                     /translation="MSDKIDHNLTKRSSSLDQLSKWEAFLEGYKNFYGFDFEWSKYIK
                     DCKLYYGYFNIHNFIKTYGKECEEDFKRFKQSIALKKQEEINKEQAEQEISKELFNLY
                     DQLFYADSLRSRLLINLLNPRNSYEKKELKRSWKDAKAQGFSKLEWMKLLLNIPFKKG
                     EEDPNDYQYDRDQVYKILDQIKQLKKNYLNKQIKEKADRFSTTKINDFQEDINEASLV
                     VDFHNDFATKLNQTKKDRSDLQVDYENYQQVVNDYQDQKKVVIKQEEQLVKTNPFSEQ
                     SEINKRLQKKLDQKIHEMKLTSSILDSEFKKAELIRKQNELEYQKTKQARENLTKEIE
                     NINQSYTHKKDNIL"
     gene            complement(650645..652405)
                     /locus_tag="MGF_RS02650"
                     /old_locus_tag="MGF_3856"
     CDS             complement(650645..652405)
                     /locus_tag="MGF_RS02650"
                     /old_locus_tag="MGF_3856"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="WP_014574667.1"
                     /db_xref="GI:504387565"
                     /translation="MIRLKTNKNKIGLFASLSMMIGSVIGVGIFVKNISVFRETGNNP
                     TLIIAAWVISAIITLLLALSFIEVTTTGSSKFGVSGYCDISLGKKAGRFFKISQSHFY
                     NGIIGVVLFMYAGELFLFMVDSNGSMGLLNDFNNQSPRASILMTIGIGFVFFLIFLAI
                     NSLSLTATKAFQSASVIIKFLPILIVTIVGIIAGANNYDQSFINQAATTTASRMGNNQ
                     SFTTILIVLPSILFSFDSFLSFTSIQDKMLNPQKYSKIILSIGVITVSIAYILITLGM
                     IFLGNGFAVSSINENLLTTVFKVDAERAKTISYAFRVIFNIFLLISILGVANAFMIVT
                     ISNHQGLINDDLIFGSKWLKRKFNHKFNTQSEQDKFYNFKSQTMGIISYLFIVVVFGA
                     IIAAISIGMGNDRIADGITNFPTLFFFIVYALIPFAIFIKRIKIMINNKDKQLTAQEK
                     RELRFLAKTQTLDGSQQAKLNQLKEKEANYIELFKLTKEHQITKFFMFMAPVASILVF
                     IIFIYQGIWAFLINPIMVSIKNPSATTRAFGGFIEAENTIAGKGLPTYMLTVIYFGLL
                     AIFLFIPWINSVLKKRYPNV"
     gene            complement(652672..653913)
                     /locus_tag="MGF_RS02655"
                     /old_locus_tag="MGF_3862"
     CDS             complement(652672..653913)
                     /locus_tag="MGF_RS02655"
                     /old_locus_tag="MGF_3862"
                     /EC_number="2.7.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_014574668.1"
                     /db_xref="GI:504387566"
                     /translation="MINYNKKTLKDVDLKDKTVIVRVDFNVPIKDNKVIDDTRIVQAL
                     DTIKYLIEQNCKIVLLSHLSRIKSLEDISSKKKSLRPVYENLKTKLNNVKFLEENVGY
                     DVVEAVKQLKHQEVLLLENTRYNDVDNQGEVVKKESKNSPELGRFWASLADVFVNDAF
                     GTSHRAHASNVGIAANISQSCIGFLVQKELEALSKLTNNPQRPFVVILGGAKVSDKLK
                     VIESLLKSADHILIGGGMVNTFNKAKGYHIGKSLFEPEMLETAKKILAEDKDNKIILA
                     TDQMVTKASTITDIKTAPAGKCVFAKDEAENEDFEALDIGDESIKTFKSYIAKAKSIF
                     WNGPLGVFENPNYERGSYEIAKAISESDSYSVIGGGDSAAAANQFKLADKFSFVSTGG
                     GASLTFMEQTVLPGIEAIQSK"
     gene            complement(653921..654949)
                     /locus_tag="MGF_RS02660"
                     /old_locus_tag="MGF_3868"
     CDS             complement(653921..654949)
                     /locus_tag="MGF_RS02660"
                     /old_locus_tag="MGF_3868"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113552.1"
                     /note="NAD-dependent; catalyzes the formation of
                     3-phospho-D-glyceroyl phosphate from D-glyceraldehyde
                     3-phosphate; active during glycolysis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_014574669.1"
                     /db_xref="GI:504387567"
                     /translation="MSKIKIGINGFGRIGRLVCRELLNHEDVEVVAVNDLTDAKTLAY
                     LLKYDTAHGKLSHNVSSTDSEIVVGKQKIKVYSEKDPAQIPWKKHKVDLVVESTGRFL
                     TQEAASAHLKGGAKKVVLSAPAKEKNVKTVVYNVNHTEIKPDDTVISAASCTTNCLAP
                     LVKVLEDKFGIKVGYMTTVHAYTADQRLQDAPHSDYRRGRAAAFNMVPTSTGAAKAIG
                     LVVPKATGKLNGIAVRVPTITGSLVDLTVKLEKDTTVEKINAAMKAAASESFLYSEDE
                     IVSSDILNETHGSIFDSKLTSVLETNGEKLYKLYAWYDNESSYVSQLVRVAKYFAKQQ
                     PKKASAKK"
     gene            complement(655069..655953)
                     /locus_tag="MGF_RS02665"
                     /old_locus_tag="MGF_3873"
     CDS             complement(655069..655953)
                     /locus_tag="MGF_RS02665"
                     /old_locus_tag="MGF_3873"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dehydratase"
                     /protein_id="WP_014574670.1"
                     /db_xref="GI:504387568"
                     /translation="MDLKNMKKIAIITDSSSTIRANEYNDVFVVPLQITVNNNKTYLD
                     GVDIEQEEVYDLLVNDKNVDIKTSMPAVQTMLEVTKKAATDYDHVFVLTISGGLSGTY
                     NQWKLVIDSELSDYKNISIFDTSDTAISLRWLVNDVQDLIKKNQSIKTIEEYITNWKS
                     RICSMIVVNDLTQLRKGGRISKMKSLIAGILKISPIIAFHKGINQLVDKAINLKSAIE
                     KCVSFANNTLKLTKNKLVKVGFCHTFKEDKKVKEVIKLIKEQLTDLNIRDLDVVLITP
                     VIGVHTGVNAFSMNFLIQ"
     gene            complement(656090..656165)
                     /locus_tag="MGF_RS02670"
                     /old_locus_tag="MGF_tRNA27"
     tRNA            complement(656090..656165)
                     /locus_tag="MGF_RS02670"
                     /old_locus_tag="MGF_tRNA27"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(656130..656132),aa:Ala,seq:tgc)
     gene            complement(656174..656250)
                     /locus_tag="MGF_RS02675"
                     /old_locus_tag="MGF_tRNA28"
     tRNA            complement(656174..656250)
                     /locus_tag="MGF_RS02675"
                     /old_locus_tag="MGF_tRNA28"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(656214..656216),aa:Ile,seq:gat)
     gene            complement(656282..657142)
                     /locus_tag="MGF_RS02680"
                     /old_locus_tag="MGF_3877"
     CDS             complement(656282..657142)
                     /locus_tag="MGF_RS02680"
                     /old_locus_tag="MGF_3877"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574671.1"
                     /db_xref="GI:504387569"
                     /translation="MLELTKNPQIIEQFKYFYLRAFKEENEFSWDYLVNAYYGKAIKI
                     FVEKDIKKNFKYGCFVLDKKLMINNEPKTAALVFGVVSDERFRGKGVLNTGFEPFLIE
                     LSQQYDLVLIQSFNWKIYRNFKLEPLDNLHKFAILNQFKNHHYSNKIDLFNYHINQDK
                     INDLYQIRKQYLVKNKIDNYCDYSLNEYKKYLLFNFLIGDVIYYSENSFCQINKDFEA
                     YQLYYLDKTEVNDFILRIPTILTLSLNDYQLDDFKSNQALIKTNQTNFTRCYYQSKLK
                     IKQIFFNELN"
     gene            complement(657136..658062)
                     /locus_tag="MGF_RS02685"
                     /old_locus_tag="MGF_3886"
     CDS             complement(657136..658062)
                     /locus_tag="MGF_RS02685"
                     /old_locus_tag="MGF_3886"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P33275.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574672.1"
                     /db_xref="GI:504387570"
                     /translation="MDRLDLTNASKLQERINQIDSSHFYSALTYYSWSFYGLNISYQF
                     HEKGISFFCEINLEKNLLHEVLQDKYCPTQKVIFAPITKPNQPDDFLDLIKGQIEQLD
                     KSQAIYIDDLTGIELEWVKSKYDVEIIHESSTNFLYETKKIMTLAGKSLQKKRNHLNF
                     FIKQYEKDAKIKINQEVDLNQLEKFYLTWINDCEDPSAYQSELALFRAIKPLIQDGSL
                     KLTALYYLDQIIGFCVSYSLNNRCEIFIEHCDETYRGSYQYLLSNSLRIHHSNDALTD
                     RQDDMGSASISYSKLSYKPEFIIKRYLVKVIC"
     gene            complement(658062..658454)
                     /locus_tag="MGF_RS02690"
                     /old_locus_tag="MGF_3888"
     CDS             complement(658062..658454)
                     /locus_tag="MGF_RS02690"
                     /old_locus_tag="MGF_3888"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit epsilon"
                     /protein_id="WP_014574673.1"
                     /db_xref="GI:504387571"
                     /translation="MVKLKVLSPNGTLFDEKIEMIIVKGAEGYAGFMRNTQPSIFAIN
                     NSVGYITYPDKTKKSVVIENATLYCNKDLIKIFALDFVIADNLSYDEIMKRKKDLESK
                     IKDTTDTKELIRLQHALDIELLKLKEAK"
     gene            complement(658447..659862)
                     /locus_tag="MGF_RS02695"
                     /old_locus_tag="MGF_3901"
     CDS             complement(658447..659862)
                     /locus_tag="MGF_RS02695"
                     /old_locus_tag="MGF_3901"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574674.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The beta chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="WP_014574674.1"
                     /db_xref="GI:504387572"
                     /translation="MNTKYSYGKVYQVVGPVVDVVFEKQDDLPKIYDCLIIDEPNMKL
                     HLEVAQLIGDDIARCIAMGPTEGLARNVKVTSTNQPISVPVGTEVLGRMFNVIGEPID
                     EKKPIDASVKRMSIHRPAPSFADQSNELEIFETGIKVIDLLIPYAKGGKIGLFGGAGV
                     GKTVLVQELIHNIATGHGGLSVFAGVGERTREGNDLYYEMIEGGVIDKTALVFGQMNE
                     PPGARMRVALTGLTMAEYFRDVNNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQ
                     PTLAEEMGSLQERITSTKSGSITSVQAIYVPADDLTDPAPSTTFTHLDAKTVLDRNVA
                     SLGIFPAVNPLDSTSRLLDPSVVGIQHYQTARKVQMILQKFLELQDIIAILGIDELSE
                     EDKLTVSRARKIRNFLSQPFFVAEKFSGNKGKYVPISETIKGFSEIVEGKHDDLPEQA
                     FFYVGSIDEAIERAKTLTRNG"
     gene            complement(659866..660735)
                     /locus_tag="MGF_RS02700"
                     /old_locus_tag="MGF_3910"
     CDS             complement(659866..660735)
                     /locus_tag="MGF_RS02700"
                     /old_locus_tag="MGF_3910"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATP synthase F1 subunit gamma"
                     /protein_id="WP_011113546.1"
                     /db_xref="GI:499426082"
                     /translation="MASMQDLKRRMESITVTHKITKAMKMLSTVKLNRFKATLGKTKE
                     FYQEFYEVIGAVITNYNKTKPRTTTPTNQSTKRLWIVINTQLGLCGSYNTNVGKLLVS
                     ELAKDDEIILVGTKLNSFLRTRNHEDQIIHTYSINDKNIDFESSYMIGKHVLELHEKN
                     QYDSIDCVYTNYINSLNFEAKKIQLIPADPSIFQADTLDRINDKFPKNISFEPGVDVI
                     IPALEKQLLQVILYGCLIESKVCEYASRRNAMDTAAKNADDLYNKYKLLYNQLRQAKI
                     TQEINEIVAGAAK"
     gene            complement(660743..662299)
                     /locus_tag="MGF_RS02705"
                     /old_locus_tag="MGF_3919"
     CDS             complement(660743..662299)
                     /locus_tag="MGF_RS02705"
                     /old_locus_tag="MGF_3919"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P33252.2"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the alpha chain is a
                     catalytic subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="WP_011113545.1"
                     /db_xref="GI:499426081"
                     /translation="MAINLNEYSLLIKDQIKKYANKIISDQKGYIITIGDGIVRVSGL
                     DDVLLNELVEFENGAYGIALNLEPNSVGVVMLSDYYDLKEGSSVKRTGKVIQAPVGDG
                     LLGRVIDPIGLPIDGKGELKNISGYAPIERLAYGVMQRKSVHQPLETGILAIDSMLPI
                     GKGQRELIIGDRQTGKTTIALDTIINQKGKNVNCIYVAIGQKNSSVAQITRLLEETGA
                     MAYTTIVSATASELAALSYIAPFAGVTIGEEWMRQGKDVLIVYDDLSKHAVAYRALSL
                     LLRRPPGREAYPGDIFYLHSRLLERAGKLSDELGAGSITALPIIETQAGDISAYIPTN
                     VISITDGQLFTTTSLFNSGQRPAIHVGLSVSRVGSAAQLKSIKQVSGSLKLELAQYRE
                     LDTFSQFSSDLDAETKIVLEHGARVMEMFKQPQAKPIDQTSEAVLLFGIKNRFIKWIP
                     TDHIIKFKEFILDKIKQDQVYKKIEEKKAFDDEIEKELTAFFKDVVKKYTSTLVDYNG
                     SLYGDLKELE"
     gene            complement(662303..662848)
                     /locus_tag="MGF_RS02710"
                     /old_locus_tag="MGF_3924"
     CDS             complement(662303..662848)
                     /locus_tag="MGF_RS02710"
                     /old_locus_tag="MGF_3924"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P33254.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit delta"
                     /protein_id="WP_011113544.1"
                     /db_xref="GI:499426080"
                     /translation="MDTNIMGFARALVDLAHEEDKVHLFYDNLKVVFDLVKENQDLMS
                     LMNSQVLSKNQKHEIIDVVFKDHLTQTIVDFLKVVIDNREFFHIKSIIKKFFRMIEEE
                     EHTIFINVVSAHELNDDQKAQLVEKLHKKFASQVKILYQTDPSLIAGIRIQSNDLLID
                     NSIDGKLKLLKHQLRTFSKEN"
     gene            complement(662853..663449)
                     /locus_tag="MGF_RS02715"
                     /old_locus_tag="MGF_3928"
     CDS             complement(662853..663449)
                     /locus_tag="MGF_RS02715"
                     /old_locus_tag="MGF_3928"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit B"
                     /protein_id="WP_014574675.1"
                     /db_xref="GI:504387573"
                     /translation="MWSTRVKKLLLLSFNFLIISAIVSSCSIPEELQAKTIVNEFFPN
                     FWVFVAHTIALSIIILLGIFLLWKPTKRFLAKRSELIQAEINNANEIKKQAQLLLDNA
                     KKQKQNAELQAREIINLATNQAYRLKNDLETDAKRKANRIIENAHAEIIKQESILKRE
                     LEGRIVDVALEATSTLIQKNVAKEDHERLVNELLRNLD"
     gene            complement(663452..663742)
                     /locus_tag="MGF_RS02720"
                     /old_locus_tag="MGF_3929"
     CDS             complement(663452..663742)
                     /locus_tag="MGF_RS02720"
                     /old_locus_tag="MGF_3929"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P33258.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit C"
                     /protein_id="WP_011113542.1"
                     /db_xref="GI:499426078"
                     /translation="MNIFLVIHELINQADQVNVTLTNHVGAYIGAGMAMTAAAGVGVG
                     QGFASGLCATALARNPELLPKIQLFWIVGSAIAESSAIYGLIIAFILIFVAR"
     gene            complement(663843..664736)
                     /locus_tag="MGF_RS02725"
                     /old_locus_tag="MGF_3936"
     CDS             complement(663843..664736)
                     /locus_tag="MGF_RS02725"
                     /old_locus_tag="MGF_3936"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit A"
                     /protein_id="WP_014574676.1"
                     /db_xref="GI:504387574"
                     /translation="MLPQEIVYTKLSSTETQNGWIDFLTTKPLASQGIEWTPLIPTAH
                     VLSIFMVLFMIAILTAVYYTKLKKLKPTEPPTGYVLVVQLLILQFENLTVDLLGEKNR
                     RLSLLFIIIFVYILISNLMSMVGGIAAPTSSSTVTFSLGLMSFFGTFIMGVKYQKLAY
                     FRDFFVIIKIKKKTIPLMINPLNVIGYFAPLLSISLRLWGNVLAGSIFIALLYSLFRT
                     FFTLGSPSSFSVGLVFGTLAGGLVIPAFHVYFDILVSAIQAFVFVSLMLTYWSQPIKA
                     AENAAEEKHQQMIENQRLNVK"
     gene            complement(664699..665208)
                     /locus_tag="MGF_RS02730"
                     /old_locus_tag="MGF_3941"
     CDS             complement(664699..665208)
                     /locus_tag="MGF_RS02730"
                     /old_locus_tag="MGF_3941"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P33250.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATP synthase subunit I"
                     /protein_id="WP_011113540.1"
                     /db_xref="GI:499426076"
                     /translation="MIVDKKIIKYNLIIFNVFSIVGLIILLGLTFTKIIGFQWVYSSL
                     LTVVFSNISLVIGLILPNLLYTSATKLNTQQVKSARFGFFILGIITLSSRLFWYAVPI
                     VIIGFVNQWQFQGAVFNVFPAILWPLSMIAVHVVVNYLLLNKEIKERNKLKELNNNVA
                     TGDSLHEAF"
     gene            complement(665384..667138)
                     /locus_tag="MGF_RS02735"
                     /old_locus_tag="MGF_3948"
     CDS             complement(665384..667138)
                     /locus_tag="MGF_RS02735"
                     /old_locus_tag="MGF_3948"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113539.1"
                     /db_xref="GI:499426075"
                     /translation="MGLSRKKIFTWPLLLTGMAVVSTTFSSCSVFNFFSNLPTTTDNN
                     NYGPTVQNLSAFLPTSDYKKIYDLSFSLEFNNSGGYNPSRLMSNNEGVTAENVNRPYR
                     VFGTGWLFDWQAQPVDENDQNAKWTGYFATNLHVAEALLNPLDNKNYRPAWYKNELPL
                     PGVDQTLYFNLGKWDENLAVQNKHNPKSLTYLPLSNLPKTVYTATSFYKESPKWITPI
                     EADNPGIREYIDFAVLSITLDLSWTMRNGEKVHRYNDEYQLYNRWIMPAMNVAKALWD
                     NKGVLNQPATPPNKKEEDDQLTDQLPYHGFFDRSNYTNPNVSLNNFSVYLGGYPYYAN
                     WPTTPQYTKFSVPSLSRRQIPITSDSRGSPGWTINALNPTELDGQKIASSTSLSSTGG
                     IRAGIYNADIARNFQLVYRNVKYKQYGYGYIIQNSNLSAGSSGSLALTSNNQALGIYF
                     GTVSVDAKKEATFGLVASLFNPNKIQVNVVTGNNVFETDTIQPYDLIYGNDLMTDDYG
                     SYIRSLQTLNLSSRLLTKIKDNLPKKEGSTNQANQQTNQTNRSTDATKKDSSSDETNK
                     NPLAELLSDIFKNLPNWN"
     gene            complement(667253..667888)
                     /locus_tag="MGF_RS02740"
                     /old_locus_tag="MGF_3954"
     CDS             complement(667253..667888)
                     /locus_tag="MGF_RS02740"
                     /old_locus_tag="MGF_3954"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="WP_036447331.1"
                     /db_xref="GI:738498399"
                     /translation="MMKNFIFNHPLISDKLSKMRDVNTGYNFFKQLLTEITTLMMYEV
                     GKGYELEEISVTTPLATTKAHKLKHNFVIVPILRAGLGMVDGVHNVIPTARVGHIGLY
                     RDEKTFQPVEYYSKFPQTMDDGHVIVLDPMLATGASVIKAISLVKNIQPKKPRSIKFM
                     GLLGAPEGLKALNQAHPDVDVYLACLDEKLNDKNYIYPGLGDAGDRIFGTK"
     gene            complement(667889..668968)
                     /locus_tag="MGF_RS02745"
                     /old_locus_tag="MGF_3962"
     CDS             complement(667889..668968)
                     /locus_tag="MGF_RS02745"
                     /old_locus_tag="MGF_3962"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase"
                     /protein_id="WP_041594414.1"
                     /db_xref="GI:753838797"
                     /translation="MYTRTKTKKVFVGDVQIGGQNKIVLQSMTIAKTKHVKKSLKEIN
                     DLVKEGADLVRIAVFDDTDKRAIRKVVDQSPCPIIADIHFNPDYAIAAIKAGCKKIRL
                     NPGNIKSKEKLREICLLANQYNIPIRVGVNSGSIPYDLMREYGVTSTAMIIAAQRYVR
                     MLKRFGFDNIVISLKTSSALLSMQAYELGAKKFSYPLHLGITEAGTLINGTIKSVAGL
                     TPLLLKGIGDTIRISLSTNPVDEIKVAKKMLNSLGLYENLVDVVACPTCGRLNFDLFK
                     VTKEIEEFVKDLHFPLKVSILGCSVNGPGEAKEADIGIAGGKQEGIIFKKGVVVKSVK
                     QEYLVDELKQMILEEYELFKKKNGK"
     gene            complement(669024..669416)
                     /locus_tag="MGF_RS02750"
                     /old_locus_tag="MGF_3965"
     CDS             complement(669024..669416)
                     /locus_tag="MGF_RS02750"
                     /old_locus_tag="MGF_3965"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBH4.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_011113536.1"
                     /db_xref="GI:499426072"
                     /translation="MAVVTFKGLGRRKSSTALVKLTPGSGKLVINNRKAEDYFPNKIV
                     IQDMRQPLEVTKTASIYDINVVVNGGGFTGQAGAIRLGIARALVNMNPELKKQLKQHK
                     LVTRDARVKERKKFGLYGARRAPQFTKR"
     gene            complement(669416..669859)
                     /locus_tag="MGF_RS02755"
                     /old_locus_tag="MGF_3967"
     CDS             complement(669416..669859)
                     /locus_tag="MGF_RS02755"
                     /old_locus_tag="MGF_3967"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_011113535.1"
                     /db_xref="GI:499426071"
                     /translation="MQKTTMQKPVVATKNRKWYLVDASGLVLGRLAVKAANLLRGKNK
                     PDFTPNVDCGDYLIILNSDKVVLTGNKLDNEKWYRHSNYMGGIKSRTGREMVDHYSDQ
                     LVYDAIRRMLPKNRLAKDMMRKLKVYKNDRHEHDAQQPTKLDWSK"
     gene            670002..671696
                     /locus_tag="MGF_RS02760"
                     /old_locus_tag="MGF_3970"
     CDS             670002..671696
                     /locus_tag="MGF_RS02760"
                     /old_locus_tag="MGF_3970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase C1"
                     /protein_id="WP_014574678.1"
                     /db_xref="GI:504387576"
                     /translation="MRLKNKKILTSLLVSPGLLIPFSTMSATTSVNSNAPKLDFFKNK
                     SAEEIAKMEFFDARDYNLVTSVKHQGNEGLCWAYTIASILETNMLKNNIGNYTKNSLD
                     IDEHAIDYISNSWNHNADKLNLNSNAQQWGGIFGEGNYLSHAFTGLMRNTSPIAQTNQ
                     TEFPNFDNPTIAKIKNAVKVNPTVEDIKLAIAKYGSVGVAYAFNAMNFHPKTIWYNEP
                     NSSIVNKSADQKNIKNHASVIVGWDDNYYESNFKPEIPKRRGGFIVKNSWGTKKMHSQ
                     GYFILSYDSLDLIQELMAVEVEKNDAYKNTYYYDTKNSFSLFATLDTKERTMANIFPV
                     KKANDEVVEKLKSINFALRGLNITAEIKIYVKDSLMSNPEDGELKLTQRVQIPNSGEK
                     GFYTIDLDKEIILNKGQYFSIIVDVTNEGEKVVDLMASGETREILSFYKYKNEWVNSK
                     KSFVVFGIKAHTLEMPITELNKDIAADEKNNPISKESNTSETKSNTTPSSESQTNNSV
                     KTGKQTNSNTATHESSVTENKTNVILWSILGALAGIATFGVTTFFIVKLMKKRVKK"
     gene            complement(671936..672349)
                     /locus_tag="MGF_RS02765"
     CDS             complement(671936..672349)
                     /locus_tag="MGF_RS02765"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006546761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594415.1"
                     /db_xref="GI:753838798"
                     /translation="MLSVLLNKIIVQPKTNHHVHDHDHGCDHTHDDGGNDHGHPHALA
                     NLMNLVNNALKEFSETNINQENSDESIKAKLTQLATEQNIDLTNEINAFVNALKQFKV
                     EYNQNNSKNNYINALKNEVENLKAKIDSVKQLINA"
     gene            complement(672734..673546)
                     /locus_tag="MGF_RS02770"
     CDS             complement(672734..673546)
                     /locus_tag="MGF_RS02770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014885974.1"
                     /db_xref="GI:504698872"
                     /translation="MLAIKEAGYDYIMAYKIKGKENKIEGIYDLETYKMMYEEFGVKK
                     QDHKEFFKSNNTFYEIDNKLILTFSRKRQKKDKKDRERLIKKAEKSLNLSAIKSEMKR
                     GGKKYLKFAANEVELDHQAILKDEAADGFYGILTSHEDMNEEDMNEKEIIKQYSKLWK
                     IEESFRVMKTNFELRPIFLSAEKTIKGHFLICFLALIIQRYLEFVLDCCGYPMPTNKI
                     IDAIKNQKLSIIPEINTYIKTEESEDFKTILKVFGIKLIETIGKYEDIKFTI"
     gene            complement(<673912..674405)
                     /locus_tag="MGF_RS02775"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            674731..675960
                     /gene="glyA"
                     /locus_tag="MGF_RS02780"
                     /old_locus_tag="MGF_4004"
     CDS             674731..675960
                     /gene="glyA"
                     /locus_tag="MGF_RS02780"
                     /old_locus_tag="MGF_4004"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NBH8.2"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_011113533.1"
                     /db_xref="GI:499426069"
                     /translation="MEIFKLINQELQRQQDQIELIASENYVSEAVLRATGSVLTNKYA
                     EGTPNKRYYGGCEYVDQIELIAIEKLKKLFGARHANVQPHSGSTANAAAYLALLQPHD
                     KVLAMGLNDGGHLTHGSKVNFSGKIYDFYHYNVDPNTYLLDYDEILKKAIEVKPKLIV
                     CGASNYSRAIDFAKFRQIADHVSAYLMADIAHIAGLIVAGYHQNPVEYCDIITSTTHK
                     TLRGPRGGIILTNREDLIKKIDSAVFPGELGGPLMHVIAAKAIAFDEALQPKFKTYIK
                     NVIDNSKAFCEAFINKGYQIIANGTDNHLFSINLFKKFNLTGDLVENWLYQANIVVNK
                     NMIPYDSNKSMNPSGIRLGTAAMTSRGLVQSDFVQIADWIDQIIKAKGDLNVINKVKS
                     EVKKLLVKYPIYQDRDY"
     gene            676007..677254
                     /locus_tag="MGF_RS02785"
                     /old_locus_tag="MGF_4010"
     CDS             676007..677254
                     /locus_tag="MGF_RS02785"
                     /old_locus_tag="MGF_4010"
                     /EC_number="6.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="WP_014574680.1"
                     /db_xref="GI:504387578"
                     /translation="MDFISELKKRNIIKQISNEEKLALALKNQKGVYVGFDPSGESLH
                     LGNLIPIIVLRYLKKVGFKTYAILGGATGLIGDPSGKTSERKVQDYEKITANANKIKV
                     QLERYTQAKIINNIDFYQNMNLLNFLRDTGKLINIGYLLDKEFIRSRIENGISYAEFS
                     YNIIQGHDFLHLYEQYDVQVQCGGSDQWGNITTGIDLIKRKYGEEKTPYLCGLTFNLL
                     LNPNGNKFGKSEQGALYLDENLTHPYLIWQYIYNQDDQFIIDLIHRYVLDQSLEQLQE
                     LIEAHLANKKTRIAQKFLADYLVKFIHSQEHLDTVHKMNKALFDNQLDQLSDQEKLVV
                     FASFDKVELDRNQSFMVIDFLLQAKVADSKRILRELIAQGSIQIDDLKITDPQAQLNV
                     RKDQQLTVIKKGKKNYFIVVWKG"
     gene            677260..678597
                     /locus_tag="MGF_RS02790"
                     /old_locus_tag="MGF_4016"
     CDS             677260..678597
                     /locus_tag="MGF_RS02790"
                     /old_locus_tag="MGF_4016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884157.1"
                     /note="with 4.5S RNA forms a signal recognition particle
                     involved in targeting and integration of inner membrane
                     proteins; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="signal recognition particle"
                     /protein_id="WP_041594416.1"
                     /db_xref="GI:753838799"
                     /translation="MLKSMISSIVTKSLKKRLLNQTIKEEDITEVLREIRIALLDADV
                     NINVVKTFIKAIKEKAIGQAVDRNTDVHAYFLKIIKDELVNILGKDQQPLKTDKKLAK
                     IMLVGLQGSGKTTTVAKLAKFLNKQKQKNSLLVGLDVYRPAAIDQLNTLAEQINMPFY
                     NEGLSDPVKTAKNSIEIAKEKNCDLIIYDTAGRLQTNVELMNELVNIRNTVDPDEIIL
                     VVDGLSGQEIINIATEFNNYLKLSGIIITKLDSDARAGAALSLRSILNVPIKFTTSGE
                     KLDAIELFYPERIADRILGFGDVMTLAEKAQEVYDEKSTMKTFEKMLSGRMDLEDLLQ
                     QTQSITKMGGLGSLVKMLPGFANKISEDKVEEATQKIHVWKILMSSMTLKERRNPKLL
                     MKNPSRKSRIIKGSGRKVEELNKLLKDWQNASGKMEEIGRMLKANKNPFGSLF"
     gene            678672..679109
                     /locus_tag="MGF_RS02795"
                     /old_locus_tag="MGF_4023"
     CDS             678672..679109
                     /locus_tag="MGF_RS02795"
                     /old_locus_tag="MGF_4023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="organic hydroperoxide resistance protein"
                     /protein_id="WP_011113530.1"
                     /db_xref="GI:499426066"
                     /translation="MFKKVYETAAVAKVGREGLVKTTDGQLSLNLGFPKAMGGSHSDR
                     LNPEQLFAAGYASCFSQAVFAVSKKLGHDLKEAPIEVTVQLHVQEEPMAFELRVGISL
                     TVDLPEAKAKELMKLSHETCPYSKLAKPSQIIWLKVNGMDVPY"
     gene            complement(679257..680363)
                     /locus_tag="MGF_RS02800"
                     /old_locus_tag="MGF_4030"
     CDS             complement(679257..680363)
                     /locus_tag="MGF_RS02800"
                     /old_locus_tag="MGF_4030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="multidrug ABC transporter permease"
                     /protein_id="WP_011113529.1"
                     /db_xref="GI:499426065"
                     /translation="MIYAKTTFGSLLARNIKLFLRNKTRFFFILLGPVITLLVFVLII
                     KRNSFDPGGRAVEFLNLSSLSRESQTSLRDLGAIELVYSTEFTTEISNYIFNGTLLSG
                     LISITALTTAVQLSQNIVQDREERILEDFFITPTKTTTVRLSYVVFNILFNMLITLLA
                     LFFIYVYIVARFPTSPFSKPETVLATVGVTILICLINSVFFVFIFSYIKKLSIFLVLT
                     AMVSSAGGFLIGGYFPISLLPKGLSAAISLIPQTEASILLNNVSLNHDIITSSVNTLT
                     AENVSVTLSNDTTKNLLTFFMDNARMPREQALQTANEIVQKLTDGINMGIRDYAKTTL
                     VGQDVEPYVSVIYAAGLLGLFTFLLYAVKYSRKR"
     gene            complement(680363..681379)
                     /locus_tag="MGF_RS02805"
                     /old_locus_tag="MGF_4035"
     CDS             complement(680363..681379)
                     /locus_tag="MGF_RS02805"
                     /old_locus_tag="MGF_4035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_011113528.1"
                     /db_xref="GI:499426064"
                     /translation="MENLEKNEVILKITNLNKSFDKHKRSGTKKALDDLTFKVYKRQF
                     YGFLGVNGAGKTTTLNIIMGLLSKDSGSIELFGEEVKGDFTRIRNNIGIVFQNSILDK
                     NLSVYENLYSRLSLYKNEFKDKTTKQVVDEMVVNFKLEDIIWKKYGSLSGGQRRRVDI
                     ARALAHNPSILFLDEPTTGLDPISRRMVWDILEKLRIERGLTIILTTHYMDEADGCDY
                     TIVIKKGKKLAEGTPAELKTRYAKSWVLVQDKPDHSIRKLIETKSLTYEIKGGYLRVA
                     FDTYDQAHKFTQEHIGVLENFELIKGNMEDVFINLTNEENKKHPEETESTKHRSWWKL
                     GGAK"
     gene            complement(681631..682527)
                     /locus_tag="MGF_RS02810"
                     /old_locus_tag="MGF_4043"
     CDS             complement(681631..682527)
                     /locus_tag="MGF_RS02810"
                     /old_locus_tag="MGF_4043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014574682.1"
                     /db_xref="GI:504387580"
                     /translation="MADKQQPTQLNLIAYFDDYQSAQNEQQNSTTLRPIELDQFYRNL
                     IRDISLSQTSSVYQQYDQPQYEEPATNNYQTSSYKITPDQEKAYYQEQTEAFNDHLNN
                     GNYYNKNTTSFMFHDTLYNYQYDHSKINNKHVNSFSDGRERLFSDSVVNNKGAEKTAE
                     FQIEDFIQWVAKKKEKWKKAREAKRKQREFKKRKLDDENAWYEKVMSEGTQAFRGSFG
                     FDFNSIDWDNIDFNGSSNEEEINNAYRILGLSIHDSSDDVRSAYRRLAKKYHPDLNKD
                     PGAEEMFKRINYAYEILNEYVL"
     gene            complement(682531..683520)
                     /locus_tag="MGF_RS02815"
                     /old_locus_tag="MGF_4048"
     CDS             complement(682531..683520)
                     /locus_tag="MGF_RS02815"
                     /old_locus_tag="MGF_4048"
                     /EC_number="1.1.1.94"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_014574683.1"
                     /db_xref="GI:504387581"
                     /translation="MKTKIGVLGTGAWGTALANILLKNGHIVQMWGIDQDEINNLKTG
                     YNNRYFGHKKLVKSPDLVSSDLAAVVDGCDYLLLAIPSKFFNDVLAKLANVLKDRKVN
                     LINVAKGMDGQTKQFWSEVIKQAFSKNLLSLTSLLGPSFATEVFHNHPTVINAVSNDM
                     TSCKKVCELFNNDTFQLVPFDNELSAQLFAAIKNVCAIGTGIVFEQTTSANTRSASLT
                     KLFNEMDRLYESLAKDKYRPKDCTQLNGIGDFILTCTNDQSRNFSFGKLVAKYGIKNA
                     LEKNINTVEGYLAAKTMYEIIKNNNLELKLLITIYQILYEDLDESVLVKKLIN"
     gene            complement(683603..684733)
                     /locus_tag="MGF_RS02820"
                     /old_locus_tag="MGF_4056"
     CDS             complement(683603..684733)
                     /locus_tag="MGF_RS02820"
                     /old_locus_tag="MGF_4056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014574684.1"
                     /db_xref="GI:504387582"
                     /translation="MRPFLESNYYELLGVSETASKEEIKRAFRRLAREYHPDVNKAPD
                     AEAKFKEINRAYSILSNETTRFDFDRRLKQRRAKASATNTTSFFHQRNQNQNYYEILK
                     VNQNDSTEKITIQYKMMRLQYSTVFAKDAHSAEMSRKIERAYEILGDPLKRARYDQYL
                     KLANTSLMSFELWCAKNPEEPPIKKKAATPPFKEDKKAKEDKKTKTKAEKQSESEKNT
                     EQVKVKKDKKKKGEKPPKQVQAIDPDLLFPKRWNDTSRVMKIITNVQLVLSYTLILCI
                     VLSLIFIFLQNNSVLEKFYNELSLGWFPFVWILFGTITLLSFLNIYLASDFSATNPEF
                     KKVKVVWIITAVLFISVFYASYLTKKAIEAQEVHNNTANKLG"
     gene            complement(684767..686167)
                     /locus_tag="MGF_RS02825"
                     /old_locus_tag="MGF_4064"
     CDS             complement(684767..686167)
                     /locus_tag="MGF_RS02825"
                     /old_locus_tag="MGF_4064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Fe-S cluster assembly protein SufB"
                     /protein_id="WP_014574685.1"
                     /db_xref="GI:504387583"
                     /translation="MPISKKILNKKYQYGFYDKDTSIFETTKGISREIVKKISKLKNE
                     PEWMLKIRLEAFDTFMKMANPSWGPDLSFIDYDNAVMYSKAVNNPQYSWDQVPKKIKN
                     TFKKLGILEAEAKFLNGVSTQYDSQAVYHSIEKELAENGVIFTDTDTAVQKYPELVKK
                     YFGSIVPTNDNKFAALNTAFWSGGSFVYVPKGVEIKKPLQAYFRINGRRVGQFERTII
                     ILEEGAKCHYVEGCTAPVYSEDNLHCAVVEVFLHKNSVGRYTTIQNWSDNVLNLVTKR
                     SIVYENAKMSWIDGNIGARINMKYPSSILAGEYASSDCISIAVANKGIIQDAGAKMIH
                     LAPHTKSRIVSKSVSFNGGDTCYRGLVKIGKDAHYSSSKVECDTLLIDNISRTDTLPT
                     EIIENKYSSLEHEAKVSNISEEQLFYMMSKGIPKDVAENLIVLGFIEPFTKELPMEYA
                     IELNRLITMDMEGSVG"
     gene            complement(686171..686605)
                     /locus_tag="MGF_RS02830"
                     /old_locus_tag="MGF_4067"
     CDS             complement(686171..686605)
                     /locus_tag="MGF_RS02830"
                     /old_locus_tag="MGF_4067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="nitrogen fixation protein NifU"
                     /protein_id="WP_014574686.1"
                     /db_xref="GI:504387584"
                     /translation="MNYSNPLIRRQIIIDYYQNPKNFIKEPISDPNYKVIKTKSDSCV
                     DQFDLYLLIKDNLLVDLKFSGSGCIISQTTFDFLSKYLINKKLDEVKKLLSAYLEFIF
                     KDVRSPLLAEEFDIFSSVHMQSNRIICATINAKALNEYLTKE"
     gene            complement(686592..687788)
                     /locus_tag="MGF_RS02835"
                     /old_locus_tag="MGF_4072"
     CDS             complement(686592..687788)
                     /locus_tag="MGF_RS02835"
                     /old_locus_tag="MGF_4072"
                     /EC_number="2.8.1.7"
                     /EC_number="4.4.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cysteine desulfurase"
                     /protein_id="WP_014574687.1"
                     /db_xref="GI:504387585"
                     /translation="MKVQLVREQFSWFKNNKGWIYFDNAATSLKPDSVVNAISEYYQK
                     WSLNPHNNNTSLSNKLNDIISETRKKTAQYLAVSADEIIFNSSATEILNLFAFGLSEY
                     LKVGDEIIVNELEHASNLINWLELSRRNNLKLVLVKSLNEIKDKVNQKTKLVAFSGLS
                     NIFGYKINYLDYAKQIKTINKNCLVFIDATQLAAQEKIVISQDIDGLCFSAHKIFGPT
                     GLGIGYIKKDLQKILNPLKYGGDMYYDFDINQKSISLKTNPLKYEAGTNNVAAIYSWS
                     KTLDFINEIYNEEFQTYKQNLTTYFKEKIKQQKKLILINEQANFPIFLLQIPNIHSQD
                     LAWYLSTKKIITRAGASCVYLLKKYQKDGYVRVSLSIYNTKEEIDYFFKVIEEFDLKD
                     ILNELL"
     gene            complement(687769..688407)
                     /locus_tag="MGF_RS02840"
                     /old_locus_tag="MGF_4077"
     CDS             complement(687769..688407)
                     /locus_tag="MGF_RS02840"
                     /old_locus_tag="MGF_4077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014574688.1"
                     /db_xref="GI:504387586"
                     /translation="MEKKYFVLIDSNTSQLVYSIPKNTNSFIHLLDIHDSDSNLNINV
                     NLSENSSAKVIISTFGINKNKKKYNIKLNHLSNNARSVYQNYVVAADQSYVSSTITSV
                     IKNKTHQNDTVQEIRGVLLSDEAVVKGEPQLIIDDNNVKAKHAMAVGRLNQNHLFYLM
                     AKGVKKAEAIKLILMGYFIKTISIIESEKERTKMIKQIEDLFLKVNYESSIS"
     gene            complement(688414..689220)
                     /locus_tag="MGF_RS02845"
                     /old_locus_tag="MGF_4081"
     CDS             complement(688414..689220)
                     /locus_tag="MGF_RS02845"
                     /old_locus_tag="MGF_4081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011113520.1"
                     /db_xref="GI:499426056"
                     /translation="MSELVINNLTVNIDKKRILTNVSATIKAGDIVAIMGPNGHGKST
                     LLKTIMGHHDSKIVRGKILFKDQVLNKMEVDERARLGLYLASQAPEEIPGVSLVEFIR
                     SAINARREKPIDLPEFYKLIQSNTKKLKMNFELLNRSVNEGFSGGEKKKNEIFLLKTI
                     NPDFAMLDEIDSGLDVDALKIITKELQEWIKDKSKSLIIVSHYERMFKLIKPTKVFVV
                     VNGTIVTEGDASLAKRIDKEGYDWIRKEFNIDFKENKDHDFELIDQFAAK"
     gene            complement(689628..690347)
                     /locus_tag="MGF_RS02850"
                     /old_locus_tag="MGF_4084"
     CDS             complement(689628..690347)
                     /locus_tag="MGF_RS02850"
                     /old_locus_tag="MGF_4084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_014574689.1"
                     /db_xref="GI:504387587"
                     /translation="MKNMARNISKISKILMVGDLEVNVTKKKGIKNIYLKVKPPFGDI
                     FVSCPLNCPDKSIVDFVLLKLNFVIKAKQNVLRNAEQFYTKFESGEKIYLWGQVFNLF
                     IVDTKKRTSIQLREDNLIFNVDKDFDQNTKEKIFNNWSKKLLMYEMKKLIKNLEGIMG
                     VKANEYRIRNMKTKWGTCNVDKKRIWISLRLVKKPIACLLYVLIHEMTHLIEQNHTKK
                     FYKIVEHFLPNWKEINKLLKQ"
     gene            complement(690417..690974)
                     /locus_tag="MGF_RS02855"
                     /old_locus_tag="MGF_4087"
     CDS             complement(690417..690974)
                     /locus_tag="MGF_RS02855"
                     /old_locus_tag="MGF_4087"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113518.1"
                     /note="catalyzes the hydrolysis of pyrophosphate to
                     phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_014574690.1"
                     /db_xref="GI:504387588"
                     /translation="MSNLLELKVTIEIPKGSNIKYEYDRKTGQISVDRILYGSEVYPH
                     NYGFIKEALDWDGDELDCLVVANQAFQPGVVVPVRILGMMGMVDSGETDNKLIGVIAC
                     DKRFENIRSLKDLGAHALKEIKGFFETYKLLQNKKVLVKGFKELDSAIHEYKNCVSLM
                     NQYGSLPKDEFIAKMKKMHPEKYME"
     gene            691047..691733
                     /locus_tag="MGF_RS02860"
                     /old_locus_tag="MGF_4088"
     CDS             691047..691733
                     /locus_tag="MGF_RS02860"
                     /old_locus_tag="MGF_4088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574691.1"
                     /db_xref="GI:504387589"
                     /translation="MQIQKNIRKRRDYYSFNFKLSFNAGMLALAIIFAYLSSLVKIPF
                     FSSLSLTIDISIVFLIPVIYISSIYSAVALTISLSLIHFIWNSTNWIGIIFLTIINIF
                     TILIFAFLNWLLNKTKLKDKKVKWLVIWILIIPILMFLFSAINGILITPLYWWWFRAV
                     RTINFIEVAKFYNSTTNLRFFLLFINDYWTGIFSLYSLFNLIKFSLVAFFAIPLLTFF
                     QNNLFTKKMF"
     gene            complement(691857..691942)
                     /locus_tag="MGF_RS02865"
                     /old_locus_tag="MGF_tRNA29"
     tRNA            complement(691857..691942)
                     /locus_tag="MGF_RS02865"
                     /old_locus_tag="MGF_tRNA29"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(691907..691909),aa:Leu,seq:caa)
     gene            complement(692046..694985)
                     /locus_tag="MGF_RS02870"
                     /old_locus_tag="MGF_4103"
     CDS             complement(692046..694985)
                     /locus_tag="MGF_RS02870"
                     /old_locus_tag="MGF_4103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CrmB"
                     /protein_id="WP_014574692.1"
                     /db_xref="GI:504387590"
                     /translation="MLRSKIKKLLFSSCALLLSLFLLLIFGQNRPLNTNNNPLIYDHQ
                     LKNKALSETIVNNGRIYRKSVEQFNALQQPGYISNNNFNGLKLANGGYIFISKDNDNM
                     IYRTDLFYNTLWTYRFANNNQISRHVVEVAYDPYDPTTFYVLTVPRQNDDNAIIAYAN
                     GSKDGFGVITKIKENLDRELDKRADFQSEIAIDPQALLNNIPSTWNSNPSFLSNTIGF
                     TNNGKFIFSYNNYLANLANLIVYKQNIYLIGGNGNINPTISDRFQSLGIFRIDKNLNQ
                     VTGWPYAVLIGGWSQTRDSNFGVNLPIFQDAQFTYVIRGAIAGGKIISDTDQLQIGGS
                     WSVGDHNVLSATNREISRVNNNSSDLQLLGTIRLNLSVLDSLGSFVSPTAFMPTTDLK
                     RTNPNFLLVSGSQDFNFNNNNNLFNNQRELRVKSRLYRLDNTNFYHSVAGFSYGFDVG
                     SFSMQFNDLTIIFDTNGTYTVIQPPLQLQRLFGFENNQYQWDNFVNSLSSANYNSLSQ
                     SQAGNTIIIFWSKKEQNVNNKVSTVYLIDNKDNGYRARIVPSINQSFLDQTQQISDNS
                     SFGVYPISNVVSLNGIDDILVYLNSNNANFKALSLFKFSSDRAIERLIIDNNYQDPVA
                     TRTSYLGSGELLLNPENDDLFTFTVQELIEPYRGDFKIKDQYIDKFIKYTPGINNPRP
                     DLVLLIKNDNLDLKTQSFRMESIVKNPLVNNYFETVPGLDFKYRYFGFGANPTWVFSF
                     IVISSTVFFVPLVWLGIIFILRFYGFSVGDYIKIQKRKQNNKKILSAFKATIDDAGAS
                     DLISNNKNQSLVEKQYSELMNMIDLARYRHIKQQQEIYIYESSVVSKNDNDDLGIRLL
                     KTKLQLLQRYFIDQGIKCYRYNLKDHKEVFLNNPKLIIHLKNTDFKLPVIMEHNDILH
                     YGSYPTNKELTSLFEINLNLLKKIDALTWQIVHSKNSYSFYNSPKFSNAYVEQMARKN
                     VRPPQKG"
     gene            695065..695958
                     /locus_tag="MGF_RS02875"
                     /old_locus_tag="MGF_4104"
     CDS             695065..695958
                     /locus_tag="MGF_RS02875"
                     /old_locus_tag="MGF_4104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="HAD family hydrolase"
                     /protein_id="WP_014574693.1"
                     /db_xref="GI:504387591"
                     /translation="MSLRNTKFVYTDLDDTIITSKKDAKFLYKGQHYKDLFDVPPEVV
                     QAFQKLIEQGIYTGIATGRDYRKVYPLLTQTNMFNLPTITDDGACVYINNKCVKASYI
                     DKSVIDRLIVLAKKFKNISYSINTPFGVYVSKNKSWWTLQDEFFNEKYHNEMFKLRYV
                     DLSKVSNFYNDEITAITISTRPIALKPLNQREIDFFIDLNNYGNVTVTKYKQDVVIRP
                     NESKASGIFWVKNNFNNKITKDNTVCFGDNHNDVDLFKWSNLSVAVNNAKDVYKTFAK
                     YQADNCENLGVAKFINQFLLK"
     gene            695971..696666
                     /locus_tag="MGF_RS02880"
                     /old_locus_tag="MGF_4109"
     CDS             695971..696666
                     /locus_tag="MGF_RS02880"
                     /old_locus_tag="MGF_4109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574694.1"
                     /db_xref="GI:504387592"
                     /translation="MTKEDYQLVDLHLHSHHSRHAGEKQTPKSAYSTDYYLTQLKKHN
                     VGAFSFTDHDVFSELFYLELKGLIERINDRKIAIFPGVEFRIRSTNPKADCNFIFNND
                     LDLARLEKLKLLVRELQNKQGADLNLLVKEFKEAEFDFFIIPDVGKSGKCSFEDFENV
                     LADVRYVEVNQGKENRLSKAIKSRLNNDYKQVFFSDCHDIKKYDKYCSKTKIKIPKDQ
                     LITFEDLKTQLYL"
     gene            696739..698430
                     /locus_tag="MGF_RS02885"
                     /old_locus_tag="MGF_4112"
     CDS             696739..698430
                     /locus_tag="MGF_RS02885"
                     /old_locus_tag="MGF_4112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574695.1"
                     /db_xref="GI:504387593"
                     /translation="MINNEKKYIKQLVLSNSSSEHILQFLPGVNVIIGTKGGGKSTLL
                     KILYGLHANYSNYDSDIDQIAKTFGFNVDKLVYSNGDIKRWRDKRTKYPKDEQRNDII
                     IQDDKIKKELDTAATFKKEKNRFLEKSCKMVAKDLSIFFDGYFKTFHELNQLLKNLNE
                     LNIHDLFQLKNDRNKRLLEQIQKLLVNSLNRTQEKNNKWVIKVHTDLYSILRHYLNKV
                     IQHKPRSGEIELISNQDYEKIIETVLSLLKLHTRSIFDKSLDNIKYDAVTNTIKDYEQ
                     YLKDSQETDRRIGSFSSALEEKFKSIARVLANNFAYFDNFLDQKFSKIPIKNKAKSEN
                     DPDIQFEIDLEYDLGETSEEDPPLYKIFSKCLYKPSVFTDKVKWLNNFLQKGGFKDNK
                     YDLDDDEILLQTLEKYFEENLQNKITVLLDGKDYEKLSLGTRSSYGVSRVIKNCQSSI
                     LFLDQPEDNIDSYTIAKTLIPAIKENDKIGQVFIITHNSNTGILTDPQTTTVCSFRTN
                     DIQNSYRQSNLTDKLEIIEDEVVNENASAHYLEGGIQALEERHSILVNKKRRWWK"
     gene            698418..698795
                     /locus_tag="MGF_RS02890"
                     /old_locus_tag="MGF_4121"
     CDS             698418..698795
                     /locus_tag="MGF_RS02890"
                     /old_locus_tag="MGF_4121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574696.1"
                     /db_xref="GI:504387594"
                     /translation="MMKIMYKLLFKKSEKDYHVNLVAIEKPDHVLLSFVFSEEGERPD
                     FDEGLIKLASYIKQDRNNDYNFHLEVEPLNEEQENDIIFKTLYTVFTKFVESFKTEYK
                     MTRDKLEKEFIEITKKPLFNFNN"
     gene            698800..699291
                     /locus_tag="MGF_RS02895"
                     /old_locus_tag="MGF_4125"
     CDS             698800..699291
                     /locus_tag="MGF_RS02895"
                     /old_locus_tag="MGF_4125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="flavodoxin"
                     /protein_id="WP_014574697.1"
                     /db_xref="GI:504387595"
                     /translation="MKKNTIVLSCSNSDVSKSLNYDLATKIAKLGSFDFINLADYNVD
                     HISSDTVEKVPAKISELNEKLLPYEKMIFVTPEINGYMPGFAKNILDWLSINKNWLGN
                     KKAYIVAATPGAKAAPMVRAILTDVLGFFGAQVVGSYGFGEYQLNQDRSKEIQEFLNT
                     VNE"
     gene            complement(699462..699623)
                     /locus_tag="MGF_RS02900"
                     /old_locus_tag="MGF_4129"
     CDS             complement(699462..699623)
                     /locus_tag="MGF_RS02900"
                     /old_locus_tag="MGF_4129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014574698.1"
                     /db_xref="GI:504387596"
                     /translation="MNMFIDVFKLITITTKTVNGKAVSEIKNNLDPEHKELNKIYSDF
                     QYAVDGLSL"
     gene            complement(699680..700939)
                     /locus_tag="MGF_RS02905"
                     /old_locus_tag="MGF_4139"
     CDS             complement(699680..700939)
                     /locus_tag="MGF_RS02905"
                     /old_locus_tag="MGF_4139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014574699.1"
                     /db_xref="GI:504387597"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LVDGEHVGKLELLRENADNDENVYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIP
                     KYQRIIHDKFILDVLSLASTRLSNNEIADQITSMYGFKVSPSVISNCIQTVQDEMRDW
                     HERPLENNYPIIMIDGKVFKIKTEESGRSKYVNKTLYVVVGINADGQKELIALYVSNT
                     ESATEWMNILDNLKERGLSEACIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAK
                     YVSHSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGCSNKRAVEVVERAMDNIEKL
                     FSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLN
                     QKSNRVRNWYRIYEELMDVFPNLLKKN"
     gene            complement(701301..703232)
                     /locus_tag="MGF_RS02910"
                     /old_locus_tag="MGF_4148"
     CDS             complement(701301..703232)
                     /locus_tag="MGF_RS02910"
                     /old_locus_tag="MGF_4148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="methylase"
                     /protein_id="WP_014574701.1"
                     /db_xref="GI:504387599"
                     /translation="MKKSFNFNLFKYVSSVGISLIGSEAFKISSAIYIYKISGDFWLV
                     TLLYLLIQLPSIIIYIFSNKLVKILKDKTALLLTDILSAFFLLIVFIISIWFLTSNIF
                     SIILIVLSTILGTIHSYRFIHLKNVLYYLATDEKTLKSFNIGNSLATSIGLVLSPLMS
                     FYLYNYLQFYWLIVFNIITYLISGILYWSLKLNINSIEFSKKTISQEIKKTKLSSWIF
                     IFSFSILIGILLYPRQAGLIQFFAYIKDYSYNEWSFWFTLTMSISGLIATILLMILNH
                     FNKSKIKLHILMIVMLILATSWIFIEKLTTSSYVIFIYYFLINTIQQFIFSITLPTFY
                     SESYKLFNKKDFHKQNGWSLATRVIVSNLLIILFTFFNNKFSYYWAYLSYSLIILILS
                     TFIITTSLIIFKTNNINKFYSSKKTFKDYEEYTKNGLWNSEKNIIEKYFFDNTKELKI
                     YDIGCGLGRTTFELKKMFPNSKIEAIDINKIFINNCKKRNSDNSILFKHKNIIEKINE
                     KEKYDLILFSFNGLTNIIEEEEVRMALNNIYNLLKKGGKFIFTIHDMFSTEEYKNYWL
                     EKVKVYDLELFSEKKVLSNKENDIWVKNRFYTQEDMKKILSDEFNFKILEVSKRDEKL
                     EEEWVKKLSKPLLFYVTQK"
     gene            complement(703216..704847)
                     /locus_tag="MGF_RS02915"
                     /old_locus_tag="MGF_4151"
     CDS             complement(703216..704847)
                     /locus_tag="MGF_RS02915"
                     /old_locus_tag="MGF_4151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011283439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113502.1"
                     /db_xref="GI:499426038"
                     /translation="MIYRKILKFIDDLISEFNLLFSSNISLILKGSYILAKNNILKRS
                     INDLDFCFISDIRETDKQKFLQWIANRLPNSKFDDNLLITYIFDFKIEIVSLETINLS
                     FVNKNNNLKNIYDISVNYAILQKILSFAYIFSDDFKHDRNRKISELVNDLESVYKFNG
                     NLIKEITSWALLRKAINLNLFNTFFIYKHYNYDKYHIRYFKFKSIEKYLNTYIYSDIK
                     KIYKFMNKESKKIIIFLDLLLKNNSLIIKTIISSYEKPTLAGFEINFLTNDIDVRKDK
                     KNSIFFNILNNKKAVFISHLDEVGGIIVNGNIYNLGTMNWIDGIYNVYDKKSNFIFDI
                     NCNKKDNNIFSAEKNRKINRPTLFFSDKKSNSLDKNDIYQIFPSTKTIVDKVFIKSRN
                     SDNRMSVACILSLNSFSSINYIFTTREEILLQSSKENKNWIQKKKIKSIINIESSESD
                     QWDIEGILIRVSDTFTAVNLSLLEKLKKLCNKYSLPYHLYFGSGSTDITELQYDNSIT
                     IALPADKIHSYESNVLSKNIYYMLIFMELINEEIL"
     gene            complement(704851..705759)
                     /locus_tag="MGF_RS02920"
                     /old_locus_tag="MGF_4156"
     CDS             complement(704851..705759)
                     /locus_tag="MGF_RS02920"
                     /old_locus_tag="MGF_4156"
                     /EC_number="6.1.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="asparagine ligase A"
                     /protein_id="WP_011884115.1"
                     /db_xref="GI:500213946"
                     /translation="MENNNVEIVNLPITTQSVTSPMGLGSDSKPYKVISKSNLNYEFY
                     LADSMQFHLELMLRAKDISSVGYITNTFRGEQVDNRHLHQFNHFEIEMLGNLNNCKEK
                     IIDYIKFIVNELIKKHKNLIDFFNTNNSNRLKKWLSNEVIDLKHDHVISLLKLEYPVG
                     IEKIYLNKNDFIESVNSKGEQYLINKFKNNIIWLSNFPWQLVPFYQKIEGDYAINSDL
                     LIGIGETVGSGQRCITYKETYDSILKHKNNPKHYDWYLKMKLESELETSGFGLGLERL
                     VLFIIDEKDIRNVQLLPRETDRELLP"
     gene            complement(706452..706793)
                     /locus_tag="MGF_RS02925"
     CDS             complement(706452..706793)
                     /locus_tag="MGF_RS02925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase domain-containing protein"
                     /protein_id="WP_011884113.1"
                     /db_xref="GI:500213944"
                     /translation="MVGINADGQKELIALYVSNTESATEWMNILDNLKERGLSETCII
                     VSDGLKFLKEAIENVYPKAMHITCTVHMIRNAAKYVSHSMKSDFLRDLKKHIWSRQLR
                     KCKTQLWIFKK"
     gene            complement(<706969..707367)
                     /locus_tag="MGF_RS02930"
     CDS             complement(<706969..707367)
                     /locus_tag="MGF_RS02930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883784.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_041594304.1"
                     /db_xref="GI:753838687"
                     /translation="MKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQALVDGEHV
                     GKLELLRENADNDENVYQNGSYTRNVKWGKEEIPIKMKRIRGENQDSQIIPKYQRIIH
                     DKFILDVLSLASTRLSNNEIADQITSIYGFK"
     gene            complement(707665..707781)
                     /locus_tag="MGF_RS02935"
                     /old_locus_tag="MGF_4170"
     CDS             complement(707665..707781)
                     /locus_tag="MGF_RS02935"
                     /old_locus_tag="MGF_4170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor G"
                     /protein_id="WP_011884110.1"
                     /db_xref="GI:500213941"
                     /translation="MTSGRGTYQMQFDHYEKCPNSIADPFIKRRNIQDKDED"
     gene            complement(707797..708358)
                     /locus_tag="MGF_RS02940"
                     /note="elongation factor G; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(708437..708772)
                     /locus_tag="MGF_RS02945"
                     /old_locus_tag="MGF_4179"
     CDS             complement(708437..708772)
                     /locus_tag="MGF_RS02945"
                     /old_locus_tag="MGF_4179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="signal peptidase I"
                     /protein_id="WP_011884106.1"
                     /db_xref="GI:500213937"
                     /translation="MLPLLKNGEWKLAFKYGPYNQKDIIIFEQNGVNVVKMIVGKEGD
                     KIIIKNNNLFINNNLINSLFMGNFGDDIELIVPKNHFFVLGTNLNFSDDSRVFGFINS
                     HQIIGKILF"
     gene            complement(708869..710434)
                     /locus_tag="MGF_RS02950"
                     /old_locus_tag="MGF_4184"
     CDS             complement(708869..710434)
                     /locus_tag="MGF_RS02950"
                     /old_locus_tag="MGF_4184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_011884104.1"
                     /db_xref="GI:500213935"
                     /translation="MSIYLNDIKNNLGKNNFWNKYKPLLKFSWAGIKRKIISFILIIF
                     LISSTSALLSNTYSLHNNSQFVSTKYFKETNSDFIELKYQTYSTNLIDIKKIDELNNR
                     IGNLSSTSYYSYYPESRIVALTNSDKILELNFDEIDNSSFWTNKLASMNIIGKASLDV
                     NEVIVWKKDAEKYNLDLYTNNELKIDNGIILKIVGIVDYDDMIDLSNYYSYIKNNEKI
                     NIFVSTETTKKISLEINKNSKFSFSILKHIDDENAIQIANSSMIDYDENLNDNEFTLI
                     SPVKKQLNIGEKYKINSDFHIDMDLVLNNFLIDKNSENTKIKFSKKTFENLKKIYSEY
                     ISGYPNSLLIYFNNAENLKKALNLLNDLAKEDPKIVIHTNFASLGKMIVENSKDTTKI
                     IFIFAISIFMISIIAVAIFSHLIVSSKSKEIALLKLLGLNSRQSLIYHLFSFIFVALV
                     SIVFSLLIMYPIYLIFTLLINNLALLKFNWLLNVTTLFIFWLAISFVSFLIYFFVSLR
                     KFYAKTNRLLKEK"
     gene            complement(710434..711090)
                     /locus_tag="MGF_RS02955"
                     /old_locus_tag="MGF_4186"
     CDS             complement(710434..711090)
                     /locus_tag="MGF_RS02955"
                     /old_locus_tag="MGF_4186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATPase"
                     /protein_id="WP_011884101.1"
                     /db_xref="GI:500213932"
                     /translation="MIKIFNLNKKINDKKIFSNINLEIPINKLTFIIGPSGVGKSTLL
                     NVLGGIDKEYDGTIEYNFNNISIDPSTLLKNNYVDFIFQDYNLFEDLSVEDNLVFPLN
                     FLGHDLSKEEIIKVINELDIKEIQLNEKVKNLSGGEKQRIAIARAILRKSEFILVDEP
                     TGNLDTKNSENIFKILSSLSKKRTIIVVSHDLEAAKKYGDYIYDLKNNELLENKPTNL
                     "
     gene            complement(711120..711755)
                     /locus_tag="MGF_RS02960"
                     /old_locus_tag="MGF_4191"
     CDS             complement(711120..711755)
                     /locus_tag="MGF_RS02960"
                     /old_locus_tag="MGF_4191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574704.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574704.1"
                     /db_xref="GI:504387602"
                     /translation="MKVIKMKSKFKKFLASFGILSTVIVVPSAIIASTVNMKEANAFF
                     GKKTEMIWIQKGQKHVDGNDYKTSHDGRVWARDYFWSSDEVFWRGVAEARVERVLFDS
                     TLPNRVVLGVETWVEGSGRPSVSSSIGISQSSGLETSLGISSNPTEKGRSFSYVFEDT
                     NTSSVHYSYSGRIWSWSYVGISTNALFKEKNKVIIVDSMTDNSYEYKKYVS"
     gene            complement(711742..713388)
                     /locus_tag="MGF_RS02965"
                     /old_locus_tag="MGF_4195"
     CDS             complement(711742..713388)
                     /locus_tag="MGF_RS02965"
                     /old_locus_tag="MGF_4195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574705.1"
                     /db_xref="GI:504387603"
                     /translation="MKKITKYLLWSIGSISASATLAGLTYYLLNRKKDSMYKIPVKDV
                     SNLEKINVLSNELSKKQAEILNNHLYSDEKMTIFYNRKIPKNIESHYYIVNLYKKSLF
                     QKNSIEKEMFKLFTFSDLSKVPIVIFDNYLYTFSFNENMKKESFINDIKSYLSKNLDD
                     KNNFFTIKNFGGITINDIANMNIKIYVALKEFGLKNILNEFDFLNKLNYLKNYLLKWI
                     RETKDESEIKRSLEFVLKIKLILNDKSLNSEEEKYLSEIENEILKEIESVENLSVSQL
                     EFIWEFLKIFKFYDFKTKEDIVVIIKNKYSNIFNNILNKMEPRYIFMFYTFFKDEFNS
                     IDNENKRMFFEKYLEKINVFYDWDFFIAYSYTLFKESDISLVEKSIDNYLDFILNKND
                     MFWDLNKLINLFFILKIKIENNLLFNKKDIIRNVLLNNLKQDKNIFNILLNVANLFLL
                     KKIDSNFEIEVSQSLIREIEKIINRNDIIEDIKFLILFKDLATFLDVEVNWKELSKKF
                     NFINKYNFLFNITSEEKDVLSNDIDNLFDLYSLIINNEGY"
     gene            complement(713399..713962)
                     /locus_tag="MGF_RS02970"
                     /old_locus_tag="MGF_4199"
     CDS             complement(713399..713962)
                     /locus_tag="MGF_RS02970"
                     /old_locus_tag="MGF_4199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hydrolase"
                     /protein_id="WP_041594417.1"
                     /db_xref="GI:753838800"
                     /translation="MFAKPINSDVLDNISKQFRASGAVALINFKDTEISYCSNEEIKK
                     QANFFYNLQFANNDFEIESKVFRMLIWHSESNVLRKLFKTWSEKYQSQIHITKLGAND
                     NFIEITDAKVSKGITKKLFATLINNSKVKTIHIGDSMNDSTAVGQLDEVILMKNGSEE
                     FKKLANIVSEFNNKDGGIINTFKKYCF"
     gene            complement(<714205..714915)
                     /locus_tag="MGF_RS02975"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(<715708..716038)
                     /locus_tag="MGF_RS02980"
                     /note="transposase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(716501..721228)
                     /locus_tag="MGF_RS02985"
                     /old_locus_tag="MGF_4239"
     CDS             complement(716501..721228)
                     /locus_tag="MGF_RS02985"
                     /old_locus_tag="MGF_4239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574710.1"
                     /db_xref="GI:504387608"
                     /translation="MKRKFKLLLALNASSIFVLTPLLTACVNRDAINEELKRLNANNF
                     DFNYPNKNQTYALDAKAEQFTTNSNDQIELVEPKIIQRVNQEAKATLQYRLKSLKTNL
                     NAEIISDILTKEISGFKQGLSLEELITNEKEKLNKTNFTFDYPDKENTFIEEARLEKI
                     QIKTNNNYQNVELKNLTHDLKTNSISFEYQIFMENFYGQKISSNVKKVTISGFKNKQS
                     FENQNSVDTFLASYTITENPLINQDLNIKLYSTSISEQNAPYFLNLVNDKEINLKIKN
                     IKIDDNNLNQISFTLVAQKGDYTKEEQRTFTFKNDVASLTNGLSFNSIEELYDVDYAF
                     LNSLAGNDLRNKTNLLNSAFSKKVEKLNNLFDYEINWQKSKNDITQVEKKVRDVNRQV
                     KNAKAFVLKWNLVVDVKLNGKTIKSFNNLKTADNRNQHDYFGGNYLYTYLLNDDFNVT
                     YKPSQYYLTNAKFNNNKTDEALLTYINNTAEEIKKTNKKYKDITTTGRYPTLNQNDAL
                     SRELFKEIVLKSFDFNLNGWQIEEVVSYLNNDTDKFNYFYFQPNNLVKLLLKLTKNNQ
                     VVYLPLIFNNFNYDISQLEDAFFVNLVTGNNISKILSQVKIKKNNDTHQNYLASKIYD
                     NLNDFYELPANGRYQIKFLTKDQTRLGLPNRPVQHFDDIKGEAIVQFGLFENGKYTGI
                     STLGYTLKYFKTIEESDFYPARNWFSANDFNDATKYTKPEANIINEIDKINSTNFIYN
                     FVQGSPNNQNDLRTRRTLDPRLLVEQKAFAQLNHLLTMVNNNSSQKQHDLIKNSTDLV
                     NNVNIDNLLKDYYVYYYDVNNPKENSLSFKLGFINKTNSNIRYSANKDITLENLYNDY
                     QLEAYPEALINNITLKNFNVKVDALKNQTSAILVNYFKTNKNINNNYFNLSEISYNNW
                     KLPNWNNLQIAEVKNIENRIFVRLKYSKYIFPQYVNRHKDILGDTWYEIGHFSDWTDD
                     NLTDEQILDFLSAQYNMKKVFLANGKILRQRKIKLNYKDNYFDLSNNKKEITWLFKKD
                     YYNPLLKQDKVTNAKINFEFFTNILYLDENRYKRVLDSQQNLNITLDWNELVKQKTLI
                     FKKETQSVNNIKIDFTLTFTLNEEGIHFSYKLSDDNDYLIVANNIAETLYYHQKTLPE
                     VKFDKNKAIYFNQNFGANINIQYQNEIENETFSKYQSNKFDYQNLSITPENMPFYIYN
                     EAYNHGELFKYNPNENLIYKWHEGYKPSVEFMHLSYDDQRIKDVNNRVLAFNNGSSLM
                     LGKVNKDKQDGKYYFITNNHVVNNNNTIETPWENAWKTNANFTLNGTNKHVISADDQK
                     GVDNANATSTPIFTFWTGYKQYNDDGEIHVDSKNKNKLAVLPDLSTYMIDVNNIINNL
                     KKQGKFSAALWFENLKKLPNLGISDYNKDNITYFLEMHKTVNKSPSFENKLNFSTNRL
                     ITGFPGYKQIGYIYNDSTIGTARESYQRTSVETSYAPIFFRGGLSGTGVVDDRGNYIT
                     SLNAASFYNFATSYYNYSVAWNNDKNKYEKFNWFGFAPNIEQLYKLANKNSLASTFLK
                     LSAWDSTIGIPEWVFNPKQLHKN"
     gene            complement(721404..721505)
                     /locus_tag="MGF_RS02990"
                     /old_locus_tag="MGF_4241"
     CDS             complement(721404..721505)
                     /locus_tag="MGF_RS02990"
                     /old_locus_tag="MGF_4241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor Ts (EF-Ts) domain protein"
                     /protein_id="WP_011884089.1"
                     /db_xref="GI:500213920"
                     /translation="MIDDSLTIEKLLSTQNSQLLDAVRYTVGEGIEK"
     gene            complement(721535..722374)
                     /locus_tag="MGF_RS02995"
                     /old_locus_tag="MGF_4245"
     CDS             complement(721535..722374)
                     /locus_tag="MGF_RS02995"
                     /old_locus_tag="MGF_4245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014574711.1"
                     /db_xref="GI:504387609"
                     /translation="MKIVKHTFFILIIVALIILVLFPLYYLIVLSLTSTNKITSGVTN
                     LLPDGFHYENYQGLFNEQFGLAFLLTFLSVLILIALKLTSTLLAAFGLNKLSNRLRKG
                     LFLFFLITSFIPEISIYLYLFSTLNQFGIINFNSLSFVLGLPMLFSFFMLMLFYNTIN
                     KEYEIKKNLMQIDRISPLQAFWSVYLPKLKVPIYLLIIFTTIEAWNSFLWPQLILSGR
                     VYQNNAPINTISTWFLKLGFVDRLDLINVRAAGAFISTLIPLSIYVIWSRIINRRMYK
                     MVS"
     gene            complement(722361..723320)
                     /locus_tag="MGF_RS03000"
                     /old_locus_tag="MGF_4248"
     CDS             complement(722361..723320)
                     /locus_tag="MGF_RS03000"
                     /old_locus_tag="MGF_4248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_014574712.1"
                     /db_xref="GI:504387610"
                     /translation="MQLDKNQKSKLKLKSNTIGLILLIPVILLLTLFTFLPIILSFIE
                     SFKVYARHSMVNYTFGIRNFTQLVSDSEFKDSFLNTNLLIFLGTPLVIFLAFILSLIF
                     SEISSKIFKNIAVVCLFSQFFTSAFAVGISFIYFFSTNNDGFNRLFNTRIRFTNDFDG
                     RNILIVYFIYYVWRLLPFNVVMMSFSFSSSLEKYSRVIKIDQLKFGHKVRYVYLKNFN
                     TVFWLVLYVNFANAGLFYPGAIVDSNLRLTKGNTLASYLYDHINPNENSSAQLNYALA
                     AAANIVIIAYLSLLSISFLIIKKTNFKQLFIKLKKKVKNHENS"
     gene            complement(723324..724472)
                     /locus_tag="MGF_RS03005"
                     /old_locus_tag="MGF_4253"
     CDS             complement(723324..724472)
                     /locus_tag="MGF_RS03005"
                     /old_locus_tag="MGF_4253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_011113488.1"
                     /db_xref="GI:499426024"
                     /translation="MSKTILKIEDLNVSYSKKVVLKEVNAQIYEGELVSILGPSGCGK
                     TTLLNTIAGFIKPKIGSIRFSDFSDNNDIELGFVFQNSILYDEISVYKNIYLSLINSF
                     NQYYSTYLDSYLQTNSIDQKKYDELKFLLKESLNNQKVKKHFRLKLFLINFALFFKKN
                     KTYFQFFKTLNSAIKNRIFDVATRLNIKDILSMKAANLSGGQRQRVAIAKSLIKDVKL
                     ILLDEPFASLDAKIKESSRDWLRKIQKEFNISMILVTHDQNDAMLISDRIMFINNNTI
                     AQFDRPEVIYNSPINLATAKFVGFPEIIKLANSENKYIRPSKLKIEKDPNSSIRITNI
                     QSMGAQEIIEFTSDQFVGSSKVIVNENQFQVNDQIKISFDEKNVMTLE"
     gene            complement(724490..726313)
                     /locus_tag="MGF_RS03010"
                     /old_locus_tag="MGF_4263"
     CDS             complement(724490..726313)
                     /locus_tag="MGF_RS03010"
                     /old_locus_tag="MGF_4263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574713.1"
                     /db_xref="GI:504387611"
                     /translation="MKLIKKLSFALLATGLSSLVVTSCNLPFVSARKPEKIVLFQSAQ
                     NSTFPLDRIMHSLVDKYNTDHKDDPDFLKVVYQNADITQTTSEFNLANSVATRIRAGA
                     DNIPSVILGSISAPYLINQFERLLDVSTDSFFSSQPIINEINEITKNIIGVNHITQNA
                     LPFDLTDLDALYFNKPVMQRLFALFKQGGGKINENSKIYNQLQTQTVLSANNFWSTVA
                     LKNNEVFKDKTINDSTFDNLESIFKFSSMIYGGLNLTNVSPDTDQSILEIDYDRNLLT
                     KYIWSKLGNSEKDFLWNLKAEANNPRDLVVNFDNLKKQKTIDTTKKAIQFWYDNIHVS
                     RSTNDKDIRSIKLNNSGRYGFSFNDIRDSNAAFAIGPTVTLAQATISKYSIDTFISNK
                     ENKTDEQIIQEAERKFTHPNDIYWAPQLTRMDDSDKKTYQIGGSYLIPISSGDPGIDK
                     ATINFLKYLYSGNNGAVANPNDSVVARIENGSGYFVPLKTNISSSINEQRKTEFDNLA
                     TKYDFSKIDLARKVYVYKNQPQEWDSYYYTQAGLITREGIDVLLNDPQNVSLVNVKND
                     SKTAKIFKFISDNVIGSAAYNAKVKTPDEIMNDIRAELRTN"
     gene            complement(726405..727943)
                     /locus_tag="MGF_RS03015"
                     /old_locus_tag="MGF_4275"
     CDS             complement(726405..727943)
                     /locus_tag="MGF_RS03015"
                     /old_locus_tag="MGF_4275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574714.1"
                     /db_xref="GI:504387612"
                     /translation="MKPKSLKKYKKALLWIFGSVGLISVLLSGIIYTSVKISNSLYQD
                     KQISGQNQPLDPVNRLIGFQTLAKFRIEDLDFELQKKIYSSTVESAELVNRSAVLVDD
                     SVLENHDGELTSGQSAPQVPAPVKILAKEQTGHTSDFVSGYSDDNNYCQSPYYYNDRV
                     YMPILDSPTIYLKNERTSRDIGLDNYQGWIALGHARVNSRVSVFNYRATDELLAKFNN
                     LPDRLIFTMSINLYQANPAIINETLKEYSPDFVILSNADSQTMKQLVFPSSVKKLTIK
                     SNILDRFDFSLVNSEIQELELYTPNLTEYNPLALNPKTHLIFDADYSTRFLSINLYGA
                     QLTNQQALAALEDVFVHRYYERALQGSFVGGYISSLVLSDTGITSLNNLVIKNINPNY
                     DSYTMSVKYHSNDSGQIELLKTTAWKTPTPTPTPTPTPTPDQAAAPGDGRVSVEDKDL
                     RLLVSSEVPVNAEVLINVVSKYLYNNTRVNILDISKSLLKSGSLVDVANSLKAKIPYL
                     NVVI"
     gene            complement(728085..729212)
                     /locus_tag="MGF_RS03020"
                     /old_locus_tag="MGF_4278"
     CDS             complement(728085..729212)
                     /locus_tag="MGF_RS03020"
                     /old_locus_tag="MGF_4278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574715.1"
                     /db_xref="GI:504387613"
                     /translation="MNNAYKTNFNLVVSENKVFRYDMIKVQANQIVGSCYVNNYQQLF
                     ELTINCSYQTDNINAYVDQFYLVLRDESLYDDLKMILAIWKQKAPLIDNIGFMINDKM
                     IYQANNHPCAWYYVYIKNQLMKLIVTRSRWDDVNDNTSYRSQYQNLDQINPSYQPNKL
                     KAEYEATKKQKERLLQYEKQDQPVLNKEEYREKKVKPNQYPSENNLRTFNQNQVDDFN
                     LFDDRDQLGSIKNSSFSHQADLKSYNNYLTNDDFNSSNNYLNDFEAKFHDSNLRVAKL
                     GSSGFNDSLASLKQRMDDIDQQIGNYESITRELSDLANSNSFNFDYNNHSNTSTLGIN
                     DFGLNSSSSISSTSGLKDLNSYEFNESTKDMLLHHSEDFND"
     gene            complement(729205..729918)
                     /locus_tag="MGF_RS03025"
                     /old_locus_tag="MGF_4283"
     CDS             complement(729205..729918)
                     /locus_tag="MGF_RS03025"
                     /old_locus_tag="MGF_4283"
                     /EC_number="2.7.7.60"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase"
                     /protein_id="WP_014574716.1"
                     /db_xref="GI:504387614"
                     /translation="MITVKMIAKTVGIILASGSSSRLGLTDQLKQFYLVNNKMVYEYS
                     LDQFLASNLFDLIYLVVNEQHLEMIKTKHSDNHLIKVIAGSKINRHLSFIHAINDMIA
                     CDYNDQTKIVVHDSARPNINQSILSDCLNALDDYQCVSLYQDIASSLIKIDQINQSQD
                     HLDRDQIKMIYTPQATWLKTVKDLVDDQQNHLDLTDFLLKLKGVKAHWIKTKIDCFKI
                     TTLADLEHFKLLVNNRKDE"
     gene            complement(729893..730369)
                     /locus_tag="MGF_RS03030"
                     /old_locus_tag="MGF_4285"
     CDS             complement(729893..730369)
                     /locus_tag="MGF_RS03030"
                     /old_locus_tag="MGF_4285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574717.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574717.1"
                     /db_xref="GI:504387615"
                     /translation="MIDYKDIIINYLTKHNWTIGIMESHSNGIITNALLLDHQLDRLF
                     KGAMIFKNPESINLFLKNNRHSEIDPNQVWSTDLHNYLSEAASEYFAADLVINFVHFD
                     QEKTKQLVFSLIIKDRIIVHNVDLSKYQSDKYLQPVCILVLKKLVEELVDYRENDC"
     gene            complement(730376..731074)
                     /locus_tag="MGF_RS03035"
                     /old_locus_tag="MGF_4290"
     CDS             complement(730376..731074)
                     /locus_tag="MGF_RS03035"
                     /old_locus_tag="MGF_4290"
                     /EC_number="2.7.8.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="WP_014574718.1"
                     /db_xref="GI:504387616"
                     /translation="MTTSAMRFRSRVFMANLIFRNIPNILTTIRIIILIPILVLFYFS
                     LSDQKTIYQIHFFNLATLKINLYFLIIGILFVVASFSDFLDGYLARKYQLISNYGKVF
                     DPIADKLLINAVLIYFAYLGVVNFYLVILLILRDIYVDGLRVFVSTKKIVVPANIFGK
                     LKTVAQMVAIIITFFVAGQFVLTNTIANQIFNLAYYLATFFSLLSGGIYSYQIYQKYQ
                     MMVKQTNTEHTPTS"
     gene            complement(731016..732386)
                     /locus_tag="MGF_RS03040"
                     /old_locus_tag="MGF_4297"
     CDS             complement(731016..732386)
                     /locus_tag="MGF_RS03040"
                     /old_locus_tag="MGF_4297"
                     /EC_number="6.1.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="WP_014574719.1"
                     /db_xref="GI:504387617"
                     /translation="MQLIEIKELLLSHSKREGEQVVLVGSFKSIRSSGAIGFIAFSDS
                     TALEPVQIVFKKENTPNFDEISKLPISSMILVKGVVRNTPGKKQPFEIQASKIVVLKE
                     ADPSYPLQKKAHGSEFLRENAHLRVRTNKFYVIMKIRSELANAFFEFFKNNDFLYVHA
                     PLITSNDSEGAGESFEVISPNDQNYFGKKASLTVSGQFAAEAYAQGFKRVFTFGPTFR
                     AEKSHTSKHLSEFWMIEPEVSLMDLDKLTILIEQCVKHAIYYLFDYAKPELEWCNENL
                     EPGLIDKLNNVINNDFPRVEYREVIEILKKAVAEGVEFEVKDIHFGMDLKSEHERYIC
                     EKVFKRPVFVINYPKDVKAFYMKLNDDNQTVAATDLLAPGIGEICGGSQREDSYNKLL
                     TRCLELDIDPEFNNLQWYLDLRKYGYYRSAGFGLGFERLLMYVTGCDNIRDAIPFPRF
                     HGQLDF"
     gene            complement(732534..735323)
                     /locus_tag="MGF_RS03045"
                     /old_locus_tag="MGF_4316"
     CDS             complement(732534..735323)
                     /locus_tag="MGF_RS03045"
                     /old_locus_tag="MGF_4316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase"
                     /protein_id="WP_014574720.1"
                     /db_xref="GI:504387618"
                     /translation="MSDKKIGLSSSEALERYQKDGPNVINIEKKKNYFLVFLAQFKDL
                     MIIILLIATVASFVVAILTGIKHNWDFNADNGTLKIELAQPFIIIFVIVVNSLIGTVQ
                     EIKSDQAVKSLNKLNLTKTKVYRDNKLVNVESTQIVVGDVIMLEAGDVIPADCKIIES
                     SNLYSNQSILTGESLPVKKYQYDNDDEANLPTIERNDHLFSGASITNGHALCEVIGIG
                     TNTEIGKISSLVNKQKKQLSPLQIKLEKLSKVFGYSGIVLFIIAFIIQIILNGVGNIE
                     STWPAALAAAISLAVAAVPEGLSTFVSIILALGVKNIAKQKAIVKKLSSIETLGSAAI
                     ICSDKTGTITKNQMTVVGLWTKDSEGVKQLTDEHKKLLINSILCSTAKINFDEHNKMV
                     EVGDPTETALIRFGLENQFYQAKDYAHYQIKVHPFDSVKKMMSVQIFDENKNTGILIV
                     KGALESLLKISNNQNHDQFINQTKLYADQSYRTLVVGTKPINKLYYDFLEIENDLELQ
                     GIIALIDPPREEVIHSVNSAKAAGIKPIMITGDDLNTAKAIAKQVNIYNEKTDLAISS
                     KELNEIDDETLKRDIEKYSVYARMSPKDKMRIIDAWQANHQVVAMTGDGVNDAPALKK
                     ADIGCAMGITGTDVAKETADMIIVDDNFATIINSVESGRRIYQTIKKVIQNLLISSVA
                     ELLVFIIGLIVMVPIYRHIISTNAEIAIKLALINQTPAELFAKFSLLSAAQLLWINIL
                     THGFPAIALGIQKSKNDVMNVRPYYKYENLFARRMGIDLLWQSCFIALMSLAAYSIGI
                     NYAIYSDQIEIFKSFNKIGSSMGFIVLGIAASIHCLNLMSDRPIFLSSIRYYWLIYLS
                     ALFSVSLILLVALTGPIASVFRMDEQFVNRPDLVGISLGMGVGIIPAMEIFKLFINSR
                     THHRSVINEFKMITK"
     gene            complement(735426..737159)
                     /locus_tag="MGF_RS03050"
                     /old_locus_tag="MGF_4322"
     CDS             complement(735426..737159)
                     /locus_tag="MGF_RS03050"
                     /old_locus_tag="MGF_4322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574721.1"
                     /db_xref="GI:504387619"
                     /translation="MDKTTEQINKTEIKKQITNCCKELINLYSNWANQIKVLTDPKQI
                     HKLSLKFGKEIVLINQQISKLTITNGIKRPDYSKYTKPRINTINATLKKNLNKSNYDY
                     IFQNSSRFDFIQEEHKFKTKQALEKLEKNIHSQLITDDYRDKRSHIYLLDWYAKLFKT
                     PAAQLLKNKEFVKCFIESCIDYESCYELHFDQDNKPKNLEYATCADLNHKHKNVELVN
                     KKFNLVTDFCIFYTQKPIKKFYWNIIYKYLQEDAWIYGENNEVQLAKINELYNRYLNN
                     PINRQNLKIIGKTQKKVCEFNLINHSLLSSKEESEIQQFIQFFLIYQAKWHKKVSYLN
                     FEYILKKEMMDLVIQEIDLNKLDYLVIYLDNLNGINFLYEKVWQIVDFLKTVNKNLNN
                     GSKAKIIFFNNIDANKIISRLKRWNPQYDFAELKQAINELFFDNKNIVNFAFTKTQNS
                     NKNEVVNNEVQNQDINKISGENALLELKELLNQHELFFNELQNLIDNHKELELTKMQL
                     TKYVNYAVKLIREISSFLSNVKINPIDVQRNEQIWKKIKLIYQLGHLDKNLSGKVGEA
                     IYDSLFGYYFT"
     gene            complement(737177..738325)
                     /locus_tag="MGF_RS03055"
                     /old_locus_tag="MGF_4328"
     CDS             complement(737177..738325)
                     /locus_tag="MGF_RS03055"
                     /old_locus_tag="MGF_4328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="replication initiation/membrane attachment
                     protein DnaB"
                     /protein_id="WP_011113478.1"
                     /db_xref="GI:499426014"
                     /translation="MSMVDYEELYEIHKMNGGVSDFGLITNVYIHILGPQATMFYIWL
                     LNDHQIYLNERWKKNNLPLSRILTSLNISKKQLIDFRNLLEGMSLIKTYKEEKTLEKQ
                     LIYKFCLAKMLDWDSLVSQEEIKNRIIAKIGHEEYFRLSSLYSNKNIGGSNVNVSSTF
                     HQVYKSNNNTDQISHIVKPTKTLVDIDNLNFGHFEFSPETKTALVNLCERYNPTEAEI
                     KNIISTTDDINDTFELTRAITNYTKEIDQVEDDSIPKNMARNESFYSTFCPSDLEIKI
                     LREYRTMNSEKYLRGIYRRNLFAREVELVEKIKKEHDNREHIVNAILDFAAHFTLTDQ
                     IQFEYVEKISNTLKLKNISRLNDAVKFFRKTYYSKKNANIKFELQKRN"
     gene            complement(738517..739119)
                     /locus_tag="MGF_RS03060"
                     /old_locus_tag="MGF_4330"
     CDS             complement(738517..739119)
                     /locus_tag="MGF_RS03060"
                     /old_locus_tag="MGF_4330"
                     /EC_number="2.7.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_011113477.1"
                     /db_xref="GI:499426013"
                     /translation="MRNVKNRILVCLSGKSSSGKSMLINRLKQDGYYTINLDELIHQY
                     YQKNQSGYDFVVESFGLEYVDENQVNRKKLGQLVFANPDKLKLLSDFAGKIAKNHLKN
                     LDYHGLVVVEGAAIYNNQQRYLDIFDYFVLVERDEKLIQASILQKFAYLKDFDLKKWN
                     PIKENKEFKADLVIQNNGEIETAYQELLKFLKKISSQCEL"
     gene            complement(739100..739924)
                     /locus_tag="MGF_RS03065"
                     /old_locus_tag="MGF_4334"
     CDS             complement(739100..739924)
                     /locus_tag="MGF_RS03065"
                     /old_locus_tag="MGF_4334"
                     /EC_number="4.2.99.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="5-hydroxymethyluracil DNA glycosylase"
                     /protein_id="WP_014574722.1"
                     /db_xref="GI:504387620"
                     /translation="MPELPEVQTVINYLKTKIINQKINNVIVSALKVLKNATPKEFKK
                     FLVNEHFVDIKRIGKYIIFILSNNKVLVSHLRMEGKYKISQFKAKYDERHVLVRFILD
                     DFELHYHDTRRFGTFHIHSVLDYQDQDYLKKLAIDPTQQEWDWKYLKNNAQKSSRVIK
                     SVLLDQSVVAGIGNIYADEILFLSKINPAKKANELTDQQFKEISKNATKVLLKAIELN
                     GTTIFSYQFKENHAGSYQDYLNVHLQKDKPCKVCGNLVKKTKLNNRGTYYCAKCQK"
     gene            complement(739934..740800)
                     /locus_tag="MGF_RS03070"
                     /old_locus_tag="MGF_4340"
     CDS             complement(739934..740800)
                     /locus_tag="MGF_RS03070"
                     /old_locus_tag="MGF_4340"
                     /EC_number="3.1.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="5'-3' exonuclease"
                     /protein_id="WP_014574723.1"
                     /db_xref="GI:504387621"
                     /translation="MKSTKKALIIDGNSLVFRAFYATLSMYEYAIKNGIRPSNGIKTS
                     LKMINKILNSDQYDYALVAFDSKEKTDRAKIYEGYKATRKKPVEGLIEQLVALQDGFS
                     YLGLNVLSSPGIEADDLIGSFSALANKDQITCHIYTSDQDIFQLVNKYNVVYQFVKGV
                     SVFNQVHERNFQEHFHDLKPEDVIQYKALVGDSSDNIPGVKGIGEKTAVQLIKDYLNI
                     DNIYANLDQIKPSIKDKLVANKANCYLSKELATIRTDCLVDQDINNFKLKPLDQQNYF
                     AFCEYYKISHLD"
     gene            complement(740817..743888)
                     /locus_tag="MGF_RS03075"
                     /old_locus_tag="MGF_4355"
     CDS             complement(740817..743888)
                     /locus_tag="MGF_RS03075"
                     /old_locus_tag="MGF_4355"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_014574724.1"
                     /db_xref="GI:504387622"
                     /translation="MFVNLNTRSYYSLLSTNLSISEIIDFAVKNNQTHVCLTDLNVLY
                     GAVEFYNLAKKNHLIPIIGLEIFDHSTNSELVLIAKNNSGYLNLIKISSFASSNLDFD
                     LFKYLDENLFVIVKSGDFKWDHVNCLKKKELAFNFVNCYDLEKKVGLNVINAVSMKQA
                     GKRSKFQIDELYNSQLVLASPFLSTEKAKKQFSQKQLDKLNDLVQQCSGWDLDNLTKN
                     SIIKYHTPKEFDSDQYLVELCQTRFNDLLNKRLIRASDQKRLNYELAIIKKLNFSDYF
                     LFVYDFINHAKQQGIVIGPGRGSAAGSFISYLLNITTINPISYGLIFERFLNPQRKSM
                     PDIDVDIMDSRREEVVDYLFNKYSKDNVAHIITFQRIKVKNAIRDVCRVLDLKTSETD
                     EVINFVSYDEISDWEKNQNATALKKVLNCNECDLDQKKCKRSGAVSCYVISKIFDLAQ
                     TIFNVPRQTGLHAAGVVCGNDALTQTIPLQYLNNRSVSQFSMEYLEQFGLMKIDLLGL
                     KTLTIIDEINSLVKLNYDRDFDINNIPLNNKNTFNLLKKGYTKGVFQLESLGMQNVLK
                     KVLPESIEDISIISALYRPGPQDNIDEYVKRRFSNTEFNYLSEDLIEILKPTHGIIIY
                     QEQVINTAMVVANFDAAQADSFRRAISKKDEALLLKDKKAFIEQAIKNRYSEQKALEI
                     FEYLHKFADYGFNHSHSLSYAFLAYQMAYLKANYPKEFYLILLKNNVDSKVKLTDYFI
                     EIIERNIGIIKPNINLSDWSFSLSADHQKIILGFNMINGLGNENANKIVQARNNKQFE
                     GFIDCLINLAKNGITKSLFDKLVNVGVFDQFKLELSKKAMSALVKSYFDQNVGFKNDD
                     DLISYEEKKALVQSSLFFLTKEQPELFLNLSKDELIAENELADSLLKVSFEAIKKKVY
                     KPNIFKKEIAFLEKQIKDLKTVKQLKGALQKEVCSILVQIKKVELKNKIWRFTIFDGA
                     YEINAKVRDKKLSDYLTNFINQETKLIVRLDHDLFRGHDSYTILDVVDIFK"
     gene            complement(743895..744152)
                     /locus_tag="MGF_RS03080"
                     /old_locus_tag="MGF_4356"
     CDS             complement(743895..744152)
                     /locus_tag="MGF_RS03080"
                     /old_locus_tag="MGF_4356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884055.1"
                     /db_xref="GI:500213885"
                     /translation="MDSNNKKSKTIRFNTSSKDLEKFERVKLEDTKVFNMEDRLLQIE
                     LQEKIINLTAELENSTDKQARKELKQEIKELQKRLAKLSEQ"
     gene            complement(744282..745757)
                     /locus_tag="MGF_RS03085"
                     /old_locus_tag="MGF_4362"
     CDS             complement(744282..745757)
                     /locus_tag="MGF_RS03085"
                     /old_locus_tag="MGF_4362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="WP_014574725.1"
                     /db_xref="GI:504387623"
                     /translation="MKKYFKIINVTRRQLALFLVYLATLLFASAGIITIMTYGIAFPG
                     GNNFVIYNENFFKTSLILPLVFFVIFAISGLAILLTGKETYKFDHKLIYQTYKFKLIL
                     SSIEIIQAIVWVFFLGILIVYFYPIDKTISQVYQDQIASVDFANANIRSDLISFIKIN
                     NNFFADLKLSVLNYAATLPYFFNKDSFAFWNIIYFAFYIALFIPYLKLSLFKRNQRFL
                     ALVPFVSLFLNLRTFNNFSEQDELIIPNEVGLRWHQKILLSNKIAFQIKLTATVIYLS
                     IFYLLGVLVFAIFAAFSIIKDGPGYTLIASTTYLNAYSIDFLRNTSSEVVLLRTLRSV
                     SSHIMMITFIVFSMGIILDDNPYVFSKVIRKSKLRLSLTLIAIELAQWSFLILVYLFY
                     SRNGALIIGREEPMTVFGIITTSAKADQTGIIYSARDTFVTTNLFFVALYMSWFLIYA
                     KAGIFSKRTRLLMYLPFATLFFVNKHVLKTNQKEQIKINVN"
     gene            complement(746094..746198)
                     /locus_tag="MGF_RS03090"
                     /old_locus_tag="MGF_r04"
     rRNA            complement(746094..746198)
                     /locus_tag="MGF_RS03090"
                     /old_locus_tag="MGF_r04"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(746268..749180)
                     /locus_tag="MGF_RS03095"
                     /old_locus_tag="MGF_r05"
     rRNA            complement(746268..749180)
                     /locus_tag="MGF_RS03095"
                     /old_locus_tag="MGF_r05"
                     /product="23S ribosomal RNA"
     gene            complement(749823..751368)
                     /locus_tag="MGF_RS03100"
                     /old_locus_tag="MGF_r06"
     rRNA            complement(749823..751368)
                     /locus_tag="MGF_RS03100"
                     /old_locus_tag="MGF_r06"
                     /product="16S ribosomal RNA"
     gene            complement(751476..753224)
                     /locus_tag="MGF_RS03105"
                     /old_locus_tag="MGF_4433"
     CDS             complement(751476..753224)
                     /locus_tag="MGF_RS03105"
                     /old_locus_tag="MGF_4433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574726.1"
                     /db_xref="GI:504387624"
                     /translation="MPLNTNNEKLTSKNVLNDRITKRFNDRRLFIVLLRFIIPSILVS
                     FFAALYIFVDQIMIVKFVTRSDLNPDSIFDNDYFNFVDSNGQSWTYQDYLTASNDLKI
                     PPFNINDLIRAAISISAPITVIINALTLLITMGLANQFSKALGRGDEEKIKEVWATGF
                     ITNVIVSIATSMIIVGVAKTWLTSSANGTMNRPLESLDTNSRDGYIISIFFARFRELQ
                     VQNASSYVYILAGLFTIQTFNQMYFLLNQSEGRQLFISIIPPLANLINILFDYLLIRY
                     TSAGIAAAAYATVIGWSISCLAYVIYNIILIKKKATHLEYREIFRKGHFNWNCLYLII
                     LIGLASFFRNAALSVSNGIFQTNLVTVTQKIQPNLPPNYYQSIFGSVTPISNLMLQSV
                     WGLIHGSRSLCGFKFGQRNFKDITKIYWYVPLIAFSYSSIVYLLFGFGLNNIFLINLF
                     NIQGADNLVVANLVLRITLVQSIFIALSMNAQLLFQSTQRIGMAWIASLMQGLFTFAP
                     VFFTMYNLAIDTNNIYLYIWIQPINTILTCIGNWIISIPFAHKYREFVSKRFDIGTIF
                     DKYLNKTKNPKIKTKQ"
     gene            complement(753208..753843)
                     /locus_tag="MGF_RS03110"
                     /old_locus_tag="MGF_4437"
     CDS             complement(753208..753843)
                     /locus_tag="MGF_RS03110"
                     /old_locus_tag="MGF_4437"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA-binding protein"
                     /protein_id="WP_014574727.1"
                     /db_xref="GI:504387625"
                     /translation="MQVTLYYSLENLQDTMIGYIKDPSTIKSKRNLGKVIYFYDENDQ
                     IVSFNILNVSKDEKLFLSIKNNGLVFLNEELKKHLLSEYLTGFESLESPFVIGQVIKV
                     NPIPNTHLNHCLVDIAKEQPLSIVCGGSNVSEGIKVVVVKVDGFINTGKHIKRSELFN
                     LESSGMICSENELGLTDLVNGDRKILVLDHDLVVGKEFQTDNIQQVDALKY"
     gene            complement(753846..754769)
                     /locus_tag="MGF_RS03115"
                     /old_locus_tag="MGF_4440"
     CDS             complement(753846..754769)
                     /locus_tag="MGF_RS03115"
                     /old_locus_tag="MGF_4440"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594418.1"
                     /db_xref="GI:753838801"
                     /translation="MFLSFVYREYCKEVLILKKIAFIIDSSANILADESNDIYLVPLN
                     IIETRNSDEKVYNASTGINLETLNEKIKGGSKFKTSQSSIGLLHQAVEELTKKYDYVI
                     GFPISEKLSSNYATWKSLETEFKDKFFVFNLGSVEVGIVWFLELIRDFLKAKKNELDP
                     KELETFITKKKKNFGGVLVVSDVSQLIAGGRLKGFKAVFVKTLKLKLLISMMPANGGL
                     EYFDKTKTDLAAKKELINFLEQKVNLISKKIKKAAVITTILDPKEREKVVHEFQSLLK
                     DKVVVEEAMFSPVIAIHTGFSNYALLVEMED"
     gene            complement(754809..755993)
                     /gene="tuf"
                     /locus_tag="MGF_RS03120"
                     /old_locus_tag="MGF_4446"
     CDS             complement(754809..755993)
                     /gene="tuf"
                     /locus_tag="MGF_RS03120"
                     /old_locus_tag="MGF_4446"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P18906.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor Tu"
                     /protein_id="WP_011113468.1"
                     /db_xref="GI:499426004"
                     /translation="MAKERFDRSKPHVNIGTIGHIDHGKTTLTAAICTVLSKAGTSEA
                     KKYDEIDAAPEEKARGITINTAHVEYATQNRHYAHVDCPGHADYVKNMITGAAQMDGG
                     ILVVSATDGPMPQTREHILLARQVGVPKMVVFLNKCDVADDPEMQELVEMEVRDLLKS
                     YGFDGDNTPVIRGSALGALNGEPAWEEKIHELMKAVDEYIPTPDREVDKPFLLPIEDT
                     MTITGRGTVVTGRVERGQLKVGEEVEIVGITDTRKVVVTGIEMFRKELDAAMAGDNAG
                     ILLRGVDRKDVQRGQVLAKPGSITPHKKFRAEIYALKKDEGGRHTAFLNGYRPQFYFR
                     TTDVTGSIQLKEGTEMVMPGDNTEIIVELISSIACEKGSKFSIREGGRTVGAGTVVEV
                     LE"
     gene            complement(756185..756259)
                     /locus_tag="MGF_RS03125"
                     /old_locus_tag="MGF_tRNA30"
     tRNA            complement(756185..756259)
                     /locus_tag="MGF_RS03125"
                     /old_locus_tag="MGF_tRNA30"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(756225..756227),aa:Trp,seq:tca)
     gene            complement(756266..756499)
                     /locus_tag="MGF_RS03130"
                     /old_locus_tag="MGF_4449"
     CDS             complement(756266..756499)
                     /locus_tag="MGF_RS03130"
                     /old_locus_tag="MGF_4449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113467.1"
                     /note="carries the fatty acid chain in fatty acid
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="acyl carrier protein"
                     /protein_id="WP_011113467.1"
                     /db_xref="GI:499426003"
                     /translation="MEILSVINNIAKKKKMAVTINDSNINKSYKELGIDSLDLFDIIV
                     ELESEFNIEFSDEKLMKIKTINDLILYIKELKK"
     gene            complement(756542..757141)
                     /locus_tag="MGF_RS03135"
                     /old_locus_tag="MGF_4455"
     CDS             complement(756542..757141)
                     /locus_tag="MGF_RS03135"
                     /old_locus_tag="MGF_4455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884047.1"
                     /db_xref="GI:500213877"
                     /translation="MNRIYKKITIGLLSSFLFFGTIGLAVATYFSSTKTTKKDEKNFD
                     DKSISDPSADLQNDLLPSLKKYPLEYQVDSSKYYYYYVSIHQYLYKTSELDNLINYRD
                     YLYQNNHDRPFSGFDLNLFKKNIKKWIYQAIRSTQMFRNNNDDIFIDVDYYIENPSRS
                     ISINVVWSFKKPTTYQNKTVKYWDQFVLKVRDKVFVNNE"
     gene            complement(757141..758223)
                     /locus_tag="MGF_RS03140"
                     /old_locus_tag="MGF_4463"
     CDS             complement(757141..758223)
                     /locus_tag="MGF_RS03140"
                     /old_locus_tag="MGF_4463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884045.1"
                     /db_xref="GI:500213875"
                     /translation="MLISYNIDSNNNSKPIVINKEGWWWRLNPLRNKDGTIVIDKNGN
                     PIYFRALLSFQNAWSDQNNFNLYFEILFENNSILPPNTIQSNLFIAGNVYPSVFSEIT
                     NEETDGYQKAQIKVSVPLEKLTKERFEEGIDIPVVIDLYLQNDILEGIRDSLESNALR
                     LLLENLKDARLVSKIKLNNFLFFRDRVGNRDIDADYEDQEKKAISWYQPNYSFLSNLD
                     QIRDLLTINVDTVVTIFKSRIVFDYSTTANGSTKSLVIENTNQITYPPNTDIKLALDS
                     NYIYDTNQDQIINRGINNHYFFLPKGGEGSYTTQLSLLINKVKYEIESANSFGYFAWL
                     DDQSRLDFIDILPKVIKSIGSYSFVE"
     gene            complement(758227..758553)
                     /locus_tag="MGF_RS03145"
                     /old_locus_tag="MGF_4466"
     CDS             complement(758227..758553)
                     /locus_tag="MGF_RS03145"
                     /old_locus_tag="MGF_4466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884044.1"
                     /db_xref="GI:500213874"
                     /translation="MNRKIINDAKKYLERYDFYRKRIENRQIIKSVFNHDLGVDNQSE
                     MQSYVDLIDATLKRLKKDEKDILIDVFLKRKHRNEFNYSQASFYRLLNRACCSLFYSL
                     GVYIPN"
     gene            complement(758850..760274)
                     /locus_tag="MGF_RS03150"
                     /old_locus_tag="MGF_4476"
     CDS             complement(758850..760274)
                     /locus_tag="MGF_RS03150"
                     /old_locus_tag="MGF_4476"
                     /EC_number="6.1.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="prolyl-tRNA synthetase"
                     /protein_id="WP_014574729.1"
                     /db_xref="GI:504387627"
                     /translation="MAFKKNLASSKDDNISDWYTEVISKGNLIHYSNIKGFMSFLPNG
                     WKIWQLIKKELTKEFDQRDILELCLPSLISQNDFLLEKKHLEGFAPELFIVTKTSNET
                     EKYILRPTSEIAFCNLWRETLRNYRQLPIKHNQWTSVFRVEKNTRPFLRNSEFFWHEI
                     HSCFETEEQSNDFAVDIWKLYQRFIKDILCIPLVAGEKTEAEKFAGAKTTYTVETIMP
                     DGQALQSATSHNLSQNFSKAFDIRYQTKNNDYQNVFSMSAGVSTRIIGAIIMTHGDNE
                     GLVFPTKVAPYHISLNCIFDDTNQELNAKLKELANKYSQKYRVHLNLNKYSTVEIIKN
                     SQLRGDCCVLLMGPNDLKKNEIVFIDRISKQKQFINLDHLDQKLEELFSTFDQKLYQK
                     AKAVFETKVDFAQTFEEFEQKIASGKFVRVFYCNEDLYEKQIKEKTGASSRCIIKHLD
                     EQTQERCFISNKKAKVEIYFARSY"
     gene            complement(760420..762039)
                     /locus_tag="MGF_RS03155"
                     /old_locus_tag="MGF_4484"
     CDS             complement(760420..762039)
                     /locus_tag="MGF_RS03155"
                     /old_locus_tag="MGF_4484"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574730.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="WP_014574730.1"
                     /db_xref="GI:504387628"
                     /translation="MRLEKNMRQNKFFQLLKINKFTVFFTVFLFLCIISAIVIKLGIN
                     VHGLAVFKNNISNFFNQSAVNKSSLLTKSFEQLWITIKYTATGTFIGFILGFLLGYLS
                     SLRITNNFTAIFVKLGIIFFRSFPVVIFINLFNTSFNSDLSAIIIISWFSMLWNAKYI
                     ADYIENSKVEQFKKFVDRSQNHLSSFINNIFIDIKSKILVLFAYSLESNFRWTTILSA
                     VGLIGIGQLINDPISINNDFASTLIPLLVLMVFLLINEGALYLFETYLVARKSYPKTN
                     NLNKLLTIKKYLVYLIFILIIAFSIYSIFSIRLRVNNLLIFTDFFQRLFDFNKSFFAT
                     TTFNENPLLIIILLTLQAILILGIVFIFSLLFATLCSNLLNRYVSLFFKALFLIIRTI
                     PLIIVFRLFNPLFNSGISTIVFIGSLYFSTSLAKKIYVLINSINWTVVTSLKSKLYTN
                     FEILRVYIIPSIRKDLVTVYQLEFESILRTIITLGAYGTSVIGQLLDIYIYRGNIENL
                     GSYVISIMVYLQVIDLLSIMVRYKKFFYTNK"
     gene            complement(762008..762757)
                     /locus_tag="MGF_RS03160"
                     /old_locus_tag="MGF_4487"
     CDS             complement(762008..762757)
                     /locus_tag="MGF_RS03160"
                     /old_locus_tag="MGF_4487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA repair protein HhH-GPD"
                     /protein_id="WP_014574731.1"
                     /db_xref="GI:504387629"
                     /translation="MSNTNHIKFLDVSIKHKRYKGFNVDHINFELKGSEILMLIGKSG
                     SGKTTLLNSITDKKLVSQGEIVFNDQNLPSLSKHKIRKIAKFIGFLDQIPNLILDDYV
                     YENIIRSIRKPWYYKFFNITPISVLNKVEEVLKTLDLSDHINKLIKDLSGGQKQRVDI
                     AKIFFQKPKLLLIDEPTTGLDYLNSEIVIREIKKLSEQFKAPVIISIHDLEIVKKFAD
                     KILIIQNKKPILINNSADLNIDEIRKKYETE"
     gene            complement(762757..763857)
                     /locus_tag="MGF_RS03165"
                     /old_locus_tag="MGF_4496"
     CDS             complement(762757..763857)
                     /locus_tag="MGF_RS03165"
                     /old_locus_tag="MGF_4496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA repair protein HhH-GPD"
                     /protein_id="WP_014574732.1"
                     /db_xref="GI:504387630"
                     /translation="MSKTIKKLFLISSSFLLSSAFVSSCAKANDANNQGTLQLKVDLK
                     IDHDANAIINDYLKNLSQTVSQKLNKPVSITSNFTEDGNTSIDRVKSNLTDLAFVSSS
                     AIKTNDTDYITKIQTLTRSFKFDNTPDFYEAGTLDQKARKISELFNEIPYRNWTDENR
                     MWDGNKYQFFYGPEDDLISFYRGMILIGGDQDTLAKIKEAWAQKNWATFSSYGIGGGR
                     TSSNGRYIYPLNLLKKHFNDPNLTISDYQSVRGREIGTNPKVHIVFDDMNSFAWTQNK
                     NKNVPNYTFNPNDNNTKVEILSLTDPALYDIGVFNKRLTNDVINAVSESIVELAKNNQ
                     DRYGPTVGYNGYRVIKDVNKEVYQFINKANIN"
     gene            complement(765174..765247)
                     /locus_tag="MGF_RS03170"
                     /old_locus_tag="MGF_tRNA31"
     tRNA            complement(765174..765247)
                     /locus_tag="MGF_RS03170"
                     /old_locus_tag="MGF_tRNA31"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(765213..765215),aa:Trp,seq:cca)
     gene            complement(765262..766776)
                     /locus_tag="MGF_RS03175"
                     /old_locus_tag="MGF_4515"
     CDS             complement(765262..766776)
                     /locus_tag="MGF_RS03175"
                     /old_locus_tag="MGF_4515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884032.1"
                     /db_xref="GI:500213861"
                     /translation="MTPYQKEIFDYDDEGFVDSIFHNDETDRFDEDQQDDFGFDSRTN
                     RIKKNVNYDQHDLQTLDVSRNKNRFFDKLVRSTKTYNFIAIWLNLIFLITFVLAIVFF
                     YLNKFSFQQSESTYVSVNLFLTIALAAVSYFISLILYGFVKMHNKRIKYSLTEKALDY
                     YSIFKKLYISYFLLGWIPLVGVIISVGSHIALQNLDDSDVSDNNLWYQESISDLLIDM
                     NGYENSYRELESKKIYLDQELQRLNYEKQKLNAKKNELAIVSSNTLPNFKNSKQLLNY
                     VSNSEFLSASLVEQVKSAITQLREERRKLRRENRKLRALLSKANNIDEQPLLLTSSNN
                     LFNDREQESLFNLTDQPSRKNEGLNLENFSDRIDWISENLNNDRAIVEIGQTRKKTAQ
                     NLKSSAPKVVKKNNQPTYKVKMVNNKKEAEVGRNQEESDLTKQSNLLNFVNAMDLSQS
                     TLSLDNLFNIEADDEEETTSNKTPLTKPKTIKVKLSRTNKATKNPNVVKKVTIS"
     gene            complement(766845..770351)
                     /locus_tag="MGF_RS03180"
                     /old_locus_tag="MGF_4530"
     CDS             complement(766845..770351)
                     /locus_tag="MGF_RS03180"
                     /old_locus_tag="MGF_4530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574733.1"
                     /db_xref="GI:504387631"
                     /translation="MNQNKKNNLPKKPLVKNKGIDLDDFLSEEIAVLDNFHLTKPKKQ
                     QPLLLENKRAKKVSQPVVVKPGEKKAKAKKAKVVITDPRILKKRSPLLTIGVSLIGFG
                     VTGPLLSFAILNQIDKQTDQSAPITRPTDSPIDTLQSSSPQFTHDNSLPAFYNSYQLN
                     KQSEINGIDLSNQRTLHDLPIASFMIHNKLVRLLNQQLQFNYSWLYSDIAYLIRKTYD
                     ENKQAFIPLKTTNLQITKSSDNNPLHVYLTANFEFRNQTDSPQTFVFRYFNQRYEKQI
                     QPKGILNLKLSSLSASNDIDPLKDPDYIGSIDPVDLAPGYGYINAVVTKDLYHNYYLN
                     WNLSNLELSMNDSNYRFSNFVFNNNVPSMNILLKKTIPGKDPYQAASDLVGENKLLNR
                     DLTPEQISRNLKFYFSNEFHWQIEWFNLIHDVFKWLIVNNNTNKKLYQVLSDNAAVFA
                     KLFTYNFTKLSINYADQKNAILKLITDALSSNPTIVNAKNVYEVLYDNFDAFKLILNT
                     YFFDVSAYSNLINLLTKDVNSAFDFYQRLYESMPILRQLISNFPTKIKYFEIIERILG
                     YRDDAGNLIPIPRFNTYLINTIFESKRLLNDIYDQLLNISNVDFDMATADTNNGSQSW
                     SGFTPLFNFLFIQNRSTLVNLFTQSTNYFDDLITLFISNNFNFLFQLLKLFGINVNTL
                     NPFVKTALDLIFLKNPEILSRDNLKAKIINLFNWIIKSLDQTNINKIKFGLYKPENFD
                     NLVLIQSPTTLKVKKLDLGFKFDINGLQIPYGVLSALFEFLPNIKIVDFIKYIVDNKR
                     YEELKEKGYQQAINEGYSSLLNASGIFSFKWAGDPAKNFFSSVFDDIWKNRILKGVSD
                     NNRTIKDLANEIFSGTNNNDPNRAIATINGTGYFKWSGENVDILPFFNFLPSNTNQAQ
                     IVYQLYNVDQEKDFSQIYQNLKLHFPRYSYRQPGIQFSDLSKKIYQSISGVVDQTLNY
                     SLNRKYLTKTRIILPGDDGKKTNLTLQENNPYENVALFMYNANQSLINQYDRMNEQDK
                     RKLREQILMITDRRARVKGIDRDPKTRETSLLPQSLRMLGSLIQIKGVDPSLVIHTNW
                     SFSTISERIPLNLTTKVKFGLISKQVSINLAYETFLSAFSYQVLLPYPILDLSNPNNP
                     VFKLKEEISHLAFSLELFGAGE"
     gene            complement(770451..773462)
                     /locus_tag="MGF_RS03185"
                     /old_locus_tag="MGF_4545"
     CDS             complement(770451..773462)
                     /locus_tag="MGF_RS03185"
                     /old_locus_tag="MGF_4545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574734.1"
                     /db_xref="GI:504387632"
                     /translation="MKKKTKLLVTFGLSLSLIGTVAAGTGITLYKKQQEAEKELIRRQ
                     SDIHKASGSQPGKPIGQGVLDDEIAHQAEYKAQESNDSGLALINKPNLQNNPNLFVAS
                     HSIQRQLDALAARKVNDSNNQIIESDISSYLISLYDRNNKMFSFIKERLNIRSYNSAD
                     FLSLSIDTAYLIKNEAEEPKDLWINNRKLSINSKTTLELSIYTDRNPAFFKKAKAFLT
                     NDHKLNWSVDKIYFNLKSLNGAYSESWSLDNFVFNQTDSALNAKISHVKNGYSEYDAI
                     NNFVGTNKLLNNRLDQTVLKDSLRRNFEDKFNLAKKYAGYIYQFSKWVINHRTQAFNL
                     TNFIQDNAQTLTEIIIYGLQEGLKTNDVNQLKPLVLDLLISYSANKQSKTLYRIIIEY
                     KDQIIKFLTQNNLVNISAYQNLIDNFFNSIDQKDPIKAETEFRDKIVEFVPTIKELVK
                     EDSPFYPYIELLVKILSTPKPYFIDSIIKDPIVFQAILDFAYDRLVSAFDQPLKDLLI
                     NSKNAIYALLMDNNKRSFNELLIRFFIDDFRSIFGLLKTFNITFDFNNPTTKFFFDTF
                     ILNNNLVKGLIGLESIVGVVSDLLELISPQSLAKITLTPLKTNQTNNIQLISTANELK
                     VANLDYDYLLNLNHISIKNSTVRKILNLIPPYLNVQTILNQFITDKALNKAADQAVEE
                     AKKISGAGIAIYGVNNFKNEVLRNLRTFLTQIANVNVRQLITEMIYGNLTFNDKDDFI
                     NLNGSIKISIKGNNIQVLPYYTQVNQQTIFDYQLLGITKEIDLSHLVNNSKLLTETYT
                     NPRPLIPYQDLSKKLFAITRSFYQSLKGTLNNQPIRIIDNLVLKFGQKIILDQNNERN
                     RVVKNAYDPNLLIVDLSTKKGLEITKEDATKNWIVSDTNNIIIDSKVLNQFSNLIKPI
                     GIANRYLTQAIRPFSTGELKGSLAINFDLMVIFIKINIPITVNLSMEQRILGYDLLVP
                     YNVANDADPNNVKFINKVSKHWEDTIFNFGT"
     gene            complement(773575..777435)
                     /locus_tag="MGF_RS03190"
                     /old_locus_tag="MGF_4565"
     CDS             complement(773575..777435)
                     /locus_tag="MGF_RS03190"
                     /old_locus_tag="MGF_4565"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_011884029.1"
                     /db_xref="GI:500213858"
                     /translation="MDKLKKKNKNKRIRGLQISIASAEEMRSWSHGEVKKPETINYKS
                     LKPETDGLFDEAIFGPVKDFECACGKYKKIKHRGRTCEKCGVEITESIVRRERMGHID
                     LAVPVAHIWMTKELPSPSKISLVLDVSYKEVEEVVYFVNYIILNPGNSKNPVFKFKEV
                     VDLSGKGSKSARIKLRKVLREIKDKHQADKHSIVYKRASDYYNKLKESHLPFSIDEVA
                     KFIETHTGIRLGIGAEAILELLEGVDLQKEYDLINKELNSYSKDLKANKEDQKVKRAL
                     RRLETIKWLKESGIKASNMILKVIPVTPPDTRPIIQLDGARFTTSDINNFYRRIIIRN
                     ERLKKIIELRAPSVILNNEKRMLQEVVDALFDNASRKKPITAKDKRPLKSLTDRLKGK
                     QGLFRQNLLGKRVDYSGRSVIVIGPELKMYEVGIPAPMILKLFKPFIIRELIMRFNED
                     GQEIKPIAPNIKIAEQMIAQKSERIWDIVDKVIKERPVLLNRAPTLHRLGIQAFEPRI
                     VDGKAIRLHPLVTTAFNADFDGDQMAVHVPISKEAVAEARAIMLASWHILGPKDGKPV
                     ATPTQDMVLGNYYLTTEKRNEKGEGLIFSDFDQVILAYEAKQVSIHALIGLSTKCLTK
                     KPFAKQGIVITTVGKAIMNSIMPEEMAYLNDGDNLLELDESNIVFAGEDFKQKLAKRP
                     LYKPFGKKTLSKIIEILYKNFPLQKVPQVLDKIKEFGFKYSTLSSTTISVFDIPRYDN
                     KQEYITKANEMIAKLKHMYQKGLLTDDERYTKVIRLWADVKDNVSKDIKEIITRPEYK
                     ENSIVVIADSGARGNISNFTQLFGMRGLMSKSYNYDQKIKSQVIRDTIEVPIKHSFIE
                     GLTINEYFNSSYGARKGMTDIAMKTSKSGYMTRKLVDAAQEVIINDSDCNTNKGIVVS
                     TITNSLDGGIVETLSERIVTRYTIDPIYDEKTKELLVDADTLITSELAEKIAKANVTK
                     ALIRSPIYCQSTKGLCQKCFGNDLTTNDLVQIGTAIGVIAAQSIGEPGTQLTMRTFHT
                     GGTANEGNITQGFERLKQIFDVVSPKEWELATIAENEGVVESITSDATARIIRIKTRL
                     EAEEYRVPFDAVISVNPKDVVYPGSKLTEGSIDIKHLLRVAGIETVRQYFLEEVQKVY
                     RLQGIEIADKYVEVTIRQLTNKLQVIDVGDSDYFVGQTVDINKFRKEVTNMLTANKRP
                     PVAINQVFGLDEAPAKTGSFLSAASFQDTKKILTDAAVKNQIDYLVGLKENVILGNLI
                     PAGTGFMSSEEIIKAGEEALEKEY"
     gene            complement(777458..781630)
                     /locus_tag="MGF_RS03195"
                     /old_locus_tag="MGF_4587"
     CDS             complement(777458..781630)
                     /locus_tag="MGF_RS03195"
                     /old_locus_tag="MGF_4587"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011884028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_014574735.1"
                     /db_xref="GI:504387633"
                     /translation="MKKNSAFHNTQYSPKVVRRDYSKVHNKYNPLNLPGIQVNAYKQF
                     LEKELEEIIGSYFPIKSPNGKYSVEFHGMKILDPQITKEEASAESKTYDASLYVNLSL
                     VNHQTGTVKKISKKSAKSKAEGIYFADIPLMTENGAFIVNGIEKFVVAQIVRSPGAYI
                     LNKSQVKLSNSRKRNQEGYICEVFPSKGTLMLFYIAENKDFVQAVVRDVGGESAKVFS
                     ITTLLKAFGLSEIKIKEIFNNNDYILRSLESEFYNEKQILNEADIAQLIRDIESDRIS
                     KVKSLPIDQKWKNLVLDWYKLNQEKQELLNSSNPNPTKIESLNTHIGVVLRKLICEKA
                     AKHVIQELSISTRSLDNVSQKEEISYQSILLQHFFQKKRYDLSSAGRHKFVRKLRVSE
                     RLYQRTIAQDIKDLDGNVVIKQGTLMLKEQLDLFKRLSKEKRLDIIKQIDFINPELNT
                     QFTDVNTYEEVQIYVNNDLRNETTQIIGIDGSNESIETLTLADLISIVSYIVNLPFNI
                     GLYDDIDHLGNKRLKLINELLKSKVQTGMMRIEKYIKDKLQTADGNNKLADQDAENDP
                     DSDLGTKSSNDLTVKSVINPKPFQIVIKDFFNTHQLTQFLDQQNPLSELTNKRRISAM
                     GPGGISREDPNLDIRDVHYSHYGRICPIETPEGMNIGLIMSLAFYATIDKNGFLMTPY
                     LKVENGKITDKVEHLTALREDEYIIAEASSYMDVAKDGTINNEKIIARYRSSQDLYDP
                     KQVDYIDVSPKQVVSVAASLIPFLENDDSSRALMGANMQRQATPLLKPYSPLVGTGVE
                     YKIAQDSGMLVTAKNPGTVTYVDASKITVKGEDNKSTDYNLLKFVKSNKNTCYNQSPI
                     VAVGDKIETNQALADGPSMKNGELALGQNVLVGFTTWSGYNYEDAVIISDRLFKDDVY
                     SSIHIDEYTIECLRTKNGDEEITRDIPNISESAKRYLDEEGVIMVGAEVKEGDILVGK
                     TSPKGQVELTPEEKLIQAILGDKVKRVRESSLKVPNGGDGIVAGIKRFSIANGDELED
                     DVLELVKVYVVQKRKIQIGDKVAGRHGNKGIISKIVAQEDMPHLEDGTPLDILLNPLG
                     VPSRMNIGQIFELHLGYAARELAKAKLIEACFDKKLADQLDTVFGLEKSKTQSLIKNL
                     VEHMKSIGVTSLAQTKNRVRTIDIDIVLKQLGLTYDDLAFKIATPVFEGVNMEDLKAI
                     MSEAGIDPDKTEGKFKLIDGRTGEPFEKPISVGIMYILKLDHMVDDKIHARAVGPYSK
                     ITQQPLGGKSQNGGQRFGEMEVWALQAYGAAHNLREILTIKSDDVRGRNMTYNAIVKG
                     LSIPEPGVPESFKLLTKELQGLGMTLNVLYDDDSIENINNISVVDESLEPKIHDAEFD
                     TFTLDDYNDDNF"
     gene            781748..782578
                     /locus_tag="MGF_RS03200"
                     /old_locus_tag="MGF_4588"
     CDS             781748..782578
                     /locus_tag="MGF_RS03200"
                     /old_locus_tag="MGF_4588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="esterase"
                     /protein_id="WP_011884018.1"
                     /db_xref="GI:500213847"
                     /translation="MRDNTMPNQIDLSKIESIELIRPNAKHKLVFLHGFGSNFKIKRR
                     LWEYYDNCSFYALNLPGHGESKIQDPNQLSIAHFAQIIKAYFEKHDLKDVILLGHSMG
                     GGLAAIMNSLIPERIKLSVLEAPANGSILSNLSNISKLVPNNPEEMKQLYYVLYYDPV
                     KEFQGKIDEMAAAEYNQDKDYMEMLKPLLSIGVLEEMSELSNIGYRSVTKPMLVIFGR
                     EDKIVIPTDSVEHIKQLNPKIEFAFIENSGHLPYYEHPKEFYKIMSNFIKSVDPTFEK
                     "
     gene            complement(783264..783845)
                     /locus_tag="MGF_RS03205"
                     /old_locus_tag="MGF_4603"
     CDS             complement(783264..783845)
                     /locus_tag="MGF_RS03205"
                     /old_locus_tag="MGF_4603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glutamine amidotransferase"
                     /protein_id="WP_011884015.1"
                     /db_xref="GI:500213844"
                     /translation="MKKNIKKQIRIAAIVATGVDDLELIIPTDLWRRARFIVDYISIE
                     KKNSVTLAQGTSIKCSLTIDKSNLMQYNAIYLPGGLGSKRFGDDQKLTHYLSKFNEKD
                     QTTPRYILAINESPIILKNLGLLEGKKVVASKEHKDAIGSNFDSKTNVLLSDNIITAR
                     ATGHAIDFAIETVKILASKKEADDLAKMISYER"
     gene            783976..784890
                     /locus_tag="MGF_RS03210"
                     /old_locus_tag="MGF_4604"
     CDS             783976..784890
                     /locus_tag="MGF_RS03210"
                     /old_locus_tag="MGF_4604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase A8"
                     /protein_id="WP_011884013.1"
                     /db_xref="GI:500213842"
                     /translation="MYTFKRYLTKTKDTLIRQFKAANTKKLIKIKYPILAVMGFFVLL
                     IVFVLRDYFLKLGIGHSTSTGFITINVITNSGVGFSLFNQNPAVPYLLQSLLTIIFLI
                     TFIFSKNKALIVLLPLITFGGLANVIDRSVPITLSNGTVETNSVLDYFQFFRSSAIFN
                     FADICIVTGFALIFLTFVVDIFLDLKKKNKKTVSTTNKQLHGWKSIPLEERNKWNDWA
                     DHKCVFCNQQMMINSNEVICSNEECAYIDLINIAKPISVEKQENCLICNSEMIKKVYD
                     KQASFLACSRFNEKCYYTKSCKQIENNA"
     gene            784883..785818
                     /locus_tag="MGF_RS03215"
                     /old_locus_tag="MGF_4608"
     CDS             784883..785818
                     /locus_tag="MGF_RS03215"
                     /old_locus_tag="MGF_4608"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="pseudouridine synthase"
                     /protein_id="WP_011884011.1"
                     /db_xref="GI:500213840"
                     /translation="MPKHTFVNNDSEKIRLDIFLTYNLNLSRNKTSFLILNDLVKVNK
                     KLVNKNNFVLKVGDVVELEYEESIFNKVSNEILPFNKKLDIVYEDDDLIIVNKPTNML
                     SHPTTHNEPDTLLNCLMYYNKKQKVYLAHRLDKDTTGLIVATKNFKSLEKIQEQITKR
                     IMKRYYLAIVHYPFNELRAVIDAPIGYLKDHDLKFGVENTKNPKNAITKIYVLDQNKK
                     YALIKCELLTGRTHQIRVHMDFIKHNIINDPLYGVKGEQRTDYKQFLHAYQLELTHPT
                     TNVPLFFEVKPDEVFMKKLFDVHLDLNQELKGLFE"
     gene            785824..786399
                     /locus_tag="MGF_RS03220"
                     /old_locus_tag="MGF_4613"
     CDS             785824..786399
                     /locus_tag="MGF_RS03220"
                     /old_locus_tag="MGF_4613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="protease"
                     /protein_id="WP_011884008.1"
                     /db_xref="GI:500213837"
                     /translation="MLKKYSLFIDTCLDKINLAIFDSEKEEIYYYTSIELHKNLVDII
                     VSKIEEFLADHKIKMKSIRKLYLTLGPGSFSGVRAGTNIAKTWKTVDPSLEVYTISNL
                     KIQVPYGEGISCIDAKSNKKYVSIYRGNVGTLKIVDDEEYENLCKKNPDLSLFKNFKN
                     VDIFENLINNINNFELTELENIKPIYLKDPL"
     gene            complement(786471..786914)
                     /locus_tag="MGF_RS03225"
                     /old_locus_tag="MGF_4621"
     CDS             complement(786471..786914)
                     /locus_tag="MGF_RS03225"
                     /old_locus_tag="MGF_4621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_011884007.1"
                     /db_xref="GI:500213836"
                     /translation="MITIKYTIENDGNYTLRKAYDGDGGYDIQLPNDLTIESLETKII
                     DTGVIFELPHNIHAQFMVRSSVAKKGIILANTIIDSNYRGHTFLIITNASKMTQHFSA
                     GDRIASVMFIDTRIVDANIKLDKVTPDQINKITTRSDKAFGSSGK"
     gene            complement(787375..789243)
                     /locus_tag="MGF_RS03230"
                     /old_locus_tag="MGF_4632"
     CDS             complement(787375..789243)
                     /locus_tag="MGF_RS03230"
                     /old_locus_tag="MGF_4632"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574736.1"
                     /db_xref="GI:504387634"
                     /translation="MRKRTKFYMYSIAALSSLGIFLSSCTRASQPVQKGEFDDKVVIQ
                     TAQNQFYPLMWAFSQLVDLYNKQFANTPGFLPVELQQSEKTNATSELQLTNNVVGSIR
                     SNSPLVPNIILADLNAAYQINGFNRLLDLSNNPIINENYFDSDIYNNFNKISGSTQSS
                     DKVYAIPFNLTTTDSLVFNKPLMNLLFSLVEQGGGTVDKNSATYKELHMEDFMKKIPN
                     KKWKDLQVKNNEIYKGLTVDDQTFSNLESMFEFSKKFTEGLELKQAPTVTGQQRDLKV
                     FMLDYGPNIYQKYLWSKLGNSRDSWLWNLKLQDNQFDLDFSNLRKTADQSTIGETYDF
                     FKNNYTSLNLNDKQVLKSIYFGTGGTSDWASWDIRNFDTAFGIAPHVGWNQSVVSPFT
                     IRTFRSTKGDVTQQDINNAKNNFASADDVLWKTQLTKLDKNNLNKNTFWIGGSSLIGI
                     STSRQRDEQTKKFLEWLFKNDTRIAAPDSPFNNQSVSQILNSVSAYDLTSKQALSTTA
                     QQALTGTIAKEQSEVDKVKNNPTVETYNNSDWSRIYLNKGALASLTDWLTFKSELNKD
                     PANNSIAFIHTDEKANQILSILNGAVSGITRSADPTNLTKENLLRQINDALGTADQ"
     gene            790149..790436
                     /locus_tag="MGF_RS03235"
     CDS             790149..790436
                     /locus_tag="MGF_RS03235"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011884006.1"
                     /db_xref="GI:500213835"
                     /translation="MTVFGVIYFLQWKETSKPETNSLALNLLHPGVLLLVLFIALIIY
                     YIYLVRKKILGLIKKDNKLTAQQKDDLYLTSGFVYIPYLLNDINFLNIVST"
     gene            complement(791277..793289)
                     /locus_tag="MGF_RS03240"
                     /old_locus_tag="MGF_4652"
     CDS             complement(791277..793289)
                     /locus_tag="MGF_RS03240"
                     /old_locus_tag="MGF_4652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574738.1"
                     /db_xref="GI:504387636"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSAATPTPNPEPKPTPNP
                     EPKPDPMPNPPSGGNMNGGNTNPSDGQGMMNAAAKELADAKAALTTLINGETANLASY
                     EDYAKIKSELTSAYETAKAVSAKTGATLNEVNEAKTTLDAAIKKAASAKNDFDAQHGS
                     LVEAYNNLKETLKEEKTNLDSLANENYAAIRTNLNSLYEKANTIVTATLDPATGNIPE
                     VMSVTQANQDITNATSRLIAWKQNADNLANSFIKQSLVKNNLTRVDVANNQEQPANYS
                     FVGFSVNVDTPNWNFAQRKVWASENTPLATTPAEDATQQAASLTDVSWIYSLNGAEAK
                     YTLSFRYFGAEKTAYLYFPYKLVKTSDNVGLQYKLNGGDTKQINFVQTPASGSSDVAA
                     NEEETMASPAEMQSAPTVDDIKIAKVALSNLKFNSNTIEFSVPTGKAAPMIGNMYLTS
                     SNSEVNKNKIYDDLFGNSFNNENNPTAVTVDLLKGYSLAASYSIYVRQFNDLNIQNGT
                     DMARSRTVYLVGLIGSNASRSIRNLSNVRTSPNTVSTNRTFTIYVNAPKSGDYYLSGS
                     YLTNQNRNIKFLNSSSDQTSSNSLTLNVKAQTNWETLGNFDTSNNTNIVTNSGSSTTT
                     GRTLNLKQGLNKIVISGVGNGNTPFIGNLTFTLMDKTASPVVDDIF"
     gene            complement(793651..795630)
                     /locus_tag="MGF_RS03245"
                     /old_locus_tag="MGF_4671"
     CDS             complement(793651..795630)
                     /locus_tag="MGF_RS03245"
                     /old_locus_tag="MGF_4671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574739.1"
                     /db_xref="GI:504387637"
                     /translation="MKRKNILKFVSLLGIGSFVMVAAASCTSAATPTPNPEPKPNPNP
                     EPKPDPMPNPPSGGMNGGDINPGGGQNMMDSAAQELTAARTALTSLLASKNANIEMYS
                     DYAKIQNTLIAAYTTAEQTSQNSSATLEQVKNATSALQTAINTANSNKQKFDQDHSNL
                     LMSYKNLMATLAKKETTVMTLKDPKYSAILDQINGVSSKGEELVQHTLDPVSGIVPAA
                     NTITEEITKIEEVISEKTLQDQKNNADQFANYQSFTLDKTKLENVEDAKKMGQPANYS
                     FVGYSVDVTGTSGQETTIPNWNFAQRAIFTSGNQPTKVTATTTGEDQSTAKPLSDVSW
                     IYSLAGTGAKYTLEFTYYGPSTGWLYFPYKLVKANDDVGLQYKLNSNETLTPIIFGEG
                     TTTNGPAATVENINVAKVRLTGLAFGKNTIEFSAPMSKVAPMIGNMYLTSSDTETNKQ
                     NIENSIFGNSVTTENNITKISVDTLSAYSLASDWSTFIGQYSSDSLTLNGNRMSDQKY
                     YLIGYVGGNTGQRDITMVANTNQQRLPTASNQNTRSYTLYVNAPKAGAYYIKGVFASE
                     VRRDLKFSTGDMSSNNVTIRQLSTGNLTTLKTFDTSAITGPTQVTTVDTNRKTLTLVK
                     GLNKIVVSGATADNGNAPNFGYLEFILNETQPETT"
     gene            complement(795961..797976)
                     /locus_tag="MGF_RS03250"
                     /old_locus_tag="MGF_4683"
     CDS             complement(795961..797976)
                     /locus_tag="MGF_RS03250"
                     /old_locus_tag="MGF_4683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574740.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574740.1"
                     /db_xref="GI:504387638"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPEPKPDPMP
                     NPPSGDMNGGDTNPGNDGGMENSAQQLAAAKKELSDLLATQSSNLAKYADYTNIQNTL
                     TAAYTTAKSTSDNTSVTLEQVKSATSTLQAAIDTAASSKTSFDEKNPELIKAYYALKE
                     TLKNEETVLSGLTDSNFATIKTNLTALYQSGKDFVKATLDPVSGNAPQIADITKADKD
                     IADAVSKLETWKTNANTLATSFVKEVLVKNKLTGIDTTNNREQPGNYSFVGYSVNATN
                     NNEIPNWNFAQRKVWTSDNGRTSLISSTSDNSSTLTEVSWIYSLSGAGTKYSLTFNYY
                     GPSTGYLYFPYKLVKEGDENNVALQYTLNSGSAQEVNFAPTVKTSVSADSSGDSNNQT
                     ESAAETMPVTSDLNPAPTVSDINIAKLTLSNLKFGSNTIEFSVPTEPSNKVAPMIGNM
                     YLTSNIANEAKVYNSIFGNVDNSSEASTSVTVDILKGYSLATNWSTYVTRFMNLTNSM
                     PENATTYLVGFIGGQLARTTVGSIPNRNNFPIMNNENRTFTLYVNAPKAGDYHISGSY
                     LTRNTRGLKLTVTDTTDKNNSITITTSGKNNWNTLGHFDTSKANNSNGNDGSVENNKA
                     SLTLKEGLNKIVIAGGTQDGKNAPYIGNLTFTLNNSSTNASQDSSST"
     gene            complement(798304..800352)
                     /locus_tag="MGF_RS03255"
                     /old_locus_tag="MGF_4693"
     CDS             complement(798304..800352)
                     /locus_tag="MGF_RS03255"
                     /old_locus_tag="MGF_4693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574741.1"
                     /db_xref="GI:504387639"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTQTPNPEPKPNPGG
                     GDTNNPPSGGMNGVDTNPGGGQGMMDSAAQELTAARTALTSLLASKNANVQMYSDYAK
                     IKNDLTAAYTTAETASQNQAATLEQVKSATSTLQTAIDKAASDKNDFNNQNADLVSAY
                     TSLKDAVKSETTNLEGLSDANYTAIKDNLTTYYGKAKNILTATLYPESGEIPKVDAVK
                     VVNNFITNANSNIEQWKNNANMLSDSFLRKTLDKQQLTSNAELQQPANYSFVGYSKDI
                     TDHKYNFAKRIVWKPKMGSGSTYEPLENQGDLTDVSWIYSLAGNETKYSFTFANYGTT
                     TGYLYFPYKSVKSSDNVALQYKLNGASPVSIDFNNSAISPSQESASDADGSEMATRTD
                     DNSPESQVKAEKASSTSDVSRSAVNSAPSVDEIKVAKIMLSELKFGQNTIEFSVPTGQ
                     DKVAPMIGNMYISSTDKNDNLVYNDIFSNILDKQDEPNSVTVNLLKGYSLAADHSTYF
                     YQFSSSNRMNESNPTYLVGFIGGHGNRNNLNSSNTTNNEVASPSVQTSNRTLTIYVNA
                     PKDGQYYIKGSYLTSNNRNLKFTTTATANNSITFTVKGKNNWSTLGTFNTANNNDIET
                     SGSSSSGQPNESKTIKLNKGLNKVVITSVMMDNKNPGAPYIGNLTFTLMSPTMMEAKK
                     "
     gene            complement(800712..802754)
                     /locus_tag="MGF_RS03260"
                     /old_locus_tag="MGF_4707"
     CDS             complement(800712..802754)
                     /locus_tag="MGF_RS03260"
                     /old_locus_tag="MGF_4707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574742.1"
                     /db_xref="GI:504387640"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPKPESKPNPAP
                     KPDPMPNPPSGGMNGGDTNPGMDTAAQELANAKAALTTLTNSESEKVGLYVDYAKISA
                     KLSATYTTAKNVLNNSASTTQNINAARTTLEAEIAAAAKAKNDFDAQHTSLVKAYNNL
                     KETLKEEKTNLDSLANENYAAIRTNLNSLYKKANTIVTATLDPTTGNIPEVMSVTQAN
                     QDIANATSKLVAWKQNADNLANSFIKQSLVKNNLTGVDEANNQEQPGNYSFVGFSVDV
                     NGAQNNNRPNWSFAERKIWASEKTPLATTTAEDATQQAAPLTDVSWIYSLNGAEAKYK
                     LSFRYFGAEKTAYLYFPYKLVKTSDNVGLQYKLNGGDTKQINFVQTPASGSSDVAANE
                     EETMASPAEMQSAPTVDDIKIAKVALSNLNFNSNTIEFSVPTDKVAPMIGNMYLTSSN
                     SEVNKNKIYDDIFGNTFNNENNPTAVTVDLLKGYSLAASHRIYVRQFNELNIQNSSDM
                     ARSPTVYLIGLISGNANRSTNRLSNVRTSPNVNGDRRTFTIYVNAPKDGNYSVRGSYL
                     TNQTRRLKFSTSMDNSLTINVKEQSDWNTLGTFDTANNTNIVMKSVATGVNPQNSNTT
                     LHLKKGLNKVIISGTSNNETPYIGNLVFTLSTTPSDSNSNEGSTGSDNSRAPHVNA"
     gene            complement(803120..805162)
                     /locus_tag="MGF_RS03265"
                     /old_locus_tag="MGF_4722"
     CDS             complement(803120..805162)
                     /locus_tag="MGF_RS03265"
                     /old_locus_tag="MGF_4722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574742.1"
                     /db_xref="GI:504387640"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPKPESKPNPAP
                     KPDPMPNPPSGGMNGGDTNPGMDTAAQELANAKAALTTLTNSESEKVGLYVDYAKISA
                     KLSATYTTAKNVLNNSASTTQNINAARTTLEAEIAAAAKAKNDFDAQHTSLVKAYNNL
                     KETLKEEKTNLDSLANENYAAIRTNLNSLYKKANTIVTATLDPTTGNIPEVMSVTQAN
                     QDIANATSKLVAWKQNADNLANSFIKQSLVKNNLTGVDEANNQEQPGNYSFVGFSVDV
                     NGAQNNNRPNWSFAERKIWASEKTPLATTTAEDATQQAAPLTDVSWIYSLNGAEAKYK
                     LSFRYFGAEKTAYLYFPYKLVKTSDNVGLQYKLNGGDTKQINFVQTPASGSSDVAANE
                     EETMASPAEMQSAPTVDDIKIAKVALSNLNFNSNTIEFSVPTDKVAPMIGNMYLTSSN
                     SEVNKNKIYDDIFGNTFNNENNPTAVTVDLLKGYSLAASHRIYVRQFNELNIQNSSDM
                     ARSPTVYLIGLISGNANRSTNRLSNVRTSPNVNGDRRTFTIYVNAPKDGNYSVRGSYL
                     TNQTRRLKFSTSMDNSLTINVKEQSDWNTLGTFDTANNTNIVMKSVATGVNPQNSNTT
                     LHLKKGLNKVIISGTSNNETPYIGNLVFTLSTTPSDSNSNEGSTGSDNSRAPHVNA"
     gene            complement(805440..807527)
                     /locus_tag="MGF_RS03270"
                     /old_locus_tag="MGF_4735"
     CDS             complement(805440..807527)
                     /locus_tag="MGF_RS03270"
                     /old_locus_tag="MGF_4735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="WP_014574743.1"
                     /db_xref="GI:504387641"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPEPKPNPEP
                     NPNPEPKPDPMPNPPSGGMNDKNTNPGNGGRMDNAAQQLAAARTALTTLINSRTQNTE
                     LYVDYAKIQDTLVKAYDAAKVVLDNTASTTQNINQAKTTLETAINAAVKARRDFDAAN
                     GPLVTAYNALKETLKNEETVLSDLTDSNFATIKTNLTALYQSGKDIVTKTLDPIMGTA
                     IDLSAVTQANTNISNAVLKLDGWKTNANTLATSFVKEVLIKNKLTGIDTTNNQEQPGN
                     YSFVGYSVDVTTGSNNARPNWSFAQRKVWSDNTVILSQPQPAEGENQQSAPDVSWIYN
                     LTGMGAKYSLTFNYYGPSTGFLYFPYKLVNSSDSDKVALEYKLNESTVKTIDFAPSQT
                     SPVPSDATRENNPSTAAPAQGSTEINSSPTLDDIKIAKVTLSNLKFGSNTIEFSVPTQ
                     AEGEMPKVAPMIGNMYLTSSDSDVNKNKIYDDLFGNNSVQGDNQTAVTVDLLKGYSLA
                     TNYSIFVRRFMGLQDNSMTRTESIYLVGFIGGNQGRISQAKRSNFQNFNNSPTQNNNN
                     RTFTIYVNAPTQGEYYISGSYLSQPSRSLMLSNNTSTNQNNSLTISNLMQSNWNTLGH
                     FNTQMTTESATTSGNTQMKRTLTLNQGLNKIVVSGVNNGDTPFIGNLTFTLSTTPQTA
                     ATPSSTSPQSQTQ"
     gene            complement(807975..808409)
                     /locus_tag="MGF_RS03275"
                     /old_locus_tag="MGF_4739"
     CDS             complement(807975..808409)
                     /locus_tag="MGF_RS03275"
                     /old_locus_tag="MGF_4739"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family domain protein"
                     /protein_id="WP_014574744.1"
                     /db_xref="GI:504387642"
                     /translation="MLNDSSARTQDIINANIYLENNIALANAYKTAFDQKNSELIKAY
                     EQLKEYLITEPDVLPYYSGNELDAVRIFYTSAKNLVNNKLEPLEGEVPTLVEVNITNR
                     NLLLAIQGVIIRRNISSIGSGGTFPSWSFARPDGSGTTTTTY"
     gene            complement(809064..809530)
                     /locus_tag="MGF_RS03280"
                     /note="lipoprotein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(810010..811764)
                     /locus_tag="MGF_RS03285"
                     /old_locus_tag="MGF_4760"
     CDS             complement(810010..811764)
                     /locus_tag="MGF_RS03285"
                     /old_locus_tag="MGF_4760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574746.1"
                     /db_xref="GI:504387644"
                     /translation="MTNKTKVKKISIALGVAGVTSIAGGALASCGAASSLTYESSVQL
                     VVSDNSSTLADQSFSETSYNGIRDFYKSVYKETLPLANDPSLSVNNGVWKRPGTIDDS
                     RINTYRQIKNDGSFVAVATGFNQESALNRILDNTALYNEFKDFGFIFVDGVITKKNGT
                     NISAITFQTESAAFLTGIAAGVLVNKNSSFFKTTKVGDVDTYGIGAYVGLPIPSTISF
                     LNGFRMGAIFFNQYIQPRVEGFKKLSWVSSNAADNNGNRDTLPADKSDSFNATEQRAT
                     TITNQLLQNGASLIYPIAGPQTALSQNVILSNRNTHHAQLIGVDTAQENLATTQPLQG
                     APGGKTIAFSTVKALDVAVDSTLKAIQKGQPVNGFYGYGWNNLATLANGGVSLSSAGL
                     AYLPNLTDLFTKTSTPANADQTTPRQEMSDQSSGTPAMTGTMNGQANGGTESMMAMSM
                     MMAEAGASTAPNMSATSSTPAATTTNKQISANDLVTTTEANKTMVIMQYVNILAGTST
                     LLPAASRENWKIKGDELRMFKTSVEADAKLLPILTTDVDPNTALSHKSAIISGSFQQA
                     EGTLLSQAGKQFVFKKLN"
     gene            complement(811912..812532)
                     /locus_tag="MGF_RS03290"
                     /old_locus_tag="MGF_4763"
     CDS             complement(811912..812532)
                     /locus_tag="MGF_RS03290"
                     /old_locus_tag="MGF_4763"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="recombinase RecR"
                     /protein_id="WP_014574747.1"
                     /db_xref="GI:504387645"
                     /translation="MASDIDLNEFNNLVEQISDLPSVSKKQAKKITQYLMTKSDRYVY
                     DMIDVLKRAKLSIKICEMCQGWSNRSICSICSDESRNKNELCIVSFFDDLNVIEESQA
                     YHGKYFILNHEISKKNKRIIEEINFDLLLDLIKKQKIEKVIIATNFTQDGQTTANYLR
                     FLLDDFDLKIYRLGMGLPYNSSIDYADSFSLKGAFENKQLIKDKKA"
     gene            complement(812538..812840)
                     /locus_tag="MGF_RS03295"
                     /old_locus_tag="MGF_4766"
     CDS             complement(812538..812840)
                     /locus_tag="MGF_RS03295"
                     /old_locus_tag="MGF_4766"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAN6.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574748.1"
                     /db_xref="GI:504387646"
                     /translation="MNFQNLANQMKKMQREMEKKLAEFEEKEYQYEYKKLIKTTLKGN
                     LRIVKLEINKDLIDPEDPDTLQDMVTETINEALSDLEKKRDELSNSITPPIKFPGF"
     gene            complement(812881..814680)
                     /locus_tag="MGF_RS03300"
                     /old_locus_tag="MGF_4777"
     CDS             complement(812881..814680)
                     /locus_tag="MGF_RS03300"
                     /old_locus_tag="MGF_4777"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_014574749.1"
                     /db_xref="GI:504387647"
                     /translation="MINFYQKYRPTNLSSIIGQSHITNILLKASAHDQLATAYIFQGS
                     RGIGKTSISKILAKAYNCLNKKDGDVCNQCSACELINENKSQDIYELDAATNNGVDEI
                     RKIIDAINYAPMNLSKKVYILDEAHMLSNGAWNALLRTLEEPPKHVVFIFATTEFNKI
                     PLTVVSRCQSFNFKKLDKDDLVDVLKNVVKQEKIKIEDLAIDKIADFASGSARDALSI
                     LQQLAYDKNKKITVEKINETFGLINLEIKLEFLELINQHDLEKLVKLLNEIEAKGTNF
                     VLFIQDLLAILIDLLVYQKVKSFSLLKVLDEEQVKAINLKNIKLLSLSEKINGLLSTR
                     VSQTNIKESLLLAVFDYLEQNPQPVVGNNVEVVIKPKTKTTEQRQEKEEAKPQVEIKQ
                     KNEKVVKVEQPNEQLKAKKVRSLPSEETQSSTKSTTNDQLDLSLDPTKAKDYLKAIIF
                     SVWKNSKLINKELQKNFLNAQDKFKKGDNKEDSFYENVDLYLTGSKVLTVTDKAAIVL
                     LEDENVAELLNEQNYNNSKVHTINHIFDKEIYVFAVTKEVMKPIFEQTQKIKDLDIIN
                     YYNDLYQSLDVDKLRAIKKQKTQAEILSELLDK"
     gene            complement(814816..816321)
                     /locus_tag="MGF_RS03305"
                     /old_locus_tag="MGF_4786"
     CDS             complement(814816..816321)
                     /locus_tag="MGF_RS03305"
                     /old_locus_tag="MGF_4786"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574750.1"
                     /db_xref="GI:504387648"
                     /translation="MSYFLIILIYSNISCSKYMNQKTNPVLDKNNNLQQVIRPSVNLA
                     NKQAVGPNNNNIYQAQAQIVRSNAKKEEMPAVNRMPSKPGPGLNQPQPQPTAKVAPNL
                     NNPNIPRPGLNPQNKAPNQPGNLNPNNLNRNLNQRPNPNLNTQPLNNNRTINPNQNNT
                     FNILNKLNTGPKPGQARNPQGENQQPLNQPKPNNLEPKQNPDNPRVNPKPSPSLRDFV
                     PQDETGSVDEEEQNEAPITSLRNFSNNQTQRTSLRDFNSSLNGETPAEQATTTKVPPA
                     ASTQAEPTTEVKPTNKVEQTKKAATHPSGMTLEEFMHKKQATNLVLADENTLQKRNEE
                     KEAKAVTVVNQQNVQEESSPDDEVSRFDIQYEIWRLNRLKKFGIGSIFVGLFSLILSL
                     GVLGLGVLYILHHFKVLDITTTLKISLDTFNAILVAVVIVYVIFSSIYRFLALACVLA
                     SSQIGSHKKVYSYDFDSLKASLSFSVFFEIASLISYPVLLSRISKVIKLLK"
     gene            complement(816331..817251)
                     /locus_tag="MGF_RS03310"
                     /old_locus_tag="MGF_4792"
     CDS             complement(816331..817251)
                     /locus_tag="MGF_RS03310"
                     /old_locus_tag="MGF_4792"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="WP_014574751.1"
                     /db_xref="GI:504387649"
                     /translation="MKLARPNNFDEFIGKNELKQKLLTFINASISQNKALDHVLFYGP
                     PGVGKTSLAQIIANELKSKIKILQASQIQKPADLLNAFSLLSKNDVLFIDEIHSLSPT
                     IMELLFPIMEDYVVDILIGKEFNSKFTRMKLPPFTLIGATTMYGRIIDPLEERFGILL
                     QLDYYQDDEIFEIIRSINVKEKIELTKDEMVQIAEHSKGTPRNALRIYKRVMDFKLFD
                     QEITIKSILEKLNIYQFGLSNLDLEYLKSFDDNPKLYLGLKSLSLISGIDCFTIESKI
                     EPYLLKMNLIKKTSKGRQITQKAIKYFKDN"
     gene            complement(817238..817918)
                     /locus_tag="MGF_RS03315"
                     /old_locus_tag="MGF_4798"
     CDS             complement(817238..817918)
                     /locus_tag="MGF_RS03315"
                     /old_locus_tag="MGF_4798"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574752.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="WP_014574752.1"
                     /db_xref="GI:504387650"
                     /translation="MITSVYAKIEYVTNTKMLFVANNWGYWVNVKPNSGFSRTDNNVL
                     VFLHELTFLAQNNAINKELYAFKSLKEKEWFKTLLTINGIGPKTAMNVMVNKQEEVLT
                     LIKNNDLNGLLRLENINKKVATMLLASDIASKHYLKNQIVVSDKVEPQIDDDEKIDDS
                     KDLNDDELLSEIVIEAIDCLISLGYKQEQIKTALAEIDLKNESINDSADLVAVIIKQI
                     GLRTSEVS"
     gene            complement(817952..819700)
                     /locus_tag="MGF_RS03320"
                     /old_locus_tag="MGF_4810"
     CDS             complement(817952..819700)
                     /locus_tag="MGF_RS03320"
                     /old_locus_tag="MGF_4810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574753.1"
                     /db_xref="GI:504387651"
                     /translation="MNPDTLKSLSTQSSLSTQSILIIVLAAIATVVVVLYAIYFVIFI
                     KVRRSVNKNYKFREKYNVLSAKNYNLTIQRLAKLANDQTGLKHVVQYVNKFNNYYREQ
                     INSVYEPINELCNFDYHFDFKYVKQATKQINLYLHKIEMLDRSFTQIKGDISGYKNHS
                     SELIVSFKELFDNLIKFLEKYILPTFDNEELLRMVNSFSSCLFHLEESATKLLNNRLI
                     AIIEHWLKNLPALIKMAKTYFVLNKLRVRLKYFIEDIYYSFGLLVQDPNFTEEKKQKI
                     NTIIKYTNKDLQTVHQLLMQRNFKQAQMLLADKFNLIEPLKTELELETKSKNTIAVIY
                     QAFKYWIDHYLKNFEQLKDKLTIFIVNFEKDHILLEQIRKLSFKSDQLKLMINEINEE
                     NQKKLSHKDYLFLISNIANNATKLNESLEVLVKTILDNIAAYENFLFNTNNLKLQFVM
                     IKNYYQANELKNDKLYKLISDNINQLVELEQNLNKNYKENINKFDQLHQKMEANFLEV
                     LKTSIKQVALKELCEHTFMFLHKYIYESVEIKNFVSDFRKRLFDNGLYEECLTNQIIL
                     LNKMKQAAKQNQIVLS"
     gene            complement(819711..821135)
                     /locus_tag="MGF_RS03325"
                     /old_locus_tag="MGF_4822"
     CDS             complement(819711..821135)
                     /locus_tag="MGF_RS03325"
                     /old_locus_tag="MGF_4822"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574754.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glutamyl-tRNA amidotransferase"
                     /protein_id="WP_041594419.1"
                     /db_xref="GI:753838802"
                     /translation="MHNFQPIIGIEVHVAINSKTKMFSPSANSHRSDPNINVHPIDLG
                     LPGTMPEPNGFVVKKALVLAKALNMQNVDHHLRFDRKNYFYQDLPKGYQITQQHHPIA
                     TNGYLDISNKRVPIQRFHIEEDTAKQLNEDNQILLDYNRAGSPLIEIVTDPVFDSGKE
                     VKEYLTNLRRILIFNDISDAKLEEGSMRVDVNVSIRPMGAPNYGTRVEIKNINSINNV
                     EKAINFEISRQHELLLSNKKVVQATMRYDDQLNQTVFMREKTNAIDYRYMFEPNIIGI
                     NLDQQFLSEVDQIQVFNIKELESKLLSEGVDQQFVELLLDNFFLYQKINEINQRINDL
                     AFVSKWLLIEFMGRINKQKLQLELINPKWFDNLTDLLVLIKGEDLNQKQAKVVLDEII
                     KTDETVAEIVDRLKMKQIKDEQEIIALLEPIVLENLAILKDYDQRKERVEKLLIGLLM
                     KKTNGQANPNVSIKVLTELIQKNR"
     gene            complement(821128..822576)
                     /locus_tag="MGF_RS03330"
                     /old_locus_tag="MGF_4830"
     CDS             complement(821128..822576)
                     /locus_tag="MGF_RS03330"
                     /old_locus_tag="MGF_4830"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="WP_014574755.1"
                     /db_xref="GI:504387653"
                     /translation="MKSDILKFNTQLRKKEITPDQLVKDSLKLINKYHWTNAYLYVNE
                     QRVNEKVNNFDHNLVNNSLLAYIPYSLKDNISTKGITTTGGSRFLEHYIPPYDATVYK
                     ILENLNALMVAKVNMDEFGLGGTGLYSGFGYTHHPISKKYAPGGSSSGSAISVANNSV
                     VFSVATDTGDSVRRPASLVGIVGFKPTYGSISRYGVYPYAPSMDHVAIFTRNVTDVAI
                     VTDALSQFDPKDFTSQKRSKSLLNHLLEPDLNQKKIRLGYYKNLEPYMYEDILTAWKK
                     VIDFLYKTNKFEIVELEFDIELLKAVLPTYQILSFPEANSCYANLTGIPFGEKVEGES
                     YEQKVINARTKLLGNQIKRRFTIGAYITLAENYEPLFKKAQKARRMIVDHFEQSKKDV
                     DVVFGLGASNFAAAIEDYKQGLADTNLIDDFLSIANFGGHPSITIPMIKNRDNLTVGL
                     NLVSNQFNDDLIIKTAYLIETELDKNGGNINA"
     gene            complement(822580..823956)
                     /locus_tag="MGF_RS03335"
                     /old_locus_tag="MGF_4835"
     CDS             complement(822580..823956)
                     /locus_tag="MGF_RS03335"
                     /old_locus_tag="MGF_4835"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     C"
                     /protein_id="WP_014574756.1"
                     /db_xref="GI:504387654"
                     /translation="MTESFIRPSSSFAMVLFAIIVGLVLVLSLTKKLYYYLFRKKRYY
                     TIPRFSVIGMTNIAMVIAIAVAIILLISAITGGLASILFRVYPGTRVSIETILVKISG
                     LLFGPIIGMISGIIIDLLAVTLSAGFFHYGYFVVAILTGMLAGMIRSLLTTSKYSKYR
                     NFSLSVYLSLLVIASFLLTIFLITSMPEIRINGGFDLSIPGVSQTKISSVVFTWIILG
                     FGIGIIAFIWITFLIYKLTTPNNAYSLSGFVHKRQIHSNHKNIITIDAKQNWYSSLSS
                     LVVLAGVNAVLVNLFFLPIFDKEITGQPYAFWISIRLIANPALFMIDIVVIFPVIMII
                     QPIMKYNYEDELTEDLNTPLFVKHWTSRKEGGNMKINKDDLKKLSRLVMFELDDAQLE
                     KLQVEFEDILSNFKQIEKLDTSNVKAMNYPISNSSNKLRDDRDVYQADQKIAQKTAKE
                     TLGDLVKV"
     gene            complement(823992..824687)
                     /locus_tag="MGF_RS03340"
                     /old_locus_tag="MGF_4841"
     CDS             complement(823992..824687)
                     /locus_tag="MGF_RS03340"
                     /old_locus_tag="MGF_4841"
                     /EC_number="3.2.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_011113868.1"
                     /db_xref="GI:499426404"
                     /translation="MLEQLIGEIQTNWKDLINQFFATHKTIYHQLDQLIKNRSEKNEL
                     IPKKELIFNAFNFFDYQETKVVIIGQDPYADLKKANGLAFGVDNNNPPVSLRNIIKEL
                     INNLKLDEQQLDDFDYSLKSWANQGVLLINTILTVKKQNPLSDQNLGWEELIKFLILK
                     LLENQTQPVFVLWGKKAQGFLEPYQLKHVLKSAHPSFFSAKQFFNNNHFNLINELLKT
                     KNEQLIQWVKQNK"
     gene            complement(824693..826252)
                     /locus_tag="MGF_RS03345"
                     /old_locus_tag="MGF_4846"
     CDS             complement(824693..826252)
                     /locus_tag="MGF_RS03345"
                     /old_locus_tag="MGF_4846"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574757.1"
                     /db_xref="GI:504387655"
                     /translation="MKKKILLVPTLVLASTVALSSCSSAVFRRNNMTYSKFLDILKDP
                     QNPKTSAKEVVYLGWNQNEIRQPTQQANNPNQKSLFNNFSYAVGSYDSNNTPTFVNNN
                     DSSIDLTFKLFYNQAFISILNSISLPAIHYSSNLYNYLEVNKLDNWATNLLPTEANQA
                     GVLRSFYESMANGLLTGNETDNYIFTPIDFKFEFKELTPELSAKSAIYDPRAYNVDYQ
                     LNANEIMTDNLLNTSNYLTKLFVLSNVNISFAYYIVGLNGDVAPTRDAYITSTSDVRF
                     QALANKFQSIYNTKLTAPVFNLKLNDLGVVVRYNVEQRASNTTNPSQSTNPADYVIRP
                     TAIDSIIPLGILSNPNNLVYQSGDLKDQRVGFKQEWTNQLVDLSKILTADQYANTENV
                     NTDTLTNQISNIRQNTGLFFNLLSSTHFRIINQNDVVDNNAFGANLTTYYNWYFNKLT
                     QVENYSKIDLVVPNNDPEIKAVTTPPASDMNTEMNVGMANNMTGDMNGQMNGEMASST
                     NNEMPTSPATN"
     gene            complement(826255..827874)
                     /locus_tag="MGF_RS03350"
                     /old_locus_tag="MGF_4856"
     CDS             complement(826255..827874)
                     /locus_tag="MGF_RS03350"
                     /old_locus_tag="MGF_4856"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA helicase"
                     /protein_id="WP_011113870.1"
                     /db_xref="GI:499426406"
                     /translation="MLINQFNQSLDDEIEYDSNDDSDIIEDEELAIASEIESFSDIYS
                     KNIATFNPAQNELYKKNQLFFYKCYRLELLVLSCLVHRIQGYEMARRILDGSDFTGIN
                     RYIFKCLTTDLYLGETDGSIDSIQSWINENFTLENKELDSLNEVCSYIRAHSNISPDN
                     FAKYLKSFVEHSKFRSVFYLSYDFTQEVNFDNKNLNGPLMPLIKFEKQINEIVNRSIQ
                     TDLDSIDKIADSFLEKINNLVINKHNNIYSTGYPGLDKYLSGLVPGNLLVIAARPGRG
                     KTAFAINILYNLAQELKSLKLQREADHEDFDTNKEDEICLFYSIEMNADEILSRLGSL
                     HSTVSFKLSNALEVYIKRQKNYRQFAEGINELRELPLFINSSPQTSIKTIYNDLHYLA
                     SIKKLPRLIVVDYLQLISTDDLDSSKNRSRHEAIGYISGSLKRIAKQYNVPVIALAQL
                     SRRIEERKGADSIPILSDLRESGSIEQDADIVIFIHSSTLNKKQNEEDFQEVENKIDV
                     VMHIAKNRSGPTGQVKFVFDKEHSKFLEDQN"
     gene            complement(827878..828321)
                     /locus_tag="MGF_RS03355"
                     /old_locus_tag="MGF_4857"
     CDS             complement(827878..828321)
                     /locus_tag="MGF_RS03355"
                     /old_locus_tag="MGF_4857"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_011113871.1"
                     /db_xref="GI:499426407"
                     /translation="MKVILLKDVPSLGKADSVVNVANGYAKNFLFKNKLAEPYTERGQ
                     KRLDLKVIKRNEQHDLLALEAKNLAKQLEGVVLEYDIRTNEEDKAFGTIGFKQIVDDL
                     SKKHIFVTKDMLDSKMKLDIGEHRVKINIFEGIHATILVKVSKAQ"
     gene            complement(828354..828680)
                     /locus_tag="MGF_RS03360"
                     /old_locus_tag="MGF_4861"
     CDS             complement(828354..828680)
                     /locus_tag="MGF_RS03360"
                     /old_locus_tag="MGF_4861"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAM3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_011113872.1"
                     /db_xref="GI:499426408"
                     /translation="MSDITKQPANNISSDDKKEVAKASAKSSVEGAKRKTFYKSRSRK
                     LCHFCAKGILKVDYKDVNTLRKNLNSYAKIVSRRQSGNCNLHQRHVSNAIKKARIMAL
                     LPFVKD"
     gene            complement(828715..829323)
                     /locus_tag="MGF_RS03365"
                     /old_locus_tag="MGF_4866"
     CDS             complement(828715..829323)
                     /locus_tag="MGF_RS03365"
                     /old_locus_tag="MGF_4866"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011113873.1"
                     /db_xref="GI:499426409"
                     /translation="MNKVILIGILTDNPSRIDYRDNYGCELKLIIHQADFSQQMYPKE
                     PYHFSINVWNKNADYALNGLEKGDLVSIEGYLKSELQVSQNGREYLRLSIVTERIRKI
                     PLSFNKSGYRSLPKENRFNRMSTPSYSNYNNAYSNDDSFDPPATTEIKGYRENYDIED
                     IQKIEPKDFAKFSTPSNFQPDHSLLDDDDMTIDMDTWMNENK"
     gene            complement(829335..829910)
                     /locus_tag="MGF_RS03370"
                     /old_locus_tag="MGF_4870"
     CDS             complement(829335..829910)
                     /locus_tag="MGF_RS03370"
                     /old_locus_tag="MGF_4870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_011113874.1"
                     /db_xref="GI:499426410"
                     /translation="MAKYEIMLMVSGQLNQNQAQAVNDELKAVFGKTEITEEYLGQKT
                     LEYPIKKEVTAHYFNLFLTSDGKSVHEYKRLASIRTDVLRILILNTEKEFGYRASQNA
                     KKVALAKQKQARYNDIMKQVQENGYFQIKGSKRNSRVEKAGAKEVWMLREKFGEDLPE
                     QKIPVLRKVNLTRKPTPNKSSENKQKVEKQA"
     gene            830093..831076
                     /locus_tag="MGF_RS03375"
                     /old_locus_tag="MGF_4871"
     CDS             830093..831076
                     /locus_tag="MGF_RS03375"
                     /old_locus_tag="MGF_4871"
                     /EC_number="6.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAM0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="asparagine synthase"
                     /protein_id="WP_011113875.1"
                     /db_xref="GI:499426411"
                     /translation="MKKLTLLETELAIKYIKDLFQNALSKELNLLRVSAPLIIAPDSG
                     LNDNLNGWEAPVSFKSKTNGVSSQVVQSLAKWKRYSIARYEIPLYQGLYTDMNAIRMD
                     ETLDATHSMYVDQWDWELRISENDRNVEFLKNTVNKIYKVLKEAQLKVNEKYGIFEQK
                     DLLPEHIHFVTTQELLDQYPDKNPSEREQLVCEKYKAVFVMQVGKKLSNNQVHDGRSP
                     DYDDWSLNGDIMVYNPRSKKALELSSMGIRVNKEVLLKQLEESKQNERLELMFHKKLV
                     NGELHQTIGGGIGQSRLCYFLLQKDHIGEVQASHWSDEIVVEAKAKGIKLL"
     gene            complement(831073..832461)
                     /locus_tag="MGF_RS03380"
                     /old_locus_tag="MGF_4883"
     CDS             complement(831073..832461)
                     /locus_tag="MGF_RS03380"
                     /old_locus_tag="MGF_4883"
                     /EC_number="2.4.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_011113876.1"
                     /db_xref="GI:499426412"
                     /translation="MSKHEKRVLVSDEINEHLINLIPVDAYKLCHRLMYPKNTTNLFS
                     TLTARKTSLKNITTHAWNSDLTTKVVCDIMDRFVYSLIELHNEKDGEIKNLVRNKLFS
                     VFGNKEFSEDFTNALIDMAEYAIEHDRLPLVISVRKSDQYIKFNEPLLTIYGEEGIDK
                     KYVWLINYFETILLQNIWQYQTSLTIAREFYDLCAKYAVKTTDSNEFLKYQCHDFSMR
                     GMSSFKSAIYSANAHLQYFDGSDSILGGNNAVSVIASEHSVMCADGQDHEAETYERLL
                     NQFKEGILSLVIDSWDIWNVLDNILPRFKDKILSRNGKLVVRPDSGDPIEVICGKNYN
                     PEDKSTWGTIHYLDHHFGSTVNSKGYKELNKKVGIIYGDAITLTRSEMILAELERQKY
                     ASNNIVFGVGATTYQASTRDTLGFVIKLTAIEKEIDGKFEWFNIKKTPKTDQSKESLT
                     GRFFSEDLVRIY"
     gene            832411..833355
                     /locus_tag="MGF_RS03385"
                     /old_locus_tag="MGF_4882"
     CDS             832411..833355
                     /locus_tag="MGF_RS03385"
                     /old_locus_tag="MGF_4882"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="esterase"
                     /protein_id="WP_011113877.1"
                     /db_xref="GI:499426413"
                     /translation="MLINFIRNQHAFFVLRHINFYLLLYIIISLIFMNKTIKGVDLNH
                     LKVIKKSNKNAEVDLIFCHGIATEPGLHYKIIKQIKNVNHYDLGFPAHYKTEEKFKYK
                     HLNIQYFAKLLVIFLRENPDLKNIVLAGHSMGCAVIMIALNLMNKEERNRIKQILLGA
                     PLTINTIFTAWNFTKYFTADAHKADEKVIKKFFKDLFYDYQKFVEDFDKWFSLEFYKK
                     TQNDQKKLALSIMSPISVKNILKSYHSFKEYEKVTIITADKDTLVPFTIIRSYIKRYL
                     KGARHIEIKKAGHAFILEHKKEYIEILKGIIESAKEVK"
     gene            833330..833704
                     /locus_tag="MGF_RS03390"
                     /old_locus_tag="MGF_4888"
     CDS             833330..833704
                     /locus_tag="MGF_RS03390"
                     /old_locus_tag="MGF_4888"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113878.1"
                     /db_xref="GI:499426414"
                     /translation="MKVQKKLNRYITNLKEILSEINLEKLINNYNLIFENSTHTRIMY
                     DDDDYEEIDFFEKSIEGELNYVKNKLIQEVNDHIEDLLKTKYDDDKKLAILHDQFYNL
                     TQAIALTKNISIKRLNKLLESE"
     gene            complement(833690..834562)
                     /locus_tag="MGF_RS03395"
                     /old_locus_tag="MGF_4893"
     CDS             complement(833690..834562)
                     /locus_tag="MGF_RS03395"
                     /old_locus_tag="MGF_4893"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="HAD family hydrolase"
                     /protein_id="WP_014574758.1"
                     /db_xref="GI:504387656"
                     /translation="MRNNIEWVISDLDGTLIRYENNQHIVEPAAIHAIEKLTSRDITF
                     TIATGRKQSDVVNFIKTYNLSGMVRYIIACNGAVIYDIEEEKIIQNSYLTKKVKTAVM
                     KHVDAFKEMTQDFLLFSYDINNNIYLYDSNKKPNESLLKELTSYEGSFSSNNYIYIDD
                     LNERDDLIKLIFFYNRSSMTEDITDYLAKFIKLTKIDTNDCVVVSPMSFELNSADCNK
                     GNAVLELNKILKKDLAKTLSIGDSFNDIPMFKVTGVSVTLESSHREVQNNATNVLDVK
                     ASDVVADAIELFAL"
     gene            complement(834566..835543)
                     /locus_tag="MGF_RS03400"
                     /old_locus_tag="MGF_4896"
     CDS             complement(834566..835543)
                     /locus_tag="MGF_RS03400"
                     /old_locus_tag="MGF_4896"
                     /EC_number="2.3.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="phosphotransacetylase"
                     /protein_id="WP_014574759.1"
                     /db_xref="GI:504387657"
                     /translation="MSTLIEELKNKIKNSKKVPEILLVEGWNAYVQEAAKQLVAEKLV
                     KPVLMFRTMDEIPADFDPRIKRYVIEKMDLSKYATYLFKLREKKGMTLEVAQQEVQKP
                     NVLASLLVKLDEVDGEVCGKEYTTKDTLKPALQIIKTSETAKIVSSVMVLEKNQERLV
                     FADCAINLYPTAEELAEIAKSTIKFAKDVLQIEKINLAMLSYSTLNSGAGESVDKVKA
                     ATKLVEESDVGKLASICGPMQFDAAYVEEVRKQKAPKLDWEKGANVFIFPNIDAGNIG
                     YKIAQRLGGYDAIGPVLTGLAKPVNDLSRGANAHEIYSVAIITACQAVA"
     gene            complement(835573..836397)
                     /locus_tag="MGF_RS03405"
                     /old_locus_tag="MGF_4899"
     CDS             complement(835573..836397)
                     /locus_tag="MGF_RS03405"
                     /old_locus_tag="MGF_4899"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase"
                     /protein_id="WP_014574760.1"
                     /db_xref="GI:504387658"
                     /translation="MNHSKINWFPGHMKKTLDDINKIKKHIDLVIQVLDARAINLTSN
                     PDLLEIFKQKKIVNVALKSDLADLSYQYDPETIVTNIRDHQFSNFLLNKLHQILSDKI
                     KRLQAKGLVTPHFNIMVIGLPNIGKSSLINKLIKKNHNKVENKAGVTKRQTFVKLNKN
                     FTLYDTPGVLYKRIDDFILGAKLSLLNAINLEVIPMQEVLSFAYSYLNQHYHNQLLEW
                     AKQEILPEQFHEFIEQYAHKKGFLNKNNAIDLNATYMNFYQDISLAKIAKVNYEKN"
     gene            complement(836410..837696)
                     /locus_tag="MGF_RS03410"
                     /old_locus_tag="MGF_4908"
     CDS             complement(836410..837696)
                     /locus_tag="MGF_RS03410"
                     /old_locus_tag="MGF_4908"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574761.1"
                     /db_xref="GI:504387659"
                     /translation="MSLRNSKDKLAKFSKSLNEITVTRTKLRTSLLIFVGLYGPKKMW
                     IRIALIAVISVIQGAISLFFIRNSGLYNLGVSSITQGLARTLFVFLPAHLPKTLIFDL
                     TFWILYIVINIPLIIFAYIKVGKRFSILTTVYVVMANVVGFLIGLIPGVQNIGLFTIN
                     TTENSTIIYEVTRFKDSDPQIYNLFFTPDGKFTDLAQKIAYIPLIWENNSEVNKIISL
                     FLYASIAGALSSLVYTVLFVIGASTGGMDFISQYVAKTKRRSIASIIFYTNIITLLVS
                     VTIGSYVPASVVLNEIPQEIMIPNSNIHFKDLSWNVSLLFSPNFIGSIVSAIVVSAFL
                     DALFPRYKMAKVEIYSADCEKIRQTLLSDHHSHTMSISKITGGFKRTEREMITTTTLF
                     VEIPRIIRLIRSVDKDCFITISQIKGIDGYIYITEE"
     gene            complement(837726..838094)
                     /locus_tag="MGF_RS03415"
                     /old_locus_tag="MGF_4911"
     CDS             complement(837726..838094)
                     /locus_tag="MGF_RS03415"
                     /old_locus_tag="MGF_4911"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RDV2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_011113883.1"
                     /db_xref="GI:499426419"
                     /translation="MNKLNKQNIINHVNNLQLKKSVPNFQVGDTVSVSIKIADEKRTR
                     IQKFDGLVLRRKGSGLSETFIVRKESSGVGVEKNFHVHNPNIEIELKRKGKVRRAYIS
                     YMRERSGKSARIKEKVVNTK"
     gene            complement(838099..838803)
                     /locus_tag="MGF_RS03420"
                     /old_locus_tag="MGF_4914"
     CDS             complement(838099..838803)
                     /locus_tag="MGF_RS03420"
                     /old_locus_tag="MGF_4914"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA (guanine-N1)-methyltransferase"
                     /protein_id="WP_014574762.1"
                     /db_xref="GI:504387660"
                     /translation="MKIVVLTLFDDFVRSYYDFSIIRNALDKKAVELEVINFRQYAND
                     KHKTVDDTIYGGSAGMLLKLEPLVNCLRDIKQNQFKDPNKIRTYLLSPQGEVYDQNKA
                     VALSQSDHDLILIAGRYEGFDERIYHYVDGALSVGDFVITGGELAALIVVDSIVRLLP
                     NVINKDSLSNESFNNYLLDYPMYTKPYDFEGYKVPDVLLSGNHQAIAAFNQQEAINNT
                     KMKRPDLYLKYKSNLK"
     gene            complement(838813..839073)
                     /locus_tag="MGF_RS03425"
                     /old_locus_tag="MGF_4916"
     CDS             complement(838813..839073)
                     /locus_tag="MGF_RS03425"
                     /old_locus_tag="MGF_4916"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_014574763.1"
                     /db_xref="GI:504387661"
                     /translation="MVKIRLMRLGRHKLPSYRMVVVDSRVKRDGSYIELIGHIDPING
                     ANKLNGALAIEWLKKGAQPTDTVKSILSKEGIWKQYAASKKA"
     gene            complement(839130..839603)
                     /locus_tag="MGF_RS03430"
                     /old_locus_tag="MGF_4920"
     CDS             complement(839130..839603)
                     /locus_tag="MGF_RS03430"
                     /old_locus_tag="MGF_4920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_014574764.1"
                     /db_xref="GI:504387662"
                     /translation="MSYVNKKGKTTSTRLMIIRQQLSDCLSYNEIITTLTKAKETQKH
                     LEKLITSAKDNTIVNKRRAKAQLLNTQVGTADQLVAHLFSKVAPVFKDRHGGYTRVIK
                     LGARMGDATEMAILQFVDKVPKFAVKKAKKVEKTSTPKVEVKSTKPAAGTEQSVK"
     gene            complement(839612..840589)
                     /locus_tag="MGF_RS03435"
                     /old_locus_tag="MGF_4927"
     CDS             complement(839612..840589)
                     /locus_tag="MGF_RS03435"
                     /old_locus_tag="MGF_4927"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RDV6.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_011883401.1"
                     /db_xref="GI:500213225"
                     /translation="MQQFLRYNINVIKEDNDKNYGKYIVKPLEKGFGITLGNALRRVM
                     LSHLPGSSVFALKIKGISHEFGFIPGVKEDVTQIILNIKNLVVWISDNMITDETLSET
                     PIEKWPVMTIRANKAGIIKAGDIECPLGFEVFNKDLEICTLSEDAEVAIDIYATRGRG
                     FKTAAENRSEIGSLSIIPIDSNFNPIIKVGYHVEEETSDVITDKLIIEVGTNGLIKSG
                     DAIAIASKILSDHLKPLIDINKSLHDIQVLNEKNVEEKNKKLSIPIEQLDLTVRSYNC
                     LKRHGIQTVEELVTRSKSEIENIRNLGKKSVREINKKLSELYDLKLKNN"
     gene            complement(840607..840972)
                     /locus_tag="MGF_RS03440"
                     /old_locus_tag="MGF_4930"
     CDS             complement(840607..840972)
                     /locus_tag="MGF_RS03440"
                     /old_locus_tag="MGF_4930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_011113888.1"
                     /db_xref="GI:499426424"
                     /translation="MAKKKKTVASNGIAHIHATSNNSIITITDINGNAITWSSSGAIG
                     YKGAKKKTPYSAGVAAEKAAKEAMAMGLSTIKIYVNGVGRGKETAIRSLAACGLTITE
                     IHDVTPIPHNGCRPPKKPR"
     gene            complement(840982..841356)
                     /locus_tag="MGF_RS03445"
                     /old_locus_tag="MGF_4934"
     CDS             complement(840982..841356)
                     /locus_tag="MGF_RS03445"
                     /old_locus_tag="MGF_4934"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RDV8.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_011113889.1"
                     /db_xref="GI:499426425"
                     /translation="MARILGIDIPNNKRVEISLTYIYGIGKPRAQEILRKAKIDFNKR
                     VKDLSDEELALIRSVASTYVLEGDLRRDVALNIKRLMEVGSYAGLRHRRGLPVRGQRT
                     KSNARTRKGPRKTVANKKIESK"
     gene            complement(841487..841699)
                     /locus_tag="MGF_RS03450"
                     /old_locus_tag="MGF_4939"
     CDS             complement(841487..841699)
                     /locus_tag="MGF_RS03450"
                     /old_locus_tag="MGF_4939"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9R6P8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_011113891.1"
                     /db_xref="GI:499426427"
                     /translation="MKETNLSIKGVVKEIIKGDKFKVLLENNLLIEAHVSGKIRMHKI
                     RILPGDSVEVEFSPYDLTKGRIIYRH"
     gene            complement(842103..843648)
                     /locus_tag="MGF_RS03455"
                     /old_locus_tag="MGF_r07"
     rRNA            complement(842103..843648)
                     /locus_tag="MGF_RS03455"
                     /old_locus_tag="MGF_r07"
                     /product="16S ribosomal RNA"
     gene            complement(843802..844104)
                     /locus_tag="MGF_RS03460"
                     /old_locus_tag="MGF_4959"
     CDS             complement(843802..844104)
                     /locus_tag="MGF_RS03460"
                     /old_locus_tag="MGF_4959"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thioredoxin"
                     /protein_id="WP_011113892.1"
                     /db_xref="GI:499426428"
                     /translation="MKHITNKAELDQLLSTNKKVVVDFYANWCGPCKILGPIFEEVAQ
                     DKKDWTFVKVDVDQANEISSEYEIRSIPTVIFFQDGKMADKRIGFIPKNELKELLK"
     gene            complement(844161..846320)
                     /locus_tag="MGF_RS03465"
                     /old_locus_tag="MGF_4974"
     CDS             complement(844161..846320)
                     /locus_tag="MGF_RS03465"
                     /old_locus_tag="MGF_4974"
                     /EC_number="5.99.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9JN65.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA topoisomerase I"
                     /protein_id="WP_011113893.1"
                     /db_xref="GI:499426429"
                     /translation="MTNHSSKILVIESPNKVKTIKKYLTDDYEIVATVGHIRDLPKYT
                     LGFNTEDFVPKWEIIQEKKPAKGVSATKKAKTVKKAVKNKKEIIDELVDKAKKADEIY
                     LATDPDREGEAISWHVYDVLKEKGVNVNKCKRIIFNEISEKAVKNAIANPREIQKDWV
                     SSQITRRRLDRLIGFKLSSLMKSKINADSAGRVQSIALKFITEREELINKFVPRFWWT
                     LDVILKDGTELMLRKIDEKLKDKLGFKELEEVSGIDFNTKEDAELVKQHLSDKYRVYA
                     IDTPKLKSSYPKEVYKTSTLQQDAINKLKWRSMKITSVAQELYEGVTIDDEQIALISY
                     PRTDSTRLSPEYGKTVLDFVAKTYGKDYVATQSQLNGETKANKKQKAKVQDAHEAIHP
                     IDISITPDSVKNKISSDQYSLYKLIWTRTVAHYMAAAVYELVNIRFINNNNKFYAVNN
                     TLKFDGYKKIYTHYDDKDHLRKLDLNHFAIDKEFEAKDVLLNEHQTKPPARFTQATLI
                     EALETEGIGRPSTYSTILDIVLKRNYAELVNGRYYKTTDLGQKLAFELDKNFPTIINK
                     EFTKNMETTLDEIAQGTVNDVSYLQAFWNDFSEVLNEAKTNIVKKVEYIEGKNCPNCS
                     SQLVRREGRYGPFVGCSNFPKCKFIEKSEQKAKEIVYEEGVKCELCHAKLIRRVAKKK
                     GRNKDNTFLGCSNFPKCKYTKSLEPEKDETIRDSTII"
     gene            complement(846454..847101)
                     /locus_tag="MGF_RS03470"
                     /old_locus_tag="MGF_4976"
     CDS             complement(846454..847101)
                     /locus_tag="MGF_RS03470"
                     /old_locus_tag="MGF_4976"
                     /EC_number="5.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_014574765.1"
                     /db_xref="GI:504387663"
                     /translation="MSDLLFSILPMLNDYDQNKLASYKQLGLNKIHYDVMDEFVNNKA
                     FDERYVDNLKDLGYQINVHLMVNKVANHILVYAKTRCDQISFHVEPLANNKQLINKYL
                     AYIKTNNKKAGLAFKFNTDVNDYLDQIKLVDYVTLMSVEPGAGGQAFNPLVYRNIAKL
                     IKFNPKLEIEIDGGINLEKAIELKGLVSGFVSGSYFYQLSDQSKLEMLEKIRAFS"
     gene            complement(847108..848388)
                     /locus_tag="MGF_RS03475"
                     /old_locus_tag="MGF_4982"
     CDS             complement(847108..848388)
                     /locus_tag="MGF_RS03475"
                     /old_locus_tag="MGF_4982"
                     /EC_number="5.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9KX58.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_011113896.1"
                     /db_xref="GI:499426432"
                     /translation="MIKLTFNLIKGLDYKKLDKNYQAKLDEIFSQLKNKKTPSANMLG
                     WIDYVDQDHTKIYKSIDNKITEWDKLKVTDVVVIGIGGSFTGIKAILDVVAYLPSEQK
                     RQIHFIRSLSENSFLKILEEVKDKNWGIVVISKSGTTLEPSVGFKLFREALYKQYGEQ
                     AQKRIVAITDPKKGVLHDIAVKNKYEMLPIYSDIGGRFSTITPSGLLVAGLVGADYKQ
                     LIEGAKKAKADLFASSELKKNSAYTYAALRHYLYTEMKKDVEIAITYEEQHEYLMLQH
                     RQLFGESEGKSLNSLFPTYSVFTTDLHSMGQLYQDGKKIFFETVFSFEKANKNKLKLK
                     NSEFNNDDQLDYLTKKSVNQLNYVACEATKQAHASAGVPIIEIDVKENSAYGFGYLYF
                     WLCVATSVSALLLGHDPYNQPGVENYKQRMFKLL"
     gene            complement(848419..849243)
                     /locus_tag="MGF_RS03480"
                     /old_locus_tag="MGF_4986"
     CDS             complement(848419..849243)
                     /locus_tag="MGF_RS03480"
                     /old_locus_tag="MGF_4986"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ribosome biogenesis GTPase RsgA"
                     /protein_id="WP_011113897.1"
                     /db_xref="GI:499426433"
                     /translation="MIARILSINANDLFCEVNHELKKLHAPGRWKHQKINLAPNDLLE
                     LNDQGEIIKLIERKNYLNRPKVANLDHVVLVFSIKDPQLNLKQLFKFMVYFESQLGFK
                     PLIVFSKLDLDHDQNEFKKIVEALEQINYQVFKLNEPDDFLRLKNLLFNKVTIFCGHS
                     GVGKSTLLKRLDNSLDIWTQAVSAKLKRGKNTTTATKLYKFLDGYLVDSPGFSIYDLN
                     LTKQQLSCGLIEFAQYQTKCKFNDCLHLENSADCYLKKKINSLIYQIYLSVIKSII"
     gene            complement(849243..850505)
                     /locus_tag="MGF_RS03485"
                     /old_locus_tag="MGF_4994"
     CDS             complement(849243..850505)
                     /locus_tag="MGF_RS03485"
                     /old_locus_tag="MGF_4994"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="serine/threonine protein kinase"
                     /protein_id="WP_011113898.1"
                     /db_xref="GI:499426434"
                     /translation="MANNNQQVNKKKNKSNSEGYLMVNDKLFNRYVILNKLTTGGMNS
                     VIYTAKNITADSTKLNDSKKSTVVIKLVKRSPEDTNDKWAKLQQELITSSRISHPNLI
                     ATYETDDKGILIERNNRMIRINDVLVIVMEYVQGTTLRNYIISKGNLSVKEALYYFRR
                     MVEGIQKLHNYSHQIIHRDLKPENLMLSKDYRELKIIDFGISTSISTESVLKVLTNEK
                     ALYGTHEYMCPDALQKEPVLDENNKPVINPKTNTPLMRWKAPTVQYDFYAFGVILFEM
                     LTGQKPFNKKIDDKKLERPQDIINLPNKFDVPLMKAMGFDVPNSVENIVFRCMASKKE
                     DRKYRYHSCEEILADLDKVDKDQPLLKPLEKRVLQKDRQFMPTEIAVDKEPIIFKYWT
                     FWTITALVILIVLLTLGLIIFNFSGVVK"
     gene            complement(850498..851292)
                     /locus_tag="MGF_RS03490"
                     /old_locus_tag="MGF_5004"
     CDS             complement(850498..851292)
                     /locus_tag="MGF_RS03490"
                     /old_locus_tag="MGF_5004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="potassium-transporting ATPase subunit B"
                     /protein_id="WP_014574766.1"
                     /db_xref="GI:504387664"
                     /translation="MKKIYASSTHVGIVREENQDAVFVGTNQYHNIIALVCDGLGGYK
                     GGAIASTLTRDLIRDNFLSTNFNKLSDEKMEEWFKKVLLKCKKQIAKYIDEYDKQFQK
                     EHDNVSLKQMATTIVLSIIANEKIYTFWVGDSRAYLIAKDKTVNQITNDHNLYNYLKK
                     INASDVTFKANEKELLALTNIVSRDTSKVEFDTSFDFINKGDEYLLLSSDGFYNFVMP
                     EQFHDLLSLTDDMQKVADNLIQNGMNAMSNDNLSVVVVKLTEVING"
     gene            complement(851292..851879)
                     /locus_tag="MGF_RS03495"
                     /old_locus_tag="MGF_5007"
     CDS             complement(851292..851879)
                     /locus_tag="MGF_RS03495"
                     /old_locus_tag="MGF_5007"
                     /EC_number="2.7.4.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="guanylate kinase"
                     /protein_id="WP_014574767.1"
                     /db_xref="GI:504387665"
                     /translation="MVVIYIMSNKQGLIILISGPSGVGKGTIVSRLLSDNNLKLNVSI
                     SATTRKKRASEVEGVHYFFKTKEEFEQMIANNQLLEYANYVNNYYGTPLSLVKEILDK
                     NENLILEIEYQGVIQVLKKGFRTLSIFVLPPSEDELVARLKKRGTENDEVIKYRLKQA
                     VKEYAHRELYDHTIINDDLEKTIQDIKQLILKYNQ"
     gene            851953..852543
                     /locus_tag="MGF_RS03500"
                     /old_locus_tag="MGF_5008"
     CDS             851953..852543
                     /locus_tag="MGF_RS03500"
                     /old_locus_tag="MGF_5008"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574768.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptide deformylase"
                     /protein_id="WP_014574768.1"
                     /db_xref="GI:504387666"
                     /translation="MKSKLKPTNDWLVTDDNPKMREVCSEVKFPLSQEVLDIIDKMLA
                     YVDESFDDNAEKYDIRPGIGIAANQLGLNQRFFYVHFIDFCQKEHRYLLINPEWIDKS
                     LNKAYLAVGEGCLSVPKDKDGYVIRSETVKLKGFDYLTQKDVEISAHGLLAMCLQHEM
                     DHLEGKFYYDSINMMKPYFKKDEWVSIDQKVCDQCK"
     gene            complement(852614..854191)
                     /locus_tag="MGF_RS03505"
                     /old_locus_tag="MGF_5021"
     CDS             complement(852614..854191)
                     /locus_tag="MGF_RS03505"
                     /old_locus_tag="MGF_5021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="MFS transporter"
                     /protein_id="WP_014574769.1"
                     /db_xref="GI:504387667"
                     /translation="MKLSLKSGLTREQKLEKISKLTDKELFITWIIILFGYFLFVVNW
                     FLIDQVAGNFTYNPNAETSLTWAGWSQSFFFKNPGSITTAATNWTITFFRGIGSFVAG
                     WFIGRLGHKKTVLTMLGLMALSFPFIVVAYPFGGNNALVLSNSQIFYQKQGDLISGGS
                     LTKLTALGYSLFIIFRTLLAVGGTALISYTQPVIAKFSTMKTKTTLSVINSFGFNIGA
                     AFSLGLFTYSMTIKMEAVKSWYVVCAAFILIIFATFILYFIFGKETVLPKEKHTRMEP
                     EVTIMSTLKNKNVIKMCLMYGAWLVAVVWILTGTYSNSVIGTSPYNVGGKLFWVGNTS
                     KIAFVLGLVAGLFVIAPFGKTRYDRSRFLMTQYSLGMFFVVVAFVLGFVGANKNIGLA
                     IGEIIASFLAGIFLWGLQGVFLLIPHEFKGASPSKVGTQFGIIWGVGYMLYTASDILL
                     SVIVESPSFANKSYVDSINPASITAFAVYVIISMVFVLIALVLPKSGRIVNGEWVPLT
                     DKWPFMSYNFYKGDIFK"
     gene            854513..856348
                     /locus_tag="MGF_RS03510"
                     /old_locus_tag="MGF_5022"
     CDS             854513..856348
                     /locus_tag="MGF_RS03510"
                     /old_locus_tag="MGF_5022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein"
                     /protein_id="WP_014574770.1"
                     /db_xref="GI:504387668"
                     /translation="MNKFIVVGAGHAGLEAAFILSKLNNKVYLCVLDRKYVANCPCNP
                     SVGGPAKGIVTREIDALGGIQALAADSTALQRKILNSSKGPGVQCLRFQIDKVYYKKW
                     FLEQIDNNENIELVEGEVTEVIKNGDTATGVMIDGVKKLEAGAVIITTGTYLKSLTFS
                     GKDVKNEGPEGFKNSNNLSEWFKVNGFELIRLKTGTPPRIKKDSIDYSNLQIEPGNGT
                     ELYFSHWSKNKYIDYELPCYLIHTTEEIHKIINDNLHLSAMYSGNITGVGPRYCPSIE
                     DKIIRFSNKPRHQIFLEPESLELDTVYLGGFSTSLDISVQDKIIRLLPGLKKAEVIKY
                     GYAIEYDAINPIQLYPSLESKLVKNLFFAGQINGTSGYEEAAGQGLIAGINANQKIKN
                     KEPLILSRDEAYIGVMIDDIVTKGVTDPYRLLTSRAEYRLLLRNDNVLDRLIQKGYEI
                     GTISKEQIDLYNQNLERKNKLIEFLKDKKVGMYTLLRAHTNNTNFSLYEFLKRPEIKL
                     IELLKLIEFDYSNYDLELLKNIEITVKYEGYIKKESRIVNSLKNLESIKIPQDLIYDK
                     VQNLSIEAIDKLNKIKPLNLAQAQRISGINLADIISLKTHLEQNA"
     gene            856341..857069
                     /locus_tag="MGF_RS03515"
                     /old_locus_tag="MGF_5028"
     CDS             856341..857069
                     /locus_tag="MGF_RS03515"
                     /old_locus_tag="MGF_5028"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_014574771.1"
                     /db_xref="GI:504387669"
                     /translation="MLKLIKDSLGKFNLTLTDKQIEDIAFFLEEIYHSNQLFNLTGYK
                     TKELIAEMLGVKTILLAQSLSYIFSNQSLNVIDIGTGAGIPGLIIKIIYPQLNVYLVD
                     SNAKKITFINEVIKKLNFTGVFAILSRVEDNFFLKKYHGCFDYVFSQAVSKIAVLNEL
                     GTQLLKINGQIIHFKSRDYQEEIEFAKKHLSDLGLAFNNLYHYQFNSYFLVNVFYNKK
                     AIAPQKYPREWSKIKRELIDDAKH"
     gene            856975..857784
                     /locus_tag="MGF_RS03520"
                     /old_locus_tag="MGF_5031"
     CDS             856975..857784
                     /locus_tag="MGF_RS03520"
                     /old_locus_tag="MGF_5031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113905.1"
                     /db_xref="GI:499426441"
                     /translation="MFFIIKKLLLHKNILESEARLKESSLMMQNTKFITITSTIKHSA
                     KTSTAIGLVISLVTEGYKVLYLGFDNKYNALPNFEDDADLVKDYILEKIILERAIRHF
                     YSFYPFDMLNINADLVKLFKNATDKQQARIISKLFKDIKAERYHYVVIDLNYKDKPVH
                     NTIVKLSDHCFYTINVKRYEEEKNHLDINSFLTVVPKKEHVKLLVVQFNRFMVDHHKF
                     IENLKYIYGDFVFDYQIDSSRTMRNRIDHAYNYLRVNKLCTPIKKYIIESK"
     gene            complement(857816..858376)
                     /locus_tag="MGF_RS03525"
                     /old_locus_tag="MGF_5037"
     CDS             complement(857816..858376)
                     /locus_tag="MGF_RS03525"
                     /old_locus_tag="MGF_5037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574772.1"
                     /db_xref="GI:504387670"
                     /translation="MGINDTKFDIVSRKIKSLRRRTKFLSAYSLIWIIFNLCLIFAVI
                     ISAVQYQQKMVDFDKGMVTKEVVENQKLFLIIAIILISTINLILFLIKVILTHLFYQK
                     NQELNEFYPDKFSRLNKILRIGGYLPLIGLLAYFRILKKAGEIWVELQTDLVKKKSEI
                     NINDLKNTPNQKVENSSKELIKTEDK"
     gene            complement(858401..859204)
                     /locus_tag="MGF_RS03530"
                     /old_locus_tag="MGF_5043"
     CDS             complement(858401..859204)
                     /locus_tag="MGF_RS03530"
                     /old_locus_tag="MGF_5043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transcription termination factor NusG"
                     /protein_id="WP_011113907.1"
                     /db_xref="GI:499426443"
                     /translation="MSKKSTAQWYIATTTNGNEDSVIKTLKAKVRALHFEDQILDCKV
                     IKFRSVEETIFDSNNPTHNIPATMRNSTYIKWVTVDNGVYKKYKITDTNKYPGYIYIK
                     MEMNEAAWFAVRNTVNITGIVGSSGKGAKPIPISSSEELDLLNGESFDQNYRIVITPN
                     AIIEMDRNLFNERGELILDENAAKTIVHKKKSDSADKYGDMSTEKEQVDEAIELKVGH
                     MVDINSGDYSGLSGQISRIIDNDEYIVDVQILGKLVSVKLNKKQLKLSV"
     gene            complement(859227..859613)
                     /locus_tag="MGF_RS03535"
                     /old_locus_tag="MGF_5046"
     CDS             complement(859227..859613)
                     /locus_tag="MGF_RS03535"
                     /old_locus_tag="MGF_5046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_011113908.1"
                     /db_xref="GI:499426444"
                     /translation="MGKIMDHKNKNINLRKNPKVILESYQDDNIKKEQQKIKEEALEQ
                     KKLKEEREEQEYREQLQREKKNKGSLGLRLKRWWFGMEKESRRITWCTPKLLITNFLI
                     VIAIVAFLTGLLFGIDQIFSAIGILK"
     gene            859979..860812
                     /locus_tag="MGF_RS03540"
                     /old_locus_tag="MGF_5048f"
     CDS             859979..860812
                     /locus_tag="MGF_RS03540"
                     /old_locus_tag="MGF_5048f"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_014574773.1"
                     /db_xref="GI:504387671"
                     /translation="MIKKMCKKDNKTNQTNEFLVEYVKQFYYDNTNALLNLTDSIARP
                     VLQTLVLIEHKAKLALLKETIKDQKVYQNGLYTRKVKWGDKSFPIKISRLRYENQSSK
                     IVVKYQRSFDTKFIFDIISLASNDLSDNEISNQLTNLYGFQLSEELFLEYLKQLRPDT
                     KKWHSKSLHNNYKTLLLDLKPFKIKINEDQNVKFKNKVLYLVVAINHQNKSELISFYV
                     NNKETEQNWSHVLEKLKKRGLSEPELVVYKKSQLLKEPLDKIYPKAKQIVCADQIIND
                     L"
     gene            861189..862847
                     /locus_tag="MGF_RS03545"
                     /old_locus_tag="MGF_5055"
     CDS             861189..862847
                     /locus_tag="MGF_RS03545"
                     /old_locus_tag="MGF_5055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574774.1"
                     /db_xref="GI:504387672"
                     /translation="MSVKKLSINLDKFKRLFKIPNNNIFYELKSEVVSIKQNAKLVLF
                     YRLLIFSILFSFSVGFIMEPARLFLVNLIPQRDAAGNMMQQAAIDPNRFPITALFQFQ
                     NPTFQSINFYILLRLIGLYLVFITSLWWNYQNISSINHRIKRYWIWFIIYISLSIISG
                     ALLLGWTNNQSSLVTVLGICSLNVILVVLNYTYWLISYFLNKKIQPISNKNLFIILIS
                     YSAKVISWIILFIFLDQLIKGGQDDLIIFNNNKVIDFINSLTTGLSPTRVVLLFVLIT
                     LSISLFILSNLYTLLNLKLFFVKLINDDLKNKAYGTIGFSFIILTTLVFGVIRVLVEG
                     KYPDNSLINTNNVDLVTNWFWIVGTLLFLTYWLVYFFVIRRNKTPVINNIYHSGSLLL
                     IWSTFIASDFNRTNFDTANGYISLLIITLITLFVILTYIVSANKQSAGIIISLSLVSV
                     FIVASVFLITFNNTLINNQNFSLKSLNSDLSINQILYALLAIILSLNFIYVVLSIYFI
                     YFFINKNKIFNFKKIKIVQHQEETNQKDSGQTNQELNNQSGVNS"
     gene            862847..863344
                     /locus_tag="MGF_RS03550"
                     /old_locus_tag="MGF_5063"
     CDS             862847..863344
                     /locus_tag="MGF_RS03550"
                     /old_locus_tag="MGF_5063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113912.1"
                     /db_xref="GI:499426448"
                     /translation="MKNKNKNNTVQEEIIETSYPSLVQHEDFVEFSQLFNTALLQTNT
                     DESSPQAKLFIEKLKQAVANHLQIVFDSFIISWTKNIRFSFTKLIPAVTTVESSQTDG
                     VNLRSDLTENKHLKLLAERFNLLMNHQLFDEHKIVEVVDGIIVYRSKETNQLKVVFSK
                     EIINA"
     gene            863351..864295
                     /locus_tag="MGF_RS03555"
                     /old_locus_tag="MGF_5067"
     CDS             863351..864295
                     /locus_tag="MGF_RS03555"
                     /old_locus_tag="MGF_5067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574775.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574775.1"
                     /db_xref="GI:504387673"
                     /translation="MDIKKLERKQVSLKNIYTLVSSKRDIALIKIFKLSKRFEYFYKR
                     AINSKTLLDILHKKFNLKNPFYEESSLLANNKLINLTLDKVENMFFVSKKRLWIYVTE
                     TQNAAADNYSRYDRAILKHENVKEDQFITIGEHAKNFCLKNKLEVVKHYPENDYDELS
                     KMIPEIIRLKIESGDIIDINFVINSNKIKNKFLKILPIKHFELDTSYYEKADTIVENI
                     EKYKLYNNLQEFIVNEINSYLRNVVTSLLVESSLIVAKNNLVKYNKTISDLDETLLNL
                     RREILKQKRELEIQELQMLTRSNESMINMESKKDGDMD"
     gene            864299..864790
                     /locus_tag="MGF_RS03560"
                     /old_locus_tag="MGF_5073"
     CDS             864299..864790
                     /locus_tag="MGF_RS03560"
                     /old_locus_tag="MGF_5073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011883437.1"
                     /db_xref="GI:500213261"
                     /translation="MAKHNFKTVPSEIEFIRFNNKLFSYKQGYFMLNVNQIDEWDLIQ
                     DNSLISVENVFFKIYDPVADEEDYYIIRNSFIKIENNKVTIYSDDHFEPLRIDYKFKI
                     KKYDDMLAEFNKKLSYYESKINLGLDFQELIDYNAVRKEKRYYSLIRNFNLAEKKVDK
                     NEK"
     gene            864780..867014
                     /locus_tag="MGF_RS03565"
                     /old_locus_tag="MGF_5077"
     CDS             864780..867014
                     /locus_tag="MGF_RS03565"
                     /old_locus_tag="MGF_5077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574776.1"
                     /db_xref="GI:504387674"
                     /translation="MKNKSKLKRLIYWQFGFMIPAVFASALSGVITRHKNSNNEYQLV
                     NQAGEGLDPSTPTQPNDPNAPVANNNNGRADQAQEKPRQPANLATLKTDIDDKMSNTI
                     GEFIQAIFLGKDNLIDQRIAAIQNQSDLSFEEKFNKTLYYSQIKAFFAKNQNEIKTNP
                     SKFGLDIVYPYVLSANAEFNKGKIVFNNKTYENKIWGNTDTTNYKKEVTGEGNSITPN
                     ADPQKAKVQNTTSDEEGKNVLKTYFNALKQSATSIFLNDSDLPGVGKDYDINGRVTDT
                     NDAGVFSNPPKNFNSWDDYIISKIRPRFIDFDLEQNKDPAEQDQQNQQNNQAVENLFT
                     PTVPVEGKQVPTDPKELIENIPRFVPKVRSLYSTLSSSALLNRFGTYNEANKSDVFFY
                     FENPINTRFTYKVTALNNNNGKVNATVQIQDSVDKNATTTYTRELDTVGLSGTEQQIN
                     QNRELAYPAMQKLFLNFYEAVGLNADLNYGDATKVYVEPQTIFQMVYLAMRAINKPEF
                     KDDLNIILSRSFGYSTEQSNSYFLNFLRNQLVNTQFLYWQLVSEMYKRIFIAFIRDFN
                     KENLKPKLIALLEQNNVSINQFNDSFAEARRKLLRLDSLTKQTIGSPQIQFDSLVTQI
                     KEMNKTLRPFNLVYDSISNQANGDAEKEAGLAAALKSFSTDINNILANSRSIANPFLI
                     MLAVFLGIISISLYGFHFMQLAFNKTKQISKLNKPLIITVLIIASIALVSTALIALKI
                     IGVF"
     gene            867024..868556
                     /locus_tag="MGF_RS03570"
                     /old_locus_tag="MGF_5091"
     CDS             867024..868556
                     /locus_tag="MGF_RS03570"
                     /old_locus_tag="MGF_5091"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113917.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The alpha chain is a
                     catalytic subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="WP_014574777.1"
                     /db_xref="GI:504387675"
                     /translation="MNPKIVAALDYVIQVEGRFEYQQNQVFTIRNKPNFRAMVISATT
                     DTGFLIVDAANADFEIGDEIIPTNSDNNVKTTKQYFGNIIDIDGNILYPKKYKPEFQA
                     NSLSSNAFAPSRNLLEVNRLNEQLYTGIMAIDLLMPIGKGQRELIIGDRGTGKTHIVL
                     NAIINQTIRKTNVKCIYVSIGQKRQNVADVYETLKKHGALENTIIIDAPATNSYHQYL
                     APYVAMAHAENISHFQDVLVIFDDLTKHANIYREMSLLVNRPVGKEAFPGDIFFSHAS
                     VLERAGKFADRKSITCLPIVKTVNNDITSLISSNLISITDGQIVTNTDLFANGILPAI
                     NIDLSVSRLGSSVQSSVIAKVASQINKKYRAYKRQSKLWTLKYDLNEETADLISKGKA
                     IEQLFIQKGFAPYTERFMLLITKLILWGTLRKVDNKAQEALSFINALIDTDPIAKWIY
                     DHLESGQDFNDDLMRNFFEYSLSQYFKYKNYDLQIDVDKKFIDFKPEELQAIVNNMKG
                     AL"
     gene            868556..869956
                     /locus_tag="MGF_RS03575"
                     /old_locus_tag="MGF_5097"
     CDS             868556..869956
                     /locus_tag="MGF_RS03575"
                     /old_locus_tag="MGF_5097"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574778.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="F0F1 ATP synthase subunit beta"
                     /protein_id="WP_014574778.1"
                     /db_xref="GI:504387676"
                     /translation="MIGHITKIWNNVVEATFKKEELPKVDFILTLHNNTCVLLVKRII
                     DDTSVRAIVIYQKQSIKIGDQVVNTNDTLKVPVGQAAKNNIYDISGVPMLQQRAKGIK
                     YIEMNSTIRKEKKIYSKHEILETGIKAIDFFMPILKGHNLGILGGAGVGKTVLMKEII
                     FNSSRSNSAKKNSSIFIGSGERSREGVELYQELEQSDLMKDSMMFISKMDEPPGARMS
                     IVPYGITAAEYLRDVEKEDVLLFIDNIFRFIQAGNEVAPGLNKKPITGGYQATLDTEV
                     SNVEDRLYATEDGSITSFQTLFLPMDDLADPSAVSIFSNLDGSLVLSREQTSKNIFPA
                     FDPLASSSSSVSPDIIGQRHYNAIIEVKSILQKYRDLEDVILILGIDELDKDNKIIVK
                     KALQLQNFFTQNFFVAEAYTKAKGVYVPLEETLESVIRIVEGKYINQSPEIFSFIGSN
                     LNLPTDEELNLNKVDL"
     gene            869993..871828
                     /locus_tag="MGF_RS03580"
                     /old_locus_tag="MGF_5110"
     CDS             869993..871828
                     /locus_tag="MGF_RS03580"
                     /old_locus_tag="MGF_5110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574779.1"
                     /db_xref="GI:504387677"
                     /translation="MTKRWTKYLAVSLSSALIFSSCTNAKNEPDPNTMDGSSTTPGNN
                     NGNQLYSINPDIDNINQPIPAKNQWRNQVVDNQRVVADQYPNFAATTNFVNYYLYNNK
                     NTQKPSFWLKDRADKSHVSPFILTNAQLKAINDKAKTIDQPNYQDAYAYGFGLPGIDK
                     DKKTLNDTIDVINDTNSTVSIPYYNVRGNNLASIDPGRSWMIANKKYQQLSKITYSIR
                     ITNELSDSPIKQDNSNHVSENAGDNVGNWSGTAWLLDYDLTSDNSYPTTWYFASNFHV
                     LQHLQLAGDSQALIRNNNAHTTKIELFQLDQSKVKLGERISPQQAQGINFQDPYLKVN
                     SINPSSVKTVFLGNDALKQTTSSFTQDAKYQAAQTLLDFGVIRVTFDSAETAKSVTND
                     YAEWKEEDKFKPAKYSYLDDAKYESLPANSLYALGFPTSRGDGILDTRIYGNIDNLRT
                     PWINKPQNTNGVSEGGGDFSWNVTSRSFVNKPGITDIFLTNPKIGQEANSFYNANKTD
                     FAHTGLGYLIDHYDITPGGSGSPIVNSNNEIVGLVFASDNDVNTGISLALHSEGFNYQ
                     NYYGNYNLPKYDLIYGTNDENQTKSYHQGLRLINPGKNINTWLFH"
     gene            871919..873958
                     /locus_tag="MGF_RS03585"
                     /old_locus_tag="MGF_5120"
     CDS             871919..873958
                     /locus_tag="MGF_RS03585"
                     /old_locus_tag="MGF_5120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574780.1"
                     /db_xref="GI:504387678"
                     /translation="MIKAKFRTFKYLFTLLSVSSIIVASCNTGKNSPEDPPNEERKPN
                     PSDPSNPNNDGNPFGPGGGSSAANSISLPDPQVNNAIINGKRVVANQYPNYDAYINLN
                     NVSKARGEGPVSDTSTPNAGVTNPNDIPPEKLKEYDDKAKKLGLPTYRDAFGYGFLLP
                     NIGEDGTIGSGLVQRKDLKGPNLIPAYQPGVLGTGLNFINLADSTGFLGLPRTILNDH
                     YRDFSKTVYSLYYSNILSDPVKSRESEKLTDEQKIDQKLQSYLGTTWILDYKLAENGK
                     YPTTWYFASNMHVLENLLLPDIAGTSNDFRDFEHRNYEARTNFASLTFANYWNKDVTP
                     TGSRFATTQPNAVTTLNYIKEQNVDEITITTQEQFDKISTPYVRVNIHPKNIKPIFLG
                     ADFLKDSSVPSERGRYSDAKTMIDFGVIEITFNNEQIAKWLTSDYANWPADKKYKFAS
                     SSLLDDKTYTDLKQNDLYAIGFPNSYDDYKIRYLGSDGENIIADRNYVSFWSNKSGNY
                     YANSNPTKFLRDHKEQGGDLSWSNTRTFVNKPGVTDLFLSYPSFDGSPKIYSRMKYVN
                     TGLGYLINNYVPSGGASGTRIIDSNGQIWGILYGVAKTGTSGYVTALRSEGMNYDGLY
                     GSYNLPQYDLVYGGGKDQKDSYLDQMIKRRANEKTWLFPNGVNRNNVPDQFKFKN"
     gene            874089..874493
                     /locus_tag="MGF_RS03590"
                     /old_locus_tag="MGF_5128"
     CDS             874089..874493
                     /locus_tag="MGF_RS03590"
                     /old_locus_tag="MGF_5128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-directed RNA polymerase subunit delta"
                     /protein_id="WP_011113921.1"
                     /db_xref="GI:499426457"
                     /translation="MASLIDKAYEVAQKNFVKKEFTFNDLWKLVVKDENFNKKDAQEL
                     IGAFYTDLIQDTRFVYVGDQKWLIKSMMLHDEWAKLSETLHNQQEYLEEGYEHVKVQV
                     EVDESSPEISNEGEESSLIDDNIIVDSTEEEN"
     gene            874500..875372
                     /locus_tag="MGF_RS03595"
                     /old_locus_tag="MGF_5131"
     CDS             874500..875372
                     /locus_tag="MGF_RS03595"
                     /old_locus_tag="MGF_5131"
                     /EC_number="4.1.2.13"
                     /EC_number="4.1.2.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883450.1"
                     /note="catalyzes the formation of glycerone phosphate and
                     glyceraldehyde 3-phosphate from fructose 1,6,
                     bisphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_014574781.1"
                     /db_xref="GI:504387679"
                     /translation="MSKLVNAKAMIQKATKEGYAIAHINTNNLEWTRAILLAAQETNA
                     PMIVAASEGAVKYMGGYQAVYHIVNDAINNLNITVPVALHLDHGTYEGVFKALEAGFS
                     SVMFDGSHLPFAENYEKSIKVIEAAKKYNASVELEVGTIGGEEDGVVGNGELANPQEC
                     KKMKDLGCDMLAAGIGNIHGIYPPTWKSLNFEVLSELKKASDASLVLHGGSGIPNEQV
                     KKAISLGVTKVNVNTECQLAFASATRKYILEEKDLDQHKKGYDPRKLLKPGFEAIKAT
                     CIEKIKLFGSENKA"
     gene            875383..876486
                     /locus_tag="MGF_RS03600"
                     /old_locus_tag="MGF_5136"
     CDS             875383..876486
                     /locus_tag="MGF_RS03600"
                     /old_locus_tag="MGF_5136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003353437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_014574782.1"
                     /db_xref="GI:504387680"
                     /translation="MLKAGIIGLPNVGKSTLFNAITNANSLVANYPFATIEPSFGIVE
                     LLDDRLNQLAKQIKPDKVVYATIMFVDIAGLVKNASKGEGLGNKFLSNIREVDCLIHV
                     VRCFDNKNITHVHNHVDPVNDIETINLELIISDLEIVDNRINKIKRKYESGDRTVVVE
                     YELLTKIKKTLELNQMLDLSEYTQEELTIIKNFNLLTAKPRIYVGNINDKYLTDPLKS
                     PHVQALADFCQKHSEQYLTISAEIEQEISNFFGQGKELEEITELFGIKETGLNKIAFK
                     AYEMLGLCTFFTYGKKEVRAWTFKKNSLAPTCAGIIHSDLERGFIKAEVIYWSDLIQY
                     GSELKAKEAGKLRLEGKQYVVQDGDVITFKFNV"
     gene            876548..877222
                     /locus_tag="MGF_RS03605"
                     /old_locus_tag="MGF_5141"
     CDS             876548..877222
                     /locus_tag="MGF_RS03605"
                     /old_locus_tag="MGF_5141"
                     /EC_number="2.7.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8RLE0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="thymidine kinase"
                     /protein_id="WP_011113924.1"
                     /db_xref="GI:499426460"
                     /translation="MAKKNAMTTTNGWIEAICGPMFAGKTDELIRKIKRYEYADVKSL
                     VFSPATDTRSAQEIINSRDGRRIGSIKIKKAFEIYDYVLLHKPQLVGIDEVQFFDDSI
                     VEVIQTLADNQINVIVAGLDRDFRGEPFGPIPKILGIAESVIRLTAICSECGAEASRS
                     QRLIDNQPADYNCETILIGDTESYAPRCRHHHKVPNRPINDQTKNFKRALKNNFDKIV
                     EQSSKD"
     gene            877315..877764
                     /locus_tag="MGF_RS03610"
                     /old_locus_tag="MGF_5148"
     CDS             877315..877764
                     /locus_tag="MGF_RS03610"
                     /old_locus_tag="MGF_5148"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q8RLD9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_036447504.1"
                     /db_xref="GI:738498572"
                     /translation="MAKKEITRIAKLELIGGQAKPGPALASVGINMGEFTKQFNEKTK
                     DRMGDVVPVIITAFNDKSFLFELKTTPVTVLLKKAAKIESGAKNPKTEKVGKISKAEA
                     LKIAEYKMADLNAYDTEAALRMIAGTAKQMGLEIEGVDPVTKSKKGS"
     gene            877771..878451
                     /locus_tag="MGF_RS03615"
                     /old_locus_tag="MGF_5150"
     CDS             877771..878451
                     /locus_tag="MGF_RS03615"
                     /old_locus_tag="MGF_5150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_011113926.1"
                     /db_xref="GI:499426462"
                     /translation="MAKKLTKKTKAALGSFDPKQIYDLDKAIEIAKKTATTKFESSID
                     IAIKLNLDTTKADQQLRGAISLPHNVSKPIRILAITDQQAEAKQAGADFVGEIDKINE
                     IKAGWMDFDVIITNPKFMIELGKLGKILGPKGLMPNPKTGTVTQDIATAITEYRKGKK
                     EYRTDTFGNIHMTVGKQSTDTNKIVENANALIDLIKSRRPSAVKGVYIQNISVSSTMG
                     PGVKVKIN"
     gene            878477..879028
                     /locus_tag="MGF_RS03620"
                     /old_locus_tag="MGF_5155"
     CDS             878477..879028
                     /locus_tag="MGF_RS03620"
                     /old_locus_tag="MGF_5155"
                     /EC_number="3.1.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_011113927.1"
                     /db_xref="GI:499426463"
                     /translation="MKLIVGLGNPGFEYEHTRHNIGFKIIDKLLDVLNLELNKSQFNG
                     LYVKHDDFIIAKPLTYMNLSGNFIRQLVNFYKIQIDDILVIHDELAFNLGVVRLKQNG
                     SANGQKGVANIISQLGTQNFKRLRVGIKNEDLKNIASFVLSKFAPNELILLESAIASA
                     SVIAYDFLKSNKSFSKLMNEYNQ"
     gene            879012..879875
                     /locus_tag="MGF_RS03625"
                     /old_locus_tag="MGF_5157"
     CDS             879012..879875
                     /locus_tag="MGF_RS03625"
                     /old_locus_tag="MGF_5157"
                     /EC_number="6.3.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7NAI9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_014574783.1"
                     /db_xref="GI:504387681"
                     /translation="MSTTNKKQYLIGVSGGPDSIYLLDRYQDQIKVACHINYNKRPTA
                     LHDQLIVSDYCLKNKIPLEILSVSPSYQYHKNFQDQARKIRYDFFLSTGLKYQVDQCL
                     IAHHKDDFLETAIMQYDKNQEQLFYGLHQDSSYQSLKIFRPLLNLWKDEILSYLEKDK
                     IVYGVDESNFLLTYQRNKIRTNLSKLTQEQKQAQLDFFLELNKKNQVRYQSVKDFFSS
                     WDCNYLDLINSLEYYNLLYLWFSKNNIKYSKQKAENILSFLQKKNNKRFRLKAGVFLI
                     KEGIKLKIVKL"
     gene            880114..882147
                     /locus_tag="MGF_RS03630"
                     /old_locus_tag="MGF_5160"
     CDS             880114..882147
                     /locus_tag="MGF_RS03630"
                     /old_locus_tag="MGF_5160"
                     /EC_number="2.7.1.-"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="PTS fructose transporter subunit IIABC"
                     /protein_id="WP_014574784.1"
                     /db_xref="GI:504387682"
                     /translation="MSIKERGDPKTMEINKPEFVFINLKQKNRDDILKELATRAVKLN
                     LATNQDELYQAFLAREKESSTALPDLFGIPHARTAAVKQPALLFAKLHQAVVWDEEKK
                     QVQYLFVILVPQDASNTHLEIISNVAKLIMDKNANQKLISSNNPDEISKLIVSYLNSS
                     ATQTTNNNSEKLILALTACPVGVAHTYLAAEKLSEAATKMGYRIKVETHGSVGAKNPF
                     SEEEIKNADIVIVAADIGLDTSRFNHKRVFQTTIKPAIHEPEKLINEAFNKATTLNQK
                     GSNQTTLGQDAKRPGIMRHILSGVSYMVPFVILGGICIAIAIGVGKLIYGQQYNAVEG
                     DFFFYLLKIGVVAFTLMIGALGAFIANSIGGRAAISPAFIVCVLANTPEAIFPIAGIK
                     VVTAMGFIGSIFFGLAIGFTVKWINTWRINKALAPIMPVFVIPLGVGLFYALIAVFVL
                     GAPIGFIMDKFIKALEEAFRNGNIGIGLGIGLGILIGAMTGFDMGGPVNKVAFLTCAT
                     LITSNIYEPMGMMAAAIPIAPLGMGLCTLIFRKKFNEGEKSLGISAILMGTIGISEGA
                     IPFAVADPKKAIISNVVGSVVAGAIAGAFGVTCAAAHGGPIVGFLLAVSSNRPQGLAW
                     GLSFFFLAIIIGSLVTCFMYGFWRTKPAEAGVVLPVNKWTFWRKKKANLNIQG"
     gene            882150..882596
                     /locus_tag="MGF_RS03635"
                     /old_locus_tag="MGF_5170"
     CDS             882150..882596
                     /locus_tag="MGF_RS03635"
                     /old_locus_tag="MGF_5170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_011113930.1"
                     /db_xref="GI:499426466"
                     /translation="MKKKIFKDQKQKNKFLFYLLLVITLVALLIGIILLALNTANYND
                     QVARTRDYLVLQTDKSSIENANFNMQGLMLGKFKDTLMNVKNQAELNTTVAKIIQDNQ
                     LISTIDAPAFAYGIFMVLVGILTGLATILFGNSTFNKKYQKEDAQA"
     gene            882583..883494
                     /locus_tag="MGF_RS03640"
                     /old_locus_tag="MGF_5173"
     CDS             882583..883494
                     /locus_tag="MGF_RS03640"
                     /old_locus_tag="MGF_5173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="WP_041594420.1"
                     /db_xref="GI:753838803"
                     /translation="MHKPKILKLLPHFEYRVWSGDKIKTLFNLDQEKIGEAWIISALE
                     NKSAKISENQTLLQFYQDKDNAYFFNSYNLKNQYPLLVKIIDAKADLSVQIHPDDAYA
                     KQFNSLGKTECWYILDTKKDNQIVFGHQAKTLDQFKSMVDHKQWNDLLLRKPIKKDDF
                     IYVPSKKLHAIKADTLIYELQQSSDITYRVYDYDRLDKGKKRELHLEHVFNLVDCPDL
                     DLSKEEISNTSDYLVANKLFNLIKIENKDQNTYKFDDAQWVQLTVIKNHGTINNLQAN
                     LYDSFIIAHNEPIVIKGDLTCLISYIK"
     gene            complement(884590..886023)
                     /locus_tag="MGF_RS03645"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(885932..888122)
                     /locus_tag="MGF_RS03650"
                     /old_locus_tag="MGF_5200"
                     /note="serine protease; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            888602..892411
                     /locus_tag="MGF_RS03655"
                     /old_locus_tag="MGF_5203"
     CDS             888602..892411
                     /locus_tag="MGF_RS03655"
                     /old_locus_tag="MGF_5203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CRISPR-associated protein Csn1"
                     /protein_id="WP_014574789.1"
                     /db_xref="GI:504387687"
                     /translation="MNNSIKSKPEVTIGLDLGVGSVGWAIVDNETNIIHHLGSRLFSQ
                     AKTAEDRRSFRGVRRLIRRRKYKLKRFVNLIWKYNSYFGFKNKEDILNNYQEQQKLHN
                     TVLNLKSEALNAKIDPKALSWILHDYLKNRGHFYEDNRDFNVYPTKELAKYFDKYGYY
                     KGIIDSKEDNDNKLEEELTKYKFSNKHWLEEVKKVLSNQTGLPEKFKEEYESLFSYVR
                     NYSEGPGSINSVSPYGIYHLDEKEGKVVQKYNNIWDKTIGKCNIFPDEYRAPKNSPIA
                     MIFNEINELSTIRSYSIYLTGWFINQEFKKAYLNKLLDLLIKTNGEKPIDARQFKKLR
                     EETIAESIGKETLKDVENEEKLEKEDHKWKLKGLKLNTNGKIQYNDLSSLAKFVHKLK
                     QHLKLDFLLEDQYATLDKINFLQSLFVYLGKHLRYSNRVDSANLKEFSDSNKLFERIL
                     QKQKDGLFKLFEQTDKDDEKILAQTHSLSTKAMLLAITRMTNLDNDEDNQKNNDKGWN
                     FEAIKNFDQKFIDITKKNNNLSLKQNKRYLDDRFINDAILSPGVKRILREATKVFNAI
                     LKQFSEEYDVTKVVIELARELSEEKELENTKNYKKLIKKNGDKISEGLKALGISEDEI
                     KDILKSPTKSYKFLLWLQQDHIDPYSLKEIAFDDIFTKTEKFEIDHIIPYSISFDDSS
                     SNKLLVLAESNQAKSNQTPYEFISSGNAGIKWEDYEAYCRKFKDGDSSLLDSTQRSKK
                     FAKMMKTDTSSKYDIGFLARNLNDTRYATIVFRDALEDYANNHLVEDKPMFKVVCING
                     SVTSFLRKNFDDSSYAKKDRDKNIHHAVDASIISIFSNETKTLFNQLTQFADYKLFKN
                     TDGSWKKIDPKTGVVTEVTDENWKQIRVRNQVSEIAKVIEKYIQDSNIERKARYSRKI
                     ENKTNISLFNDTVYSAKKVGYEDQIKRKNLKTLDIHESAKENKNSKVKRQFVYRKLVN
                     VSLLNNDKLADLFAEKEDILMYRANPWVINLAEQIFNEYTENKKIKSQNVFEKYMLDL
                     TKEFPEKFSEFLVKSMLRNKTAIIYDDKKNIVHRIKRLKMLSSELKENKLSNVIIRSK
                     NQSGTKLSYQDTINSLALMIMRSIDPTAKKQYIRVPLNTLNLHLGDHDFDLHNMDAYL
                     KKPKFVKYLKANEIGDEYKPWRVLTSGTLLIHKKDKKLMYISSFQNLNDVIEIKNLIE
                     TEYKENDDSDSKKKKKANRFLMTLSTILNDYILLDAKDNFDILGLSKNRIDEILNSKL
                     GLDKIVK"
     gene            892479..893405
                     /locus_tag="MGF_RS03660"
                     /old_locus_tag="MGF_5229"
     CDS             892479..893405
                     /locus_tag="MGF_RS03660"
                     /old_locus_tag="MGF_5229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CRISPR-associated protein Cas1"
                     /protein_id="WP_014574790.1"
                     /db_xref="GI:504387688"
                     /translation="MQLPHPPEHLCSGFLFIMSKKVLEVSETEFISLHLDTLIVRKHG
                     ARVTLPLKTLDTILITNPYCNISVPLLNKIVENNINLIVCNTKFQPTMQILPISSYYS
                     NKNYLWQIRWTDEQKNQIWKQLVKLKIINYARLINHLNITTDDNIEKLTNYYTNVVDG
                     DLNNCEGHAAKLSFKLLYGEDFSRSQKDDIINKYLDYGYIVLMTYVSRTLVKNGLDNR
                     IGIFHKSFNNHFALSCDIMEPFRPIIDYLTFSYLIKNQNDDFKSYKKDLFISFENFIF
                     PNGKNLNQVIDMLIKAIINNKINERDFNIDWS"
     gene            893416..893721
                     /locus_tag="MGF_RS03665"
                     /old_locus_tag="MGF_5234"
     CDS             893416..893721
                     /locus_tag="MGF_RS03665"
                     /old_locus_tag="MGF_5234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="CRISPR-associated protein Cas2"
                     /protein_id="WP_036447506.1"
                     /db_xref="GI:738498574"
                     /translation="MRIVIFYDIYETEEVDKLAKKFRDNLISLGYFMIQYSVYCKCIG
                     SHTMYDYEIKKIRKILPVKANVRILLLSEKQYQNMLIISGEKNLNEIYNDREDYIEI"
     gene            893721..894485
                     /locus_tag="MGF_RS03670"
                     /old_locus_tag="MGF_5235"
     CDS             893721..894485
                     /locus_tag="MGF_RS03670"
                     /old_locus_tag="MGF_5235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574792.1"
                     /db_xref="GI:504387690"
                     /translation="MKIKIHNQEIDNFNGLLLIDVKNTSEYLKRLFMYEKQHETSVFE
                     INNVNVDISDCLIITPFSKYSDLISYTAKNVFTKLLGNINFEHDKILNEEYLDKEVVA
                     KLNETLGRDIISLDTSYSKILKSIIKISEDYIDHEFIYSYLELLHWSKEVKTVILKDF
                     DNIDLKRLSNLTQTTNLIIMKNDIIYDLEKNFEFFETYCLIDHDYENMIKIDNMPSFE
                     YLLEDIFKVMVDEEFKANMSFHQLEIIKKELKKQIN"
     repeat_region   894507..897113
                     /inference="COORDINATES: alignment:crt:1.2"
                     /inference="COORDINATES: alignment:pilercr:v1.02"
                     /rpt_family="CRISPR"
                     /rpt_type=direct
                     /rpt_unit_range=894507..894542
                     /rpt_unit_seq="gttttagcactgtacaatacttgtgtaagcaataac"
     gene            complement(897196..897978)
                     /locus_tag="MGF_RS03675"
                     /old_locus_tag="MGF_5261"
     CDS             complement(897196..897978)
                     /locus_tag="MGF_RS03675"
                     /old_locus_tag="MGF_5261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="rRNA methyltransferase"
                     /protein_id="WP_014574793.1"
                     /db_xref="GI:504387691"
                     /translation="MKNQFKSQFNNKHQNKHKKERLCLFGYNAVYEGLINNLKIKKVY
                     LHKEDHLLLKLIKQKGIEYELHTIKWFDNQYRDLSNHQGFVAEIDGSSLTISFNQFCE
                     KIKNEQQGIVVVLDQIHDPGNFGGILRSCLAANVLGVIFKKDNQASINNTVIKTSLGA
                     CFYLNLIEVANLSYAIKDLQDKYGFWSYVSNLSDQAQDYNVDYANKSILIVGNEQKGV
                     SSQLIKNADYQIKIPMYTDKIQSLNVSVATGIMLFNMKQKIK"
     gene            complement(897982..899289)
                     /locus_tag="MGF_RS03680"
                     /old_locus_tag="MGF_5271"
     CDS             complement(897982..899289)
                     /locus_tag="MGF_RS03680"
                     /old_locus_tag="MGF_5271"
                     /EC_number="6.1.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011883492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="WP_014574794.1"
                     /db_xref="GI:504387692"
                     /translation="MKLYDTLTKTNVDIDANEINIYVCGPTVYDHIHIGNLRPIVTFD
                     VLRRLLEHSNKKVNFVHNITDIDDKIINQAQRLNLSEEEVTKRYTSAYFEILDALNIK
                     LPKIVKVTDVMNGIIKYIEKIYDKQYAYELDGDIYFDTTRIPDYGVLSKRKLDEQISG
                     IRVKSNENKTSPNDFVLWKKTVNGIKWNSKFGLGRPGWHTECAYIIDQEFKQKGFVIH
                     GGGIDLVFPHHENENAQNLALHNKNLANCWVHVGHLLIDNEKMSKSLNNFIYVKHLIE
                     SHNYRAIRWVFYNTAHTQPLNFDGTIIKAAQKDVEKIISTVNRFRTFLIANKNNIPSS
                     SLVCEEFKKALFDNLNFANATKVIWDLIKVLNESIAYKKIDENIWAYQQLIWCLEIYG
                     IVPDMIHNEQIIDQINQWSELLNNKDYEKADSIRNKLINKKVL"
     gene            complement(899488..899805)
                     /locus_tag="MGF_RS03685"
     CDS             complement(899488..899805)
                     /locus_tag="MGF_RS03685"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_041594421.1"
                     /db_xref="GI:753838804"
                     /translation="MSIDRNDQDYIEQLTNLWNVRIAPQAGIFEVKPESASKNLDELT
                     GDDFTFNDRINSYVEVTGPISVVNKKQNKDNNGYIYTLKYKVRLNNKVKNDTWYEDQS
                     DVQ"
     gene            complement(900083..902371)
                     /locus_tag="MGF_RS03690"
                     /old_locus_tag="MGF_5290"
     CDS             complement(900083..902371)
                     /locus_tag="MGF_RS03690"
                     /old_locus_tag="MGF_5290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886684.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="peptidase S8"
                     /protein_id="WP_014574795.1"
                     /db_xref="GI:504387693"
                     /translation="MNEILKLRVNFSDAKPNPVRASAANIPKYQSVDLKKIEDLKNDL
                     NYVIEYWNNVNQSLPIKPLINIHYKELIAKSNRIKGLLENSSQKNNESVVGAKFSDDD
                     KHKHIITHCVEKKVLVNALKRIQNVIYIFKKQFKNKITHDDIIKINSGQYNELFNNDQ
                     NQSVSKSSFINIIVDAYYVEKISVQEEVSEIARNNGLITIYKTGYDLKKLLNHLGLDV
                     LDSQIIDETTLMLEPRNYEILRLKAPQLISMAVSDISLIDNLPSIGLNNKWQIKIDDP
                     KDEPIIGVIDTLFDKNVYFSKWVEYEEHIPAGVTKSTRDYFHGTAVSSIIVDGPSFNK
                     KELNDGCGRFRVKHFGVALADKFNTSTLMRKIEEIVKQNKHKIKVWNLSLGSAHEINN
                     NFISWEGSILDKIQYEHDVIFVVAGTNKHKKFPVEKIGAPADSINSLIVNSVDHRKNP
                     SIFSRRGKVLSFFNKPDISYYGEAIRTCTPIGEDICQGTSFAAPWITRKLAYLIYVLD
                     FSIEEAKALIIDSAIKWPSYKQVNKDERETIDKEELIGYGVVPIRIDDIVKTATEDIK
                     IVISGVAEEFNTYFHNIPIPHQNNQQPFIARATLCYLTKCSRNQGVDYTDTELDFKFG
                     QVRVDKNENERIDDLKKNKQSEDKNLNLREKKVRSEYRKWDNVKHISEALYTPKGYKK
                     KPRNGTNSWGISIKKKNRSTNSQSESIKFGLVITLKEINGLNKINDFLNLCQMNNLIV
                     HKVNIKKHVDIKEKAKEDINFE"
     gene            complement(902375..903412)
                     /locus_tag="MGF_RS03695"
                     /old_locus_tag="MGF_5294"
     CDS             complement(902375..903412)
                     /locus_tag="MGF_RS03695"
                     /old_locus_tag="MGF_5294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase AAA"
                     /protein_id="WP_014574796.1"
                     /db_xref="GI:504387694"
                     /translation="MKKETVINLIRYYTENDDYRFRNEAYEVARAFDKAGDRELAEYI
                     MALLSDGLSFAPQINEDNLVFLKKIKVNGDPLPLPKQIESDLLGIVNALKSGVNKFLF
                     QGSPGTGKTESVKHLARILGRDCYVVDFDTLIDSKLGQTTRNISNLFQEINKYLIAQK
                     SVILFDEIDALALDRTNSRDVREMGRATTSVLKGLDNLDPNVLLIATTNLYNHFDKAL
                     TRRFDYIINFNRYEKEDLIRISEILLNSYLPKFKHASSNVRLFKKIISSMSDIPYPGD
                     LKNLIRSSLAFSNPNDEYDYLKRLYIAVNNEDESEISLNNIQDKGFTVREIEILTGIS
                     KSKVARELKSR"
     gene            903704..906337
                     /locus_tag="MGF_RS03700"
                     /old_locus_tag="MGF_5296"
     CDS             903704..906337
                     /locus_tag="MGF_RS03700"
                     /old_locus_tag="MGF_5296"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="restriction endonuclease subunit M"
                     /protein_id="WP_014574797.1"
                     /db_xref="GI:504387695"
                     /translation="MTKQELVREIWAIANEMRGNIEANDYKDYILGFLFYKYLSDKQD
                     EYFANKNVVKDEDKKQYLVALAEAEKKGIASIIHKCKKDLGYYIAYENLFSTWIKNYN
                     PGDDLSDKVSTALNSFERSILEKYEESFKDIFKDLQVGIQKLGNTAYERSEAIWNICN
                     LINKIPITSKQDYDILGFVYEYLISMFAANAGKKAGEFYTPHEVSQLMSVIAANHLKG
                     LKNVSIYDPTSGSGSLLITLGRELKKIDKNVKIQYYAQEVIDTTYNITRMNLLMNDVH
                     SVNMFAKCGDTLKEDWPFVYEEQKYKSKRTDAVVSNPPYSLAWNTENKENDPRFRYGL
                     APKSKSELAFLLHSLYHLEDHGILTIVLPHGVLFRGGSELQIRQNLISHDHIDAIIGL
                     PSNIFFGTGIPTIIMVLKRSKTKKEKNNVLFIDASKYFTKEGNKNKLQSSDIMRIYDA
                     FSAREDIPGFARVVSHEEIKANEYNLNIPKYIDLVDNGDNHNLYSSIFSGIPHNDIDK
                     LSDFWSTFPTLKKALLNDNGKNYQLKDHDVEKVISNNEEVKKYLSDFNKSLESLRTYF
                     KKSLIDTDLNVIDLYNVYQQFLDKIQSVLKSYKLLDYYQAFQLFDNEWTIIENDLKVI
                     KSADNKNSFDTIRELKEHDSSTISAKADKKLVSKNTTYGIYQTPVIPFEFVTKLKFNN
                     QLEALEINSNKVEEINARLEELLNEVAGYESDVVNNFYKKEENKLNFDEIKKQLKNLS
                     VVAKSQPESVEALLVEALSIDKEKRALNSAIRKAKLQLEKDTIQAYSKLTDEEAKTLL
                     CLKWIDPLITAISKLTKYKIENLASELNRLDKKYIDKLSDLEVQIIQTQNSLIELINQ
                     LEGPDLDMEGLNELKKILGKK"
     gene            906547..907164
                     /locus_tag="MGF_RS03705"
                     /old_locus_tag="MGF_5309"
     CDS             906547..907164
                     /locus_tag="MGF_RS03705"
                     /old_locus_tag="MGF_5309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="restriction endonuclease subunit S"
                     /protein_id="WP_011113944.1"
                     /db_xref="GI:499426480"
                     /translation="MNSNVNYFGVNKIKKSAKKPVIRFSGFTNEWEQQRVANLFEITR
                     GYVLAVNKTTEEKTNKNRYPVYSSQTLNNGLLGYYHEYLYEDTITWTTDGANAGTVNF
                     RSGKFYCTNVCGVLLSKKVKADKMIAEALNNVAKSYVSYVGNPKLMNNVMAGVEIMIP
                     TNEEEREKISNIFATLDHLITLNQLKLEKLKNIKQSLLEKMFPKK"
     gene            907139..907777
                     /locus_tag="MGF_RS03710"
                     /old_locus_tag="MGF_5313"
     CDS             907139..907777
                     /locus_tag="MGF_RS03710"
                     /old_locus_tag="MGF_5313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="type I restriction-modification system
                     specificity (S) subunit domain protein"
                     /protein_id="WP_014574798.1"
                     /db_xref="GI:504387696"
                     /translation="MKKCSQKNNADKPQIRFKGHTYAWKQVKLKTLADFLRGNGLNWD
                     AISQNGKEDCILYGHLYTDYGMIIDKVLYRTNEKLKNPFFSKFGDVLIPGSGHTPNGL
                     ARATSIEKDDVLIGGDVNIIRPRKSINGSYLSLCLNSCRNKLIQIIKGSIVRHIHNSD
                     IKEIKVHVSIHEKEQALLVSIFKNIDNLLALHQRKCEKLQNIKEAILEKMFC"
     gene            907789..910944
                     /locus_tag="MGF_RS03715"
                     /note="DEAD/DEAH box helicase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            911273..911605
                     /locus_tag="MGF_RS03720"
     CDS             911273..911605
                     /locus_tag="MGF_RS03720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014885839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="WP_041594436.1"
                     /db_xref="GI:753838819"
                     /translation="MLRENADNDENMYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQ
                     IIPKYQRIIHDKFILDVLSLASTRLSNNEIADQITSMYGFKVSPSVISNCIQTVQDEM
                     RDWHERPL"
     gene            911694..>912132
                     /locus_tag="MGF_RS03725"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(912595..913161)
                     /locus_tag="MGF_RS03730"
                     /old_locus_tag="MGF_5358"
     CDS             complement(912595..913161)
                     /locus_tag="MGF_RS03730"
                     /old_locus_tag="MGF_5358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011113947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574801.1"
                     /db_xref="GI:504387699"
                     /translation="MKIDQVTKLIFMKINILNRKIIMKSISIFTWITLIISLIFLPIF
                     IYILNDQLRWATYPSIQEQISYSLTHFSNWNILKFFVPLWTVILFSFLLYFISLKTVH
                     KNNSLNSLLVVRNVGFIKPKLSKRNDLIIASIMLFLMSLVIMAFASLILPFTVYIHMA
                     VTIPFFVLMLIHLFLNMFNFIAIIKEKN"
     gene            complement(913493..914338)
                     /locus_tag="MGF_RS03735"
                     /old_locus_tag="MGF_5363"
     CDS             complement(913493..914338)
                     /locus_tag="MGF_RS03735"
                     /old_locus_tag="MGF_5363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574802.1"
                     /db_xref="GI:504387700"
                     /translation="MKSKKVNKENEEIAIEEQEVQSSEVEQEEVSSDFEKDKIRRRIG
                     ILPIILSITGIIAVWIGAWLISYVIGSITQRVIDLTEVNGAEMSNFGEIFKNELTKIS
                     YVMLAFGGILIIAGIALLVVSIILVIKDFKYRNKKLELFFIKYQEMLEESEQFNLKLD
                     DLNRINQENLNKINLLNQEIAYLRKNNNNSLAIIQQQKTIEKVAPKPQQVPQLQQPKL
                     LINNYPQINKTQQNQQVLKKTVVTSTQTLIKNIEPKRVQITAGPTHPATKRSLIYQPS
                     SPTKR"
     gene            complement(914481..917771)
                     /locus_tag="MGF_RS03740"
                     /old_locus_tag="MGF_5372"
     CDS             complement(914481..917771)
                     /locus_tag="MGF_RS03740"
                     /old_locus_tag="MGF_5372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014574803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574803.1"
                     /db_xref="GI:504387701"
                     /translation="MADLPMNNKAKLAKLAKLKKSLSIKIKKQLLYGAVAFASAGLIS
                     GIIGASISATIDSDNKLTSIIQSNSNLVTSTNEGFNDKIDPRKPNPDLNKFIGDLSAS
                     YADREKGIVDLTTNQIKPFDQNKLSDAYIGANGELLTKEHAAASLLPEYKLIKKYAYG
                     SGDKLYDSLDELKNNFWNNISENSIAYYVFKDKNGQNHYFNPLNKNDINKFKEFVINQ
                     VINGDDKFSLDYYIPYSNDKNNSTYVSLSKSSAVFSDQGNFTLSSNANLGRAFDQKIN
                     QLFYQKTNDIFSQSSFLPTISLPKTAISVHRRSGLYLDYPTAPNYGFDKYFGIGFKDQ
                     NQDWNNVSISDKLVINQGFSVNDLIANLQKISSPDFVSKNFDSIQLNSRYQRNNKGSI
                     IPSTTSLDSSVSNYGLGLNQEQDNLKPLIATYSSIGRNKSDTEVAKLLDKEFLKTHAY
                     IKNRSFVTKDGVKLFGKNIGLIYKGNLYGYTVHGDPYIAKNNYNGDHRNKVFIYHDTF
                     SNNSWWLKAGNFNKDGFIQYSPYYFGFGNLENANKAYGLYPESVGISNDTLHVGADIF
                     DLTTNRRNAVGLVADIKNPGKRWDGWVSALTFIPSYWESYRISAENRKLYLNVDVDWK
                     LNNQTITDKEEFIRKISEKFGLNYSGNNNFAINPNSEFYKSYLSQSYINGASTYAILS
                     GLSNFSSLNKILDENFLNVAKSQVNKFAQFYDKTVATFSLGNGRDNRFVDYVFTYYDL
                     LRANSNLSYNSINLSSAYNTNFLTRHVFDVKDIKPVLTYGTNKQPLFEIDLSSDKKNL
                     LIQSLGSNQNNFKQALLSTLTRLPLDQLHNSLTNLSNHYKVDGIDLSAYSYDLKYQKY
                     LELNSNNNQVKLKAEYQTNNKINLPILPKGIDQDQFATLVTDNNTWFPITYMWKFYQE
                     ALSRLSSDSITKSGNQIVTDPNNLLVLEGGINTFTELRYGKYYDITGTDINLSIDSSS
                     DKHSLFFDSIQSRELTKYFIGQFSNKANVDNNYEIVLYYNNATNQKLGLVRGNYKNLS
                     RLEKESKNRALIELKPKVDENYKFYIDKDTTTKIKNTVFTLYPLKLQNGRTLYFDSLD
                     HLKAYRGE"
     gene            complement(917841..921437)
                     /locus_tag="MGF_RS03745"
                     /old_locus_tag="MGF_5386"
     CDS             complement(917841..921437)
                     /locus_tag="MGF_RS03745"
                     /old_locus_tag="MGF_5386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014886275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="WP_014574804.1"
                     /db_xref="GI:504387702"
                     /transl