GenomeNet

Database: RefSeq
Entry: NC_017503
LinkDB: NC_017503
Original site: NC_017503 
LOCUS       NC_017503             977612 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Mycoplasma gallisepticum str. F chromosome, complete genome.
ACCESSION   NC_017503
VERSION     NC_017503.1  GI:385325853
DBLINK      Project: 162001
            BioProject: PRJNA162001
KEYWORDS    RefSeq.
SOURCE      Mycoplasma gallisepticum str. F
  ORGANISM  Mycoplasma gallisepticum str. F
            Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
REFERENCE   1  (bases 1 to 977612)
  AUTHORS   Szczepanek,S.M., Tulman,E.R., Gorton,T.S., Liao,X., Lu,Z.,
            Zinski,J., Aziz,F., Frasca,S. Jr., Kutish,G.F. and Geary,S.J.
  TITLE     Comparative Genomic Analyses of Attenuated Strains of Mycoplasma
            gallisepticum
  JOURNAL   Infect. Immun. 78 (4), 1760-1771 (2010)
   PUBMED   20123709
REFERENCE   2  (bases 1 to 977612)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 977612)
  AUTHORS   Szczepanek,S.M., Tulman,E.R., Gorton,T.S., Liao,X., Lu,Z.,
            Zinski,J., Aziz,F., Frasca,S. Jr., Kutish,G.F. and Geary,S.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2010) Pathobiology and Veterinary Science, and
            Center of Excellence for Vaccine Research, University of
            Connecticut, 61 North Eagleville Rd., U-3089, Storrs, CT
            06269-3089, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP001873.
            Bacteria available from Steven J. Geary (steven.geary@uconn.edu).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..977612
                     /organism="Mycoplasma gallisepticum str. F"
                     /mol_type="genomic DNA"
                     /strain="F"
                     /db_xref="taxon:708616"
                     /clone="1"
     rep_origin      1..1882
                     /note="putative oriC"
     protein_bind    complement(24..32)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     pulmonis consensus ttatcMaMa"
                     /bound_moiety="DnaA"
     protein_bind    complement(36..44)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     pulmonis consensus ttatcMaMa"
                     /bound_moiety="DnaA"
     protein_bind    114..122
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach"
                     /bound_moiety="DnaA"
     repeat_region   209..217
                     /note="oriC imperfect repeat"
     protein_bind    complement(254..262)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     mycoides consensus YtWtMHaMR"
                     /bound_moiety="DnaA"
     protein_bind    298..306
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     mycoides consensus YtWtMHaMR"
                     /bound_moiety="DnaA"
     repeat_region   complement(396..445)
                     /note="oriC imperfect repeat"
     repeat_region   complement(457..505)
                     /note="oriC imperfect repeat"
     repeat_region   complement(570..618)
                     /note="oriC imperfect repeat"
     repeat_region   complement(708..756)
                     /note="oriC imperfect repeat"
     repeat_region   complement(758..806)
                     /note="oriC imperfect repeat"
     repeat_region   complement(816..864)
                     /note="oriC imperfect repeat"
     repeat_region   867..915
                     /note="oriC imperfect repeat"
     repeat_region   984..997
                     /note="oriC imperfect repeat"
     repeat_region   1054..1102
                     /note="oriC imperfect repeat"
     repeat_region   1140..1188
                     /note="oriC imperfect repeat"
     protein_bind    complement(1178..1185)
                     /note="putative DnaA-box; Mycoplasma spp. putative dnaA
                     binding site; consensus sequence approach; Mycoplasma
                     capricolum consensus ttWtMHaa"
                     /bound_moiety="DnaA"
     repeat_region   complement(1223..1271)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1543..1552)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1601..1649)
                     /note="oriC imperfect repeat"
     repeat_region   complement(1824..1872)
                     /note="oriC imperfect repeat"
     gene            1886..2674
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /db_xref="GeneID:12396886"
     CDS             1886..2674
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /note="MGF_0005"
                     /codon_start=1
                     /transl_table=4
                     /product="ParA/Soj family protein"
                     /protein_id="YP_005880291.1"
                     /db_xref="GI:385325854"
                     /db_xref="GeneID:12396886"
                     /translation="MIISFINNKGGVLKTTLATNICGVFSKFFPKSRSVIVDLDGQGN
                     VSATFGQHPERLKNTLIDIFRGEKDIDDCVLNVFPSIDILPSNHELSFVDMDVARKEY
                     KLSVIKNLIEKLEEMYDFVFLDTPPAMSTIVSVSMHISDMIVIPFEPDQYSILGLLRV
                     IDTIETFRERNEDLKVLVVPTKVNARTRLHNDVLNIVKTKLSKKNIPLSKNIVSFTTK
                     SSASVGYEKLPIVLINQRSKYQEEYIEITKEIINLLKDNKNNGK"
     misc_feature    1886..2662
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    1889..2428
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    1910..1930
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(1928..1930,2255..2257)
                     /gene="parA"
                     /locus_tag="MGF_0005"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            2664..3143
                     /locus_tag="MGF_0007"
                     /db_xref="GeneID:12396888"
     CDS             2664..3143
                     /locus_tag="MGF_0007"
                     /note="MGF_0007"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880292.1"
                     /db_xref="GI:385325855"
                     /db_xref="GeneID:12396888"
                     /translation="MENKKAKKKERRFTDLSADLDEEVEKVDPEYEDFKEIKIEKNKD
                     NQVIDKNDPFFYSESFEEARIQLIKDKKVEVKKEEEKVQETTVKNKISEAKKEEVAKD
                     VYIDSSLEIASQEPLTKGMHFYTNSRIIRKVRECAKNKGLSISRLITMILDKSIKEE"
     gene            3159..4544
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /db_xref="GeneID:12396926"
     CDS             3159..4544
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="MGF_0010"
                     /codon_start=1
                     /transl_table=4
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_005880293.1"
                     /db_xref="GI:385325856"
                     /db_xref="GeneID:12396926"
                     /translation="MKTKLKRFLEEISVHFNEANSELLDAFVHSIDFVFEENDNIYIY
                     FESPYFFNEFKNKLNHLINVENTVVFNDYLSLEWKKIIKENKRVNLLDKKEADTLKEK
                     LATLKKQEKYKINPLSKGIKEKYNFGNYLVFEFNKEAVYLAKQIANKTTHSNWNPIII
                     EGKPGYGKSHLLQAIANERQKLFPEEKICVLSSDDFGSEFLKSVIAPDPTHIESFKSK
                     YKDYDLLMIDDVQIISNRPKTNETFFTIFNSLVDQKKTIVITLDCKIEEIQDKLTARM
                     ISRFQKGINVRINQPNKNEIIQIFKQKFKENNLEKYMDDHVIEEISDFDEGDIRKIEG
                     SVSTLVFMNQMYGSTKTKDQILKSFIEKVTNRKNLILSKDPKYVFDKIKYHFNVSEDA
                     LKSSKRKKEIVQARHICMYILKNVYNKNLSQIGKLLRKDHTTVRHGIDKVEEELENDP
                     NLKSFLDLFKN"
     misc_feature    3174..4454
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="chromosomal replication initiator protein DnaA;
                     Region: DnaA; TIGR00362"
                     /db_xref="CDD:232941"
     misc_feature    3621..3935
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    3642..3665
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(3645..3668,3840..3842)
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    3828..3845
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    4281..4541
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(4350..4352,4374..4379,4398..4400,4416..4424,
                     4446..4460,4467..4469,4476..4481)
                     /gene="dnaA"
                     /locus_tag="MGF_0010"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            4669..6384
                     /locus_tag="MGF_0017"
                     /db_xref="GeneID:12396975"
     CDS             4669..6384
                     /locus_tag="MGF_0017"
                     /note="MGF_0017"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter component domain protein"
                     /protein_id="YP_005880294.1"
                     /db_xref="GI:385325857"
                     /db_xref="GeneID:12396975"
                     /translation="MLKILFYNTTKSFRLHMSIVPIFLLIESLTTVLVPYFISDLINF
                     GIIGRDKNALTQYSLILLGVAAVGFTFGYLGGRSIIIASVEFAKQLRVNIFERYQSFS
                     VKNTDKFEKASILTRMTTDINFIQQSIQSGRMAIRGMSVFLFSLVLMFVTSWKLGIAS
                     VAIMPVIIGGILLVYRFVIGNYKKLFKQYDQLNNLAKESIAGARVVKSYHQQDNEIQK
                     FNRVAGFIYKNFTKIERITALISPIVLFCIYVLAIAIAWISTNNIVDGKLDIGSLASV
                     FAYAFQMLINLLLLSVVYVTIITAKPSKDRIIEVLTEKIDIKDKKYAIDNVSDYEVEY
                     KDVSFKYVDTSPHHNLEKINIKIKKGQTIGIIGPTGSGKTSIVNLLTRLYECNEGQVL
                     LNNIQLNNYSLKALRDAIAIVPQKSILYSGTIKDNILMGRNYSDEEVEKAITQGQAAE
                     FINKLPNKLDSIVEQNGTNFSGGQRQRICIARAMIRKSKILIFDDSTWALDTKTDALI
                     QSSFNNDLKESSKILISQRVSSIKNADLIYVLNNGQIVASGNHDYLIEHSELYREINQ
                     SQTEQ"
     misc_feature    4723..6381
                     /locus_tag="MGF_0017"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    4723..5520
                     /locus_tag="MGF_0017"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    5662..6372
                     /locus_tag="MGF_0017"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    5767..5790
                     /locus_tag="MGF_0017"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(5776..5781,5785..5793,5911..5913,6148..6153,
                     6244..6246)
                     /locus_tag="MGF_0017"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    5902..5913
                     /locus_tag="MGF_0017"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    6076..6105
                     /locus_tag="MGF_0017"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    6136..6153
                     /locus_tag="MGF_0017"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    6160..6171
                     /locus_tag="MGF_0017"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    6232..6252
                     /locus_tag="MGF_0017"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    6390..8290
                     /note="MGF_0026f; Potential ABC-type
                     multidrug/protein/lipid (MdlB-like) transport system
                     component gene region; this gene is intact in strain
                     R(low) but is comprised of 3 CDS regions in strain F"
     gene            6390..6551
                     /locus_tag="MGF_0026"
                     /db_xref="GeneID:12396977"
     CDS             6390..6551
                     /locus_tag="MGF_0026"
                     /note="MGF_0026"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type multidrug/protein/lipid (MdlB-like)
                     transport system component"
                     /protein_id="YP_005880295.1"
                     /db_xref="GI:385325858"
                     /db_xref="GeneID:12396977"
                     /translation="MSHKKERNAQKKKYFKELLRFIWKNNKWHLLIAFFFIIISSITL
                     VLVNNFIKT"
     gene            6644..7675
                     /locus_tag="MGF_0028"
                     /db_xref="GeneID:12396979"
     CDS             6644..7675
                     /locus_tag="MGF_0028"
                     /note="MGF_0028"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type multidrug/protein/lipid (MdlB-like)
                     transport system component"
                     /protein_id="YP_005880296.1"
                     /db_xref="GI:385325859"
                     /db_xref="GeneID:12396979"
                     /translation="MIFILGVLSNIISGQIMAKATHATLFKLRNNMYVHMQGLPIKYF
                     DTTKHGDIMSYYTNDVDTVRNLIVQIIPQSFQALVQIVVIFVFMLQISIVLTLITVLL
                     LLPMLIFFGFFGKKTRVNFVANQVEIANLNGVIQEYIETQMISNLFNYSDQVIHKFKL
                     ANNKQAAIMKKANVLASIVFPVMFNYSNVMYIVVAIASVFLFESYQNKPILGQQITLA
                     VIVSFVALVRAFVGPLANISENINFFARSKAGAERIYTMLDEKLEENKGKIILDYIEK
                     DENGNWRIANKWTKQIGWVINGEIKPFQGKVEFKNVNFSYDGKKQVLKNINISGYPGE
                     KIALIGKTG"
     misc_feature    6644..>7672
                     /locus_tag="MGF_0028"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    6647..7345
                     /locus_tag="MGF_0028"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    7556..>7672
                     /locus_tag="MGF_0028"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    7661..7672
                     /locus_tag="MGF_0028"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     gene            7790..8290
                     /locus_tag="MGF_0036"
                     /db_xref="GeneID:12396985"
     CDS             7790..8290
                     /locus_tag="MGF_0036"
                     /note="MGF_0036"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type multidrug/protein/lipid (MdlB-like)
                     transport system component"
                     /protein_id="YP_005880297.1"
                     /db_xref="GI:385325860"
                     /db_xref="GeneID:12396985"
                     /translation="MGIVLQSTELFSGSIRDNIAYGNKEAKLEDIIEAAKLANAHDFI
                     MTLPNEYDTYIINNGEGLSQGQKQLLTIARVSLMNPAIMVLDEATSNIDSRTEKVTKE
                     SMDKLMQNRTTFAIAHRLSTIKNTNQILVIQEGEIVERGNHEQLMAKKGLYESFYHSS
                     FSEEMS"
     misc_feature    <7790..8278
                     /locus_tag="MGF_0036"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    <7790..8248
                     /locus_tag="MGF_0036"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    7796..7807
                     /locus_tag="MGF_0036"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    7973..8002
                     /locus_tag="MGF_0036"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    8033..8050
                     /locus_tag="MGF_0036"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    8057..8068
                     /locus_tag="MGF_0036"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    8129..8149
                     /locus_tag="MGF_0036"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            8385..8534
                     /gene="rpL34"
                     /locus_tag="MGF_0042"
                     /db_xref="GeneID:12396995"
     CDS             8385..8534
                     /gene="rpL34"
                     /locus_tag="MGF_0042"
                     /note="MGF_0042"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L34"
                     /protein_id="YP_005880298.1"
                     /db_xref="GI:385325861"
                     /db_xref="GeneID:12396995"
                     /translation="MKRTYQPNKRKRAKTHGFRARMATASGRAVLAARKRKGRHILTV
                     SDEAR"
     misc_feature    8385..8516
                     /gene="rpL34"
                     /locus_tag="MGF_0042"
                     /note="Ribosomal protein L34; Region: Ribosomal_L34;
                     pfam00468"
                     /db_xref="CDD:249883"
     gene            8546..8893
                     /gene="rnpA"
                     /locus_tag="MGF_0045"
                     /db_xref="GeneID:12397054"
     CDS             8546..8893
                     /gene="rnpA"
                     /locus_tag="MGF_0045"
                     /EC_number="3.1.26.5"
                     /note="MGF_0045"
                     /codon_start=1
                     /transl_table=4
                     /product="ribonuclease P protein component"
                     /protein_id="YP_005880299.1"
                     /db_xref="GI:385325862"
                     /db_xref="GeneID:12397054"
                     /translation="MKRENSLKKITNFLELVKSKNKYYSNNYVIYAEKNRENKIKIGI
                     SVPKKLFAKAVIRNKIKREVRSFFDDFTDWSKSLNILIKINNVNYLTNSYLAKKKEFF
                     DTYKKVVQKFKII"
     misc_feature    8552..>8749
                     /gene="rnpA"
                     /locus_tag="MGF_0045"
                     /note="Ribonuclease P; Region: Ribonuclease_P; pfam00825"
                     /db_xref="CDD:250159"
     gene            8898..10049
                     /gene="yidC"
                     /locus_tag="MGF_0047"
                     /gene_synonym="oxaA"
                     /db_xref="GeneID:12396878"
     CDS             8898..10049
                     /gene="yidC"
                     /locus_tag="MGF_0047"
                     /gene_synonym="oxaA"
                     /note="MGF_0047"
                     /codon_start=1
                     /transl_table=4
                     /product="putative inner membrane protein translocase
                     component YidC"
                     /protein_id="YP_005880300.1"
                     /db_xref="GI:385325863"
                     /db_xref="GeneID:12396878"
                     /translation="MNKVHSEIKTQSFNPFWNAATLKEKSRIDPNLKKALSYLWKFLK
                     ICVFLFLTVIGLWGCTQTYSEPWTVSNPRIGVGLEIGYNYGVTGDYRYDLISSNLGPY
                     FSFANYQLSYGPFLAWFVWPASQIILPILYQTRVPLTQGIDYGLNTILAILILLFIIR
                     LITIGITLNSTLNTERMGEVQGKIAEINAKYKNATDTQSKKMKQIEVMHIYKKHKIKP
                     AALFVQGFVTIPIFLIVYKMVSLTRPIKATILFGIWDLSVTPGTEIISDISRNWVYIF
                     FVLLVVPMQIVSQWLPQFWATRRNRNAKTTSQKGLEQLKKTRRIQWILIFVFALFPVI
                     TPSAVGLYWFLNSIFTILQSYITHVFIVKRRQRTKTISRLDQILNRELD"
     misc_feature    8910..10007
                     /gene="yidC"
                     /locus_tag="MGF_0047"
                     /gene_synonym="oxaA"
                     /note="putative inner membrane protein translocase
                     component YidC; Provisional; Region: PRK02201"
                     /db_xref="CDD:235012"
     gene            10049..10855
                     /gene="ksgA"
                     /locus_tag="MGF_0056"
                     /db_xref="GeneID:12396340"
     CDS             10049..10855
                     /gene="ksgA"
                     /locus_tag="MGF_0056"
                     /EC_number="2.1.1.-"
                     /note="MGF_0056"
                     /codon_start=1
                     /transl_table=4
                     /product="dimethyladenosine transferase"
                     /protein_id="YP_005880301.1"
                     /db_xref="GI:385325864"
                     /db_xref="GeneID:12396340"
                     /translation="MINKINKFFKNNEFSPSKQRGQNFLIDQNIINKIVEAVIKINPS
                     KVLEIGPGLGAISEQLIKRFADNYYAIELDKKLFHHLNEELLKDHILHADALEIDWKS
                     IFDNLGDNPTMVGNLPYNISSKLIKKFILSTYRCAIIMVQKEMGLRLLAKINSKDYSA
                     FSALCQYSLNVSKIIEINETAFIPQPKVRSTLLFLEKKDIAFNEGYEKFLKLIFLSRR
                     KTILNNLKNNYDSKLVIQSLVSLGFKKTSRAQELSPTQLFSLYESLSKLC"
     misc_feature    10181..10453
                     /gene="ksgA"
                     /locus_tag="MGF_0056"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(10193..10213,10262..10267,10325..10333,10394..10396)
                     /gene="ksgA"
                     /locus_tag="MGF_0056"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            10770..11555
                     /gene="ispE"
                     /locus_tag="MGF_0062"
                     /db_xref="GeneID:12396341"
     CDS             10770..11555
                     /gene="ispE"
                     /locus_tag="MGF_0062"
                     /EC_number="2.7.1.148"
                     /note="MGF_0062"
                     /codon_start=1
                     /transl_table=4
                     /product="diphosphocytidyl-2C-methyl-D-erythritol
                     2-phosphate synthase"
                     /protein_id="YP_005880302.1"
                     /db_xref="GI:385325865"
                     /db_xref="GeneID:12396341"
                     /translation="MVLKKHPELKSYHLPNCLAYMNHYRSYAKVNFYLKIKEYCPKVK
                     KHKLESKLVLVKDLYDDLYLEKSNQTKIEYFDQNDNPLTFSDDILVRTKKFLEDKLNQ
                     NFEFKAKVIKRIPTLSGLGSAPSNAAVLINWIYQEYGILNPVSYYEIATELGSDIPFF
                     LSLHDCAIIKNFGDQVEQSILDGYEIEKIIFNKQKPSTKKIFELLDYSQIKKENLNDL
                     EQPFFSLFPELLPSFNQLKNDNNHVVLAGAGSCFVVFRKLNEI"
     misc_feature    10833..11552
                     /gene="ispE"
                     /locus_tag="MGF_0062"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05905"
                     /db_xref="CDD:235642"
     misc_feature    11094..11252
                     /gene="ispE"
                     /locus_tag="MGF_0062"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     gene            11568..13217
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /db_xref="GeneID:12396342"
     CDS             11568..13217
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /EC_number="6.1.1.19"
                     /note="MGF_0066"
                     /codon_start=1
                     /transl_table=4
                     /product="arginyl-tRNA synthetase"
                     /protein_id="YP_005880303.1"
                     /db_xref="GI:385325866"
                     /db_xref="GeneID:12396342"
                     /translation="MVFKKIKTQIDHALKQLNLPTDIEYLIQQTKNIQFGDFSSNVAM
                     VLSKRQNKNPEEIAKQIIEQLNPNEFEKITFSKPGFINFFLSNQDKLVVLKRLQKTNY
                     SVEKLPKEEQESINIEFVSANPTGFLHLGHVRNSYTGDVLGNILRAVGHNVTKEYWIN
                     DLGNQVSLFALSTIIRYLQKLGINKYQLPDDSYHGKEPIFVAEEMIKDFGNKYQDIKI
                     EDNKIVDSKIANELTQYCTNKMLHFIKQDLESIGVKMDVWTSEKVVYQSNTLTELLNN
                     QLKDHIYEQDGAVWLRTTDGGDDKDRVIIKENKQPTYYGTDIANHYLKHKRGFDRLIN
                     VWGADHFGHILRTAYAAELTGIKKGKFVVVLIEMVKLLKDNKEIKFSKRLGNAISIPD
                     MLEFLSKDASRWFMLNQSWTSGIKIDVDLTNKKDSSNPVYYVQYAHARIHKLLTKAEH
                     IDLTKVNLSLLNSDVERTMVNYLASFEHYVHNVATTYEVNKLLNFVYTLTQSFHSWYN
                     SHEILNQKDEIKQTRLLLAKAIKNLINYLLSLFGIEAVEQM"
     misc_feature    11568..13214
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="Arginyl-tRNA synthetase [Translation, ribosomal
                     structure and biogenesis]; Region: ArgS; COG0018"
                     /db_xref="CDD:223097"
     misc_feature    11577..11822
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="Arginyl tRNA synthetase N terminal domain; Region:
                     Arg_tRNA_synt_N; pfam03485"
                     /db_xref="CDD:251994"
     misc_feature    11910..12722
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="catalytic core domain of arginyl-tRNA synthetases;
                     Region: ArgRS_core; cd00671"
                     /db_xref="CDD:185675"
     misc_feature    order(11919..11921,11928..11930,11934..11936,11952..11954,
                     11961..11963,12504..12506,12516..12518,12585..12587,
                     12594..12596)
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="active site"
                     /db_xref="CDD:185675"
     misc_feature    11952..11963
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:185675"
     misc_feature    <12702..12806
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    12705..12716
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="KMSK motif region; other site"
                     /db_xref="CDD:185675"
     misc_feature    order(12825..12827,12837..12839,12846..12848,12873..12875,
                     12885..12890,12894..12899,13047..13049,13068..13070,
                     13077..13079,13086..13088)
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153408"
     misc_feature    12867..13214
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="DALR anticodon binding domain; Region: DALR_1;
                     smart00836"
                     /db_xref="CDD:214846"
     misc_feature    order(12873..12875,12882..12887,12894..12899,13086..13088)
                     /gene="argS"
                     /locus_tag="MGF_0066"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153408"
     gene            13226..14395
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /db_xref="GeneID:12396343"
     CDS             13226..14395
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /note="MGF_0074"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane nuclease MnuA"
                     /protein_id="YP_005880304.1"
                     /db_xref="GI:385325867"
                     /db_xref="GeneID:12396343"
                     /translation="MRNRVRDKQNQNTRKKQVNNKRWIMWVLLLLLIILGVSAYFVIN
                     KFFPPKNDVPNSKRTNDSQVTNPGTRNETVPPSEQYKKVGDLRLMSWNTLNFGSRSEP
                     TSNKFMNIIRTIQLSDADVVGLSEINYDDQLLAQRLNDALGSSWSYTFSGKNFNENYP
                     RSKESILILYKNQVVQPEVSKAINPNNIYTRPLWYTKFKIIGFDYSFITFFGHFDAPG
                     VNANNGETSAAGFSRQGSQEIKEAQAIATVFSDLKTQYPDTDIIGAADTNIRETNNRV
                     FTSDQYSLNYINFDNNRPYYRTTLSERNGYANSYDKWFIYDADSQNILKKSDIPYKID
                     IINAFTDKIWDKQKSLAAWLASRSGMRNPNPSDFQLISNVSDHAPILLDIDYKLK"
     misc_feature    13481..14377
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    order(13499..13501,13601..13603,13862..13864,14021..14023,
                     14027..14029,14156..14158,14351..14356)
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    order(13601..13603,14351..14353)
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(13862..13864,14027..14029,14354..14356)
                     /gene="mnuA"
                     /locus_tag="MGF_0074"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            complement(14450..15181)
                     /gene="glpF"
                     /locus_tag="MGF_0082"
                     /db_xref="GeneID:12396344"
     CDS             complement(14450..15181)
                     /gene="glpF"
                     /locus_tag="MGF_0082"
                     /note="MGF_0082"
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol uptake facilitator protein GlpF"
                     /protein_id="YP_005880305.1"
                     /db_xref="GI:385325868"
                     /db_xref="GeneID:12396344"
                     /translation="MNTTVNILLGELIGIMVLIILGNGVCASVNYKNMFAKQVGANWL
                     LIAFGWGFAVFCGVVISIQVLKGNAHLNPAVTVYFMINQKGANIGLLFAMIAMQLLGA
                     MIAQIILNSLNWKHIIENDAEMLKASSCTGPSHRKAWFRNISYEMLGTMILLAGVMAG
                     DYHKLTGVFFVMAIVMTLGSVTGCAINPARDFGPRVIYFLTAKAFNKKLQNPVSADFR
                     YGLVPLLAPIAAGLIMGGFSLLINQ"
     misc_feature    complement(14483..15181)
                     /gene="glpF"
                     /locus_tag="MGF_0082"
                     /note="Glycerol uptake facilitator and related permeases
                     (Major Intrinsic Protein Family) [Carbohydrate transport
                     and metabolism]; Region: GlpF; COG0580"
                     /db_xref="CDD:223653"
     misc_feature    complement(order(14612..14614,14621..14623,14630..14635,
                     14966..14974,15032..15034))
                     /gene="glpF"
                     /locus_tag="MGF_0082"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    complement(order(14615..14623,14960..14968))
                     /gene="glpF"
                     /locus_tag="MGF_0082"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            complement(15181..16707)
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /db_xref="GeneID:12396345"
     CDS             complement(15181..16707)
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /EC_number="2.7.1.30"
                     /note="MGF_0094"
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol kinase"
                     /protein_id="YP_005880306.1"
                     /db_xref="GI:385325869"
                     /db_xref="GeneID:12396345"
                     /translation="MDKKKYIITLDEGTTSCRSIVFDKQAKIVSVAQNEFTQYFPQSG
                     WVEHDPLEIWNTQLSTMQSVKNKAQIKSVNVEAVGITNQRETVVLWNKETGLPVYNAI
                     VWQDRRTSEYCETLTKHVDKVREKTGLIINPYFSGTKIRWILKNVPLAQKTLKAGKLL
                     AGTIDSWLIWKLTGGKVHATDVSNASRTLLFNIHTMDWDQELLDLFEIPRSILPEVKS
                     SSEVYGYVEPSLWSQRATAKVPITGVAGDQQSALFGQLCLKPGMVKNTYGTGCFTLMN
                     IGEKPIMSKNKLLTTVAWKLGKKKPVYALEGSVFIAGAAVQWIRDGLRLIYDAAESDF
                     YANLASKEDTHQVYLVPSFTGLGAPYWDSYSRGAIFGLERGTKKEHIIKATLESIVFQ
                     TNDLIKAMSSDVGKKIEVVKVDGGATRSEYIMQFQSSISGVNVIRPKNIESTALGATF
                     LAGLAVGYWKDLKELEKLVKVDKEFKPKLDKEKVEKLVHGWNVAVKRTFNWMKEVDLK
                     "
     misc_feature    complement(15205..16707)
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    complement(15220..16692)
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15331..15336,15340..15357,15361..15366,
                     15370..15378,15382..15384,15610..15612,15616..15621,
                     15625..15627,15646..15648,15757..15759,15775..15780,
                     15784..15786,15790..15792,15799..15801,15805..15807,
                     15823..15843,15859..15861,15865..15867,15892..15894,
                     15901..15903,15958..15963,15979..15984,16045..16056,
                     16120..16122,16126..16131,16147..16152,16159..16164,
                     16303..16308,16312..16314,16318..16329,16336..16338,
                     16366..16368,16378..16380,16387..16389,16393..16398,
                     16456..16482,16576..16578,16624..16626,16630..16632,
                     16639..16644,16648..16650,16654..16656,16663..16668,
                     16675..16677,16681..16683,16687..16692))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15448..15450,15457..15465,15712..15714,
                     15718..15723,15757..15762,15766..15771,15892..15894,
                     15901..15909,15964..15969,16306..16308,16396..16398,
                     16453..16461,16654..16656,16663..16671,16675..16677))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15448..15450,15457..15465,15712..15714,
                     15718..15723,15757..15762,15766..15771,15901..15909,
                     16654..16656,16663..16671,16675..16677))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15967..15969,16666..16668,16675..16677))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15967..15969,16675..16677))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15892..15894,15964..15969,16306..16308,
                     16396..16398,16453..16461,16666..16668))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(16024..16029,16186..16188,16195..16197,
                     16420..16422,16519..16524,16531..16533,16543..16548,
                     16555..16557,16606..16608))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15565..15567,15574..15576,15586..15612,
                     15649..15651,15664..15666,15670..15672,15745..15747,
                     15754..15759,15766..15768,15775..15777,16393..16395,
                     16570..16572,16579..16581,16588..16590))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15994..15996,16000..16005))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    complement(order(15250..15252,15256..15267,15271..15273,
                     15277..15279,15481..15483,15487..15489))
                     /gene="glpK"
                     /locus_tag="MGF_0094"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            complement(16747..17937)
                     /gene="glpO"
                     /locus_tag="MGF_0099"
                     /db_xref="GeneID:12396346"
     CDS             complement(16747..17937)
                     /gene="glpO"
                     /locus_tag="MGF_0099"
                     /EC_number="1.1.3.21"
                     /note="MGF_0099"
                     /codon_start=1
                     /transl_table=4
                     /product="glycerol 3-P oxidase"
                     /protein_id="YP_005880307.1"
                     /db_xref="GI:385325870"
                     /db_xref="GeneID:12396346"
                     /translation="MCRYRKAIKLQNMSILKTHFDVAIIGAGIIGASIAYELSRYNLE
                     VVVLEKNPKVANETSLGNSGLIHGGFDPEPHKLEAKLNLQGNLKWREWFKHLEFPRVE
                     IDSLILAFNEEEMKHVHMLYERGLTNGLNKKDLKVLTTQEVLKKEPNVNPAVKGGLLC
                     TSSVAIHPVEATRALLGAAKQNDTRLRVNSEVTNIKYEGDRFALTINNKYKIYARKVI
                     NAAGHYADKLANKFGFDDFKQTTRRGEYRILDNYDKNLINSVLFKVPTIHGKGIIIAP
                     TLDGHYLVGPTAQDGVPKEDISLVTKEKYDLIGKIGKDIVPSLKIERTIKTIAGSRPI
                     DVETNDFVIRKSKKNPNFILAAGMQSPALSSAPAIASEIANLLNLKLTPRENFKPDYK
                     IDIF"
     misc_feature    complement(16807..17859)
                     /gene="glpO"
                     /locus_tag="MGF_0099"
                     /note="hydroxyglutarate oxidase; Provisional; Region:
                     PRK11728; cl19156"
                     /db_xref="CDD:267509"
     misc_feature    complement(16810..17832)
                     /gene="glpO"
                     /locus_tag="MGF_0099"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     gene            complement(18180..20432)
                     /locus_tag="MGF_0110"
                     /db_xref="GeneID:12396347"
     CDS             complement(18180..20432)
                     /locus_tag="MGF_0110"
                     /note="MGF_0110"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880308.1"
                     /db_xref="GI:385325871"
                     /db_xref="GeneID:12396347"
                     /translation="MIKKSAWFNLLCGLSSVSFVSASCQKMQAPATKSAEEIFRTLTK
                     GDITIAFNKNQDKTKILPSAINEKNYFNYFYFQISQSVDQKELDHINFDAKNFVPNNQ
                     SGTLSFDLDVSVVDRPKDIKNFDFRIDGLMTGSGASSGSGSSSASSGSGSGNSGSTTT
                     QPEHDPNDCPPDTSKANKTSSSEKTVNTTRPTESQRQPRDSSKPPSFPNGFPGFPGSN
                     ITKEFVQKQNSYPDYVASRYKTVDKQLIYKEIWDRTFSIRPGTFTSDNGTAHPIVDQG
                     TGWVLDYAKNSSNNNQLKLFIATNLHVIGNYGNTNSKELDDLLSYSDPTGVKPSGFAL
                     GKSNKTPSFAPQPNNQSVDQLKQNAGTMLYYSYKEGGGKIGIEEIKTTQAFRTPKIVF
                     AAVDYLDDHALNQYKSKIDEKWKAWKEETLNIINGSNSGHGTVFADEEKTRLKKLTEY
                     NGKISFYTDFGILELDVDLSKADEKLKEWINNSTKAVDSYVNRIKTTQHLPNYNPETG
                     NYFPTLDYISKNLGLASCKPSYAYGIDNAKDIYIAGYPKDLQSQTFWMQNNPAERYQD
                     ITQGSVNNQLRIPQQAWLPNKDLFNVPSYTRSTDSATSKTWSDINNIQIYTKLWNRPF
                     IDRYGFNYFTKFSSLYYGASGSVAYNDFGQIVGIYDGVASSTNFGDVSNLGTFAPLVQ
                     AANIKVQSDESITNYAYNLIDNKGFPHQTRSYRSNLSLFYPNGFTWPSTSGTPTQSNS
                     KVTAIFPNGF"
     misc_feature    complement(18450..19697)
                     /locus_tag="MGF_0110"
                     /note="Putative peptidase (DUF31); Region: DUF31;
                     pfam01732"
                     /db_xref="CDD:250823"
     gene            complement(20661..21173)
                     /locus_tag="MGF_0113"
                     /db_xref="GeneID:12396348"
     CDS             complement(20661..21173)
                     /locus_tag="MGF_0113"
                     /note="MGF_0113"
                     /codon_start=1
                     /transl_table=4
                     /product="ferritin-like protein"
                     /protein_id="YP_005880309.1"
                     /db_xref="GI:385325872"
                     /db_xref="GeneID:12396348"
                     /translation="MHSNVRKLLNNQYNSEMAAATMMFEYSARIDEYGMDHFSALLYD
                     WAKEKLEHAQKLEWYLRLNEQWIRTNELATPKLVDSTEPLGILEAVSEYQRATAVAFD
                     EIAEVALINKDFGTYNFVGFFIENQLYQKKKCADLINTFKMSEDLLIIDEKIKQIKEE
                     HLANITKSHK"
     misc_feature    complement(20700..21164)
                     /locus_tag="MGF_0113"
                     /note="Ferritin-like superfamily of diiron-containing
                     four-helix-bundle proteins; Region: Ferritin_like;
                     cl00264"
                     /db_xref="CDD:260311"
     misc_feature    complement(20745..21155)
                     /locus_tag="MGF_0113"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    complement(order(20784..20786,20793..20795,20892..20894,
                     21018..21020,21027..21029,21126..21128))
                     /locus_tag="MGF_0113"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153097"
     gene            21287..22114
                     /locus_tag="MGF_0114"
                     /db_xref="GeneID:12396349"
     CDS             21287..22114
                     /locus_tag="MGF_0114"
                     /EC_number="6.3.5.2"
                     /note="MGF_0114"
                     /codon_start=1
                     /transl_table=4
                     /product="GMP synthase PP-ATPase domain protein"
                     /protein_id="YP_005880310.1"
                     /db_xref="GI:385325873"
                     /db_xref="GeneID:12396349"
                     /translation="MQARKLQDFLISTVTLLRDTIKNKKAIIPLNGGVFSFVLAKITK
                     IALNKNLTCIYIDNGMMRHNEVANKIHFFREKLDLEVWHIDAKELFLNNLKGHISYAD
                     KKKAIDDTFLEVVMQTIVDIGEKIDFALLGTCFDDLNQGLNISMALANDVYIFEPLKQ
                     LTIQQVIELGELLSIDPNFLKEPTLPLSGFGLMVEDEVTEEKIVILKKVYYLINMILN
                     QGLQNKFEILIRDDYKDKSAYNLYIEFNQPISDLLVKKVKDQINGLLSNIKKIFIKV"
     misc_feature    21359..>21913
                     /locus_tag="MGF_0114"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:260331"
     misc_feature    order(21371..21376,21383..21394,21446..21448,21452..21454)
                     /locus_tag="MGF_0114"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            complement(22111..23811)
                     /locus_tag="MGF_0134"
                     /db_xref="GeneID:12396350"
     CDS             complement(22111..23811)
                     /locus_tag="MGF_0134"
                     /note="MGF_0134"
                     /codon_start=1
                     /transl_table=4
                     /product="hydrolase"
                     /protein_id="YP_005880311.1"
                     /db_xref="GI:385325874"
                     /db_xref="GeneID:12396350"
                     /translation="MIKDFKDINPNKKPTKIFAFGGLEEVGKNMYGIEYDDELIIVDC
                     GIKFSSVELLGIDGIVPNFAYAKANQHKIKALVITHGHEDHIGGIPYLLREVSIPVIY
                     APLMATKLIEKKLHEHHNLNQYKIVSYNDKSQFSTKHFKIDFYRVCHSIPDAFGVCVQ
                     TPNGNIVESGDYRFDFNAGNEELDIHKVVEISRRGIDLFMTETTNAEIPGFSSSEKEI
                     YDNIRNIIKNANGRVILSTFASNVTRISEVIEIAIQHGRKICLLGKSMDNNVSISRDV
                     GYINLKDDDIVESRYVEQHPDNEIMIFCTGSQGEELAALNMLASGRHPWIQLKKTDSI
                     IMSSNPIPGNYAAVERLLNELSKEEGISIYENSPTLKLHASGHATMQEIQLMLSLLRP
                     KYLFPIHGEYKMFTSLKRIAKKCGFDPENVALHKNGQIVYLIDRELYYTKETIDAEPL
                     FIEGKSVSPNVKRIMNTRQVLSEEGIFAITVVIDKATKQIKTLPKLKSSGCFYLKESH
                     GLMTKIAYEIKTNANEYLAKNQNYSEHELKKIIHESCRFYIWRNKHRNPLVVSNIREI
                     "
     misc_feature    complement(22123..23790)
                     /locus_tag="MGF_0134"
                     /note="mRNA degradation ribonucleases J1/J2
                     (metallo-beta-lactamase superfamily) [Translation,
                     ribosomal structure and biogenesis; Replication,
                     recombination and repair]; Region: COG0595"
                     /db_xref="CDD:223668"
     misc_feature    complement(23290..23745)
                     /locus_tag="MGF_0134"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; pfam00753"
                     /db_xref="CDD:250108"
     misc_feature    complement(22603..>22701)
                     /locus_tag="MGF_0134"
                     /note="RNA-metabolizing metallo-beta-lactamase; Region:
                     RMMBL; pfam07521"
                     /db_xref="CDD:254257"
     gene            24243..28328
                     /locus_tag="MGF_0139"
                     /db_xref="GeneID:12396351"
     CDS             24243..28328
                     /locus_tag="MGF_0139"
                     /note="MGF_0139"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="YP_005880312.1"
                     /db_xref="GI:385325875"
                     /db_xref="GeneID:12396351"
                     /translation="MFNLIKSVIRSFKKAKVALISLTFLIFLSSLTYSLLDNTNKNLE
                     SSYAYVNQKGNAADLVINEKYDFGTLQFDSDPSIVNPNVDLTNTNKVHIFLSAESITP
                     YLNTIISNDSANIYTNLISYEINLNSNLSNQQRINLVQNEIITASNRLRNQLQSDPNA
                     KIDKILNDENIEFERYESLDVSEGDLQKKIVRTNSDYQVDKLVLYDGQMISNSGHNYQ
                     QILDQFMKLKADYNQLRIDQIPGFIKDNQDLKTILKVVLTGINPDTNNPNLANFVQSA
                     TKVVNNQPLNNNEQQRIQEFIDTETNPINNNWSINFQWKYQIVPLSVRLINPSSYFVI
                     VSASNWKHDQQTDGKMIFQDQEMIDQLMSLNGDAFLERFNTISDRYKIEIDQTSYLIL
                     GTGVSPEFVYPIYSFTNFIPNPVNQRIYYVNDYGYSRLREAFSTNPIETNIVGRFKDR
                     NLSQAQRQLALDKINQWASINMAWPPNLKSAYFANDISNILNLTAARTTFIPSLLNTI
                     KNTSLMLMAIIILLALMVGILIVKSYIDKNRQTLGILLANGFNKTKINLSMAIFSFIP
                     SLIGGMAGYILGYILQEVAINAFSSFWFIPVELRRFSATALVTSFFLPVIIFGFTSFL
                     VSVYLMRKNVVDSLKNDSEYKVSKISVYIKKPIAILSVMNRFRISIAFNSMWKLFLLC
                     ILSAATMVVLIFSLSTLNVYDKAKNDTFGANNYKYYVDLATPTQQSGLIMYQEFKDLG
                     KTDAALAGWEDHKNYFLANSRTDPNQSGWSNLHIVGLNDIIDQSSKVTYLKNYVQSKI
                     GLDYLIGLGVLSANPWSLSSSLMPSNQAAASEKSYEIFLQAIANNVYPNLKTPADNDP
                     SYYIRIVFNPQLNRNVYEINQDQALSGGVLKPEFIHFLIQQFENISNNTYGLVDYKIT
                     YNVIGLGAKTIGDIKDKESPKFAYTRIDTVTDNDQKFQIKGIKNWIKTTNLDEVDRKD
                     YLGPILIDNNNKVINQKLFNQTDDNPIIINEFVAKNNHWKVGDTIDFTITNRVDRISD
                     KLNIINHDEYLKNQKVKFKVIGISSSARDNDLYTSYDLANKLLGFSDFEIKHKLPFNG
                     YYSDDLDAFERSTPLFSESGLLPSTSNFSVDNKQLQKIIRNSILNYQSTLTTSTPYNQ
                     LSSTRQAYVDDYKALLVALGEVKNLDGNNFHQWTELKADNQSVSDYIKKLVNVYGSLP
                     YNTMINFLYNSSSNRTIFENISKTSLTIQNVIIAMIVPIVTLIVILISNMLIDELKKI
                     AIRMKALGFSDRAIIFSFLSIYIPVFIFGLLVGGPLSLILVNIYNLIILKSASIALFT
                     TISITHILGALIGVMGIFSISFFTNWYTLRKMKIAQEIKNY"
     misc_feature    <25281..26159
                     /locus_tag="MGF_0139"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    25779..26144
                     /locus_tag="MGF_0139"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     misc_feature    27942..28304
                     /locus_tag="MGF_0139"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            28332..29831
                     /locus_tag="MGF_0155"
                     /db_xref="GeneID:12396352"
     CDS             28332..29831
                     /locus_tag="MGF_0155"
                     /note="MGF_0155"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005880313.1"
                     /db_xref="GI:385325876"
                     /db_xref="GeneID:12396352"
                     /translation="MMMSNFQLTKQIEEVKIANELDYLSLDWDQPAVYFVDNFGDFNN
                     IYNSYIGNVIYYMRQKTEAVLLLRPNFRIQVNNFCNDLLYLKQTLDNTYGKMFASENY
                     QTKQKQYLVKKFIDHVNELSNRLIYHINDFIFELKQKKRPVERKLSVRTAQEYEVILN
                     QESAAIIDYFKKLENNISDDSYLDPSWLKKTEVSIKQREDKIKDFFKVLHLKNFARVK
                     LSNIYKKIDKFKQNLETAFWNLEVSKVEILNKPHKIRQTNPIRPDFVIDLRNVTKYYS
                     NGVTTTKVLKNVNLQIPWGEFVVILGPSGSGKTTLLNIISGMDRASSGITFVANKNLI
                     GFSDTQLTKFRQENIGYIFQQYGLLPNLNVKENIEVGAFLQRDASKRKDIDELLKNIG
                     MYEQRNKLPTELSGGQQQRVSIARAIAKNPTVIFGDEPTGALDGEMTQVVLEEFVQIN
                     KKNKTTLIIVTHNPLIADIATMVIRVGDGTIKSITRNENPKSVKEIHWG"
     misc_feature    29124..29792
                     /locus_tag="MGF_0155"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    29127..29774
                     /locus_tag="MGF_0155"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    29235..29258
                     /locus_tag="MGF_0155"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(29244..29249,29253..29261,29391..29393,29613..29618,
                     29715..29717)
                     /locus_tag="MGF_0155"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    29382..29393
                     /locus_tag="MGF_0155"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    29541..29570
                     /locus_tag="MGF_0155"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    29601..29618
                     /locus_tag="MGF_0155"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    29625..29636
                     /locus_tag="MGF_0155"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    29703..29723
                     /locus_tag="MGF_0155"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            30233..30916
                     /locus_tag="MGF_0165"
                     /db_xref="GeneID:12396353"
     CDS             30233..30916
                     /locus_tag="MGF_0165"
                     /note="MGF_0165; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880314.1"
                     /db_xref="GI:385325877"
                     /db_xref="GeneID:12396353"
                     /translation="MFLSSCTGITLTRQNFVDTSVSNNRQPNNSNPSSNQGTTNPIQS
                     NNQDSTHPNLYGVLNPSVLGRPDNQSDLTQHEDQNPLSASRPNINGVRSAQPNQGGSD
                     SQNQGNNGNTNSLIPDITQPAREQTPAPLCTVRVSSYELTNTGLLGADKSEVVIDILD
                     NKITLGSKIQNHFSTSLETSKLLEIFAKNASTYSPNFILTDKKPSDWQTYTSTNSFYV
                     SNEQEQTEL"
     gene            31390..31857
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /db_xref="GeneID:12396354"
     CDS             31390..31857
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /EC_number="4.6.1.12"
                     /note="MGF_0172"
                     /codon_start=1
                     /transl_table=4
                     /product="2-C-methyl-D-erythritol 2,4-cyclo diphosphate
                     synthase"
                     /protein_id="YP_005880315.1"
                     /db_xref="GI:385325878"
                     /db_xref="GeneID:12396354"
                     /translation="MNIRIGQGFDSHKLKTKKNSRVFLGGIPVKTDQQLIANSDGDVV
                     LHALSDAVLGCGSFGDIGMYFDENDLSNKGLDSKTILNYCLKLIKKLKLEFVNIDLTI
                     FAQDIRIDPIRFEIKSSLMKLTGCNSVNVKAKSYEEPKNEIACSCVVLMNTNK"
     misc_feature    31399..31842
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /note="MECDP_synthase
                     (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase),
                     encoded by the ispF gene, catalyzes the formation of
                     2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the
                     non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid
                     biosynthesis; Region: MECDP_synthase; cd00554"
                     /db_xref="CDD:100025"
     misc_feature    order(31399..31404,31408..31410,31414..31416,31420..31428,
                     31438..31440,31549..31551,31555..31560,31564..31569,
                     31678..31680,31684..31686,31690..31692,31711..31713,
                     31717..31719,31777..31779,31783..31788,31795..31803,
                     31825..31827,31831..31833,31837..31839)
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100025"
     misc_feature    order(31417..31419,31423..31425,31525..31527)
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:100025"
     misc_feature    order(31567..31569,31573..31575,31699..31704,31708..31719,
                     31786..31794)
                     /gene="ispF"
                     /locus_tag="MGF_0172"
                     /note="CDP-binding sites; other site"
                     /db_xref="CDD:100025"
     gene            31864..32409
                     /gene="hpt"
                     /locus_tag="MGF_0175"
                     /db_xref="GeneID:12396355"
     CDS             31864..32409
                     /gene="hpt"
                     /locus_tag="MGF_0175"
                     /EC_number="2.4.2.8"
                     /note="MGF_0175"
                     /codon_start=1
                     /transl_table=4
                     /product="Hypoxanthine-guanine phosphoribosyltransferase
                     Hpt"
                     /protein_id="YP_005880316.1"
                     /db_xref="GI:385325879"
                     /db_xref="GeneID:12396355"
                     /translation="MSKLNYTIEKILITNEQINEAAIKAANWINQTYKDDEIILVGIL
                     KGCIPFIGKIIDKIECEMILDFMTLSSFKGETKSQGTPKIVMDLAYDVMDKNVLLVED
                     IIDSGNTIKIVLDLLKQRGAKSVRLLTFLDKPSGREVDVKADYVCFEVPHGFLVGFGL
                     DYKDKLRNLPYVAHMVSNDKK"
     misc_feature    31939..32310
                     /gene="hpt"
                     /locus_tag="MGF_0175"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(31993..31995,31999..32001,32164..32172,32176..32190,
                     32260..32262)
                     /gene="hpt"
                     /locus_tag="MGF_0175"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            32435..34732
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /db_xref="GeneID:12396356"
     CDS             32435..34732
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="MGF_0179"
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protease ftsH-like protein"
                     /protein_id="YP_005880317.1"
                     /db_xref="GI:385325880"
                     /db_xref="GeneID:12396356"
                     /translation="MSNTSNFNERVTENAKPPKNVKSIIWKTIGIIIVMAIIIGLILF
                     YVLPRNTIANISNIQYVDGNLVATATINGRSGRFILDLENSTYQTSYTSGLSLSISVF
                     LRNLNNANGQSFFVSLIRPATSSANDTVFNIANLSINQTRGVATLVTEGGSYSAVLTT
                     TLTALPLTGQKFLLEGFNLDTANADAYRAAGAIPGIQRLLAVGNVQLPNQSTAILTQF
                     LTSIIPFVILIVIYIVIARRFSRTMGAGGAIGEDGENVFTIGKSQAKLAKSTFKFTDV
                     AGIEEEKSELIELVDYLKRPGKYVQMGARTPRGVVLYGPPGTGKTLLAKAVAGEAGVP
                     FFQVTGSAFEDMLVGVGAKRVRNLFAKAKKAAPCIIFIDEIDSVGSKRGKYEISAGSA
                     TDQTLNQLLAEMDGFSTRTGIIVMAATNRLDVLDDALLRPGRFDRHIQVNLPDIKERE
                     AILKIHSRNKNISSKVNLLDIARRTPGFSGAQLENVLNEATLLAVRADRTSISLTDID
                     EAIDRVIAGPAKKSRVISDFEKNQVAHHEAGHALVGLHLKGADEVQKITIIPRGQAGG
                     YTLSTPKDAELNLKKKSDLLNMIAGALGGRASEELFFGKDAISTGASNDFYKATNIAK
                     TMVTQLGMSDLGITQFLPSEGGINPNARYYSENTAQRIDEAIAKILEEQYQVAYNIIK
                     DNQNELKLIVEALLIQETIVKNDIDYIHEHLKLPEAIIKLKEEQLKEKAAAQKEEQAE
                     KAKLDHQSDSAQPQEEPTASTASSN"
     misc_feature    33149..34567
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    33263..33763
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    33374..33397
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(33377..33400,33551..33553,33692..33694)
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    33539..33556
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    33734..33736
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    34001..34561
                     /gene="ftsH"
                     /locus_tag="MGF_0179"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:250619"
     gene            34778..35401
                     /locus_tag="MGF_0194"
                     /db_xref="GeneID:12396357"
     CDS             34778..35401
                     /locus_tag="MGF_0194"
                     /note="MGF_0194"
                     /codon_start=1
                     /transl_table=4
                     /product="dihydroxyacetone kinase family protein,
                     ADP-binding subunit dhaL"
                     /protein_id="YP_005880318.1"
                     /db_xref="GI:385325881"
                     /db_xref="GeneID:12396357"
                     /translation="MENRSAFINLLIRIIDNFTYSEQFLNLIDKKGSNGDFVDSLTPF
                     INKISQFANREDNQISFYNSLKIIALYIKETIKTTLGAILYDLTHQAAHYLDQNKLSR
                     NHLIESFYRALLDCKNKYQLRIGAKSFYDILYPVLKYLYLNNDLSTQELMAQSQKILD
                     ENFNKSLLLKSKVGRASYHGKRSIGMYDPGTVFIYIILEGIIKIYDQ"
     misc_feature    34970..35380
                     /locus_tag="MGF_0194"
                     /note="DAK2 domain; Region: Dak2; cl03685"
                     /db_xref="CDD:261838"
     gene            35391..36281
                     /locus_tag="MGF_0195"
                     /db_xref="GeneID:12396358"
     CDS             35391..36281
                     /locus_tag="MGF_0195"
                     /note="MGF_0195"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880319.1"
                     /db_xref="GI:385325882"
                     /db_xref="GeneID:12396358"
                     /translation="MISKILNPKLRRIVVITAWILMIIPLIATYFFINTPVVLYSLYF
                     SLYPISLILYVGHYYLHLRLRKKLNEQYQAKAIFEGLEKTKKLKIKRVNDQFLNKEMI
                     KQIIKLSDGEIQNLDKRFSQPNFYQEYQVNDHNDQLRISCLEFCKSKYSLNYPYKYDC
                     YYWFELKNLSDQPFVLLNKKEAQNPGFSKYLVNGLKPNFQDKFVLYTNQENFDLTKVI
                     DDEILNDLLFKKPDTNINLVNKNNKTFLLLRMSFNIFNLYYGSDYFDETTYHQLVIQR
                     VENIKLLIDLFYSLRECIND"
     misc_feature    <36021..36257
                     /locus_tag="MGF_0195"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     gene            36339..36605
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /db_xref="GeneID:12396359"
     CDS             36339..36605
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="MGF_0199"
                     /codon_start=1
                     /transl_table=4
                     /product="phosphocarrier protein HPr"
                     /protein_id="YP_005880320.1"
                     /db_xref="GI:385325883"
                     /db_xref="GeneID:12396359"
                     /translation="MKSFKATIIDPFGLHVRTATVLSSKMGGFKSKVTLKIVGGATAD
                     VKSIINLMSLAVKQNTAVEFIIEGEDEEKACEELQKALKDNKLI"
     misc_feature    36351..36584
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    36351..36362
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(36378..36380,36384..36389,36393..36398,36408..36410,
                     36417..36419,36474..36485,36492..36497)
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    36381..36383
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    36477..36479
                     /gene="fruB"
                     /locus_tag="MGF_0199"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            36670..38658
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /db_xref="GeneID:12396360"
     CDS             36670..38658
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /EC_number="2.2.1.1"
                     /note="MGF_0202"
                     /codon_start=1
                     /transl_table=4
                     /product="transketolase"
                     /protein_id="YP_005880321.1"
                     /db_xref="GI:385325884"
                     /db_xref="GeneID:12396360"
                     /translation="MNIQQQTINTIRVLGIEMINNAKSGHPGMVMSAAPMMYALFHDH
                     LNYDVSDPNYLNRDRFILSAGHGSALLYATMYVAGYKTLSTKDLKNFRKFSSKTPGHP
                     ESTMLAGVDFGTGPLGQGAATSVGFAIAEANLSARFDKIINHYTYCLIGDGDLQEGVC
                     QEALAVAGRYKLNKLIWLYDSNDVQLDGRVENSTNFDVEMLVKSYRWNYILIKDGNDY
                     QEISNAIAQAKKSDKPTFIEVKTKLGFASSVENTNKAHGSPFSDEEIKNIKAKFDYKN
                     KPFTVSAEVKNHFESAISRGLKAAEEFNQRLAKAKPELKEKFITQVKEEKINFPKSLI
                     NEFNVDQYDSTRNLFGKVFKELTKINDNILVVNCDLSSSTKVVTHNNARFDHGHYQNQ
                     FVDVGVREFLAGCIVNGIVAHKGLKAVSSTFMAFSDYNKPALRLGAINKLSSLYVYSH
                     DSFNVGEDGPTHQPIEQLSALRLIPDVLVYRPANFYELYIALKTAFDKKNHKPVVIST
                     SRSEFDLTKVNPKTFDEGYYYLNKTKSPKLRLIATGSDAGTALKLAKIFKQEGIDIDV
                     ISVVSFKKLKEKLADLEVLKEFKKYKNIVIESGVSNIWFEFVSLVIGVNDFGLSGNPN
                     EVATYFSMDLESLVKSLASILHKNYTQQKIEELIKNAN"
     misc_feature    36670..38607
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="Transketolase [Carbohydrate transport and
                     metabolism]; Region: TktA; COG0021"
                     /db_xref="CDD:223100"
     misc_feature    36694..37476
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="Thiamine pyrophosphate (TPP) family, Transketolase
                     (TK) subfamily, TPP-binding module; TK catalyzes the
                     transfer of a two-carbon unit from ketose phosphates to
                     aldose phosphates. In heterotrophic organisms, TK provides
                     a link between glycolysis and the...; Region: TPP_TK;
                     cd02012"
                     /db_xref="CDD:238970"
     misc_feature    order(36865..36867,37012..37014,37018..37020,37123..37128,
                     37138..37140,37213..37215,37219..37221,37225..37227,
                     37435..37437)
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    order(36943..36945,36967..36972,36976..36978,37015..37020,
                     37024..37026,37132..37143,37150..37155,37162..37164,
                     37174..37176,37222..37227,37270..37272)
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    37708..38199
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    order(37750..37752,37756..37758,37774..37776,37843..37845,
                     37852..37854,37858..37875,37882..37887,37891..37899,
                     37954..37956,37963..37968,38041..38043,38050..38052,
                     38098..38103,38164..38166)
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(37774..37776,37852..37854,37861..37869,37951..37956,
                     37960..37962,38041..38043,38047..38049,38074..38079,
                     38083..38088,38092..38094)
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(37861..37863,37867..37869,37945..37947,37954..37956)
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    38275..38526
                     /gene="tktA_1"
                     /locus_tag="MGF_0202"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            38648..41320
                     /gene="secA"
                     /locus_tag="MGF_0213"
                     /db_xref="GeneID:12396361"
     CDS             38648..41320
                     /gene="secA"
                     /locus_tag="MGF_0213"
                     /note="MGF_0213"
                     /codon_start=1
                     /transl_table=4
                     /product="protein translocase subunit secA"
                     /protein_id="YP_005880322.1"
                     /db_xref="GI:385325885"
                     /db_xref="GeneID:12396361"
                     /translation="MLINWFKLISPKNRILKRATLAAKQVDALKDEMRALSDEQLFNK
                     TEYFINELKNNKTTDDILVEAFAVIREVVYRETGNFAYLVQLIGAYVVHQGDFSEMMT
                     GEGKTLTLVLAAYLNMLEKKGVHIVTVNEYLAERDAEQARRIFARLNLTVGCNKANLA
                     PHLKKEAFDCDLTYTTNSELGFDYLRDNMVRNYRDKKIRGLHFAIVDEGDSILIDEAR
                     TPLIISGQPKKDFRMYFDADKFVETLSESDYKIDPESRSPSLTEKGITKAEKHFKINN
                     LFDLENSDLFHKIGNALTARKIFQNGKEYIVRDDKILIVDHFTGRILEGRSYNGGLHQ
                     AVQAKERVPIEAENVVVATVTYQSFFRMYKKLAAVSGTALTESEEFLKIYNMVVVPVP
                     TNRPVIRKDHPDFMFGNLKTKWEAVVNEIEKIHKTGQPILVGTGSVEDSETLHQMLLE
                     KNIMHEVLNAKNHAREAHIIAKAGEVGAVTISTNMAGRGTDIKLGKGAKELGGLYVIG
                     TERHESRRIDNQLRGRSGRQGDIGESRFFISFGDPLFKRFAQDRILKAQEKLASDYFD
                     SKFFSRFLTMTQKKVESVNFDMRKNLIDYDHVLANQRELIYKQRDKILIASDLTEVVD
                     RMAQNFVEGFVETFKDQANQTMVNPIELSIAVQKELLQGEEVAASQFYNQTLLAAKQT
                     VLKLVKDAISKKIEVMTVAIANNVFRDIIIQQMDDAWIHHLDQMLKLREGVSLRSLEQ
                     TSPLNIYVEESKKLFDLMLNKIAKNVILAVCAIINPTRNVDINVEQEHRRLEALKRLE
                     EIKKLEELQNNNNEPAKVLFKFPDQHGNMIEREVPVDNLIQLVDGQIIQAQVAEEPKQ
                     ELNQLEKVDQLDQTLIEAKLAEQREQKNNSATDK"
     misc_feature    38654..41251
                     /gene="secA"
                     /locus_tag="MGF_0213"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: secA; PRK12903"
                     /db_xref="CDD:237258"
     misc_feature    39323..39658
                     /gene="secA"
                     /locus_tag="MGF_0213"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; smart00958"
                     /db_xref="CDD:214938"
     misc_feature    40343..40960
                     /gene="secA"
                     /locus_tag="MGF_0213"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     gene            41602..43833
                     /gene="mslA"
                     /locus_tag="MGF_0229"
                     /db_xref="GeneID:12396362"
     CDS             41602..43833
                     /gene="mslA"
                     /locus_tag="MGF_0229"
                     /note="MGF_0229"
                     /codon_start=1
                     /transl_table=4
                     /product="mycoplasma specific lipoprotein A"
                     /protein_id="YP_005880323.1"
                     /db_xref="GI:385325886"
                     /db_xref="GeneID:12396362"
                     /translation="MKVKSFKKVIGALGIFASASLFVASCTKASTRFDQVDDGKLVLA
                     STFSSSSPIALSLNDVIEQYNKNKPAGNYPVEIFSIAGGYNGGLQTVNTKLAAKDKTQ
                     FFNMIFNYQAVTAQLVRHDLALELNKGAEPVDVSAFPDQFLQENYDILGNTDRAVYGV
                     PFTRSTEVLVTNVPVVYQLLSQATTNGDLKISDDEATQKLWAEWKMKAQTNLGNNTRS
                     NKPSRAAGEMAVTENGMQAEQPANQAPVSSEFIKKLWGDYTSVEGGLKGYTFSASALD
                     TTTSLLDLSTRIAKSYPNNLKPVNDRKPASPQGVIGIDSPSNYLFNATFSQVNGNKDN
                     FMIRKTANNRTYDYNALLSNQDNRNEQLKNAFNALSPLINANGLFLNNGGNYSSNWGK
                     YHQLGFFLSSTSGYYQSFVGNSAAFNLVFKGVDPSVGTYPFPNFTSNLYAPTKAEYDA
                     GALGAFTSSRKRWVIYKKDSLTDALKQTETNVAITDEANRAKAEEALSKNLEPIKDNL
                     STEKNKKLIGYIGTGFELDKFDSAVKNKVYQAGNLNNRNFMSAFVLTSDVDKKSVPSE
                     QSLQVSEADIRIAPTKFQASATKNTIITQGPSLIGIHANEKEDLQTKRFINWLIKGNI
                     NIPATTNAQGRETSSAYQGTPLNYLVAKASYILPTREFLNNPKNEQTNNPYQKIATHV
                     FKSILDDPNNYVPYTDAPDFRSGSFRQSLDSTLVSANSSKSNFDTFMNNLDKAVPTIV
                     KQN"
     misc_feature    42442..43161
                     /gene="mslA"
                     /locus_tag="MGF_0229"
                     /note="Mycoplasma MG185/MG260 protein; Region:
                     Lipoprotein_X; pfam03305"
                     /db_xref="CDD:251860"
     misc_feature    43378..43767
                     /gene="mslA"
                     /locus_tag="MGF_0229"
                     /note="Putative mycoplasma lipoprotein, C-terminal region;
                     Region: Lipoprotein_10; pfam03202"
                     /db_xref="CDD:251795"
     gene            43898..44728
                     /locus_tag="MGF_0241"
                     /db_xref="GeneID:12396363"
     CDS             43898..44728
                     /locus_tag="MGF_0241"
                     /note="MGF_0241"
                     /codon_start=1
                     /transl_table=4
                     /product="nuclease-like lipoprotein"
                     /protein_id="YP_005880324.1"
                     /db_xref="GI:385325887"
                     /db_xref="GeneID:12396363"
                     /translation="MKFTKFLLVAGTLGLSVSFFSACTNSTSNIPADSKPFWENLSNQ
                     YSVTKFSDEQIKNNLQKAKLLRWTDGDTPVIQFYQADNPDQLSNETSSIRIEGIDTPE
                     KTRVADNNVRVPSGEPELKYAEAATQFAQRTVPEGSDVYFWYSGSKSFNRLVGTIYYG
                     FDPAKKTAINYGAQVVLNGLAIPLIKSVTSLLDQNSEIYVSTRPIGIAANLAILNKMN
                     IWSLDSDLNKSLKDIYNVRGVDSSWVSYLYPGTNNYKTYARKGPDANDYVQTIWPFYE
                     "
     misc_feature    44093..>44440
                     /locus_tag="MGF_0241"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    order(44108..44110,44174..44176,44192..44194,44201..44203,
                     44342..44347,44351..44353)
                     /locus_tag="MGF_0241"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            44792..46525
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /db_xref="GeneID:12396364"
     CDS             44792..46525
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="MGF_0247"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type sn-glycerol-3-phosphate
                     transport system ATP-binding protein"
                     /protein_id="YP_005880325.1"
                     /db_xref="GI:385325888"
                     /db_xref="GeneID:12396364"
                     /translation="MKNSKSTLEIQIDNYQNKHQEYAKHKNETPAIVINNLVVDFGET
                     LALDNVSFEVKKGKLVTFLGPSGCGKTTTLNAIAGLLTPTSGQILFSGYDVTDKSPKD
                     RKLGLVFQNYALYPHLTVYENIAFPLYNDEAWKKKAAFKSLMSLTRAECVVFKANGAT
                     QEELDAWNKSGENRYYIPIQMRMDSDNKEINLNKKLRELNSQRRLLGVKKYIEISRLS
                     KDVAEKLTQAKKANDKQASDQLKKDYQKEVIEIKKKYKKLILENQQEIAKEKQLIKNS
                     PELVEIRKLKSQMFRIDRELTAIYKKLRQKLIEKYSLNLNKLSPEQKAEYDLQMKNNI
                     SLKEAVNQAVLEVANRVEITKNLAKFPTKLSGGQQQRVAIARSIVRHPKILLMDEPLS
                     NLDAKLRVQTRQWIRSIQSDLHITTIFVTHDQEEAMSISDEIVCMSNGSIQQIGTPTE
                     LFNKPKNEFVAKFLGLPEMNILTCELKNNKIYFNNNVIAQTNLPKDYPKIRVGFRDDT
                     MTIKPDGINQAIIKQIENLGKITVVKCEFYDQLINVKLNHPNYQIGEVINFDIDHNKL
                     HYFDAETTNRI"
     misc_feature    44882..46507
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    44885..46186
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    44981..45004
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(44990..44995,44999..45007,45119..45121,45953..45958,
                     46055..46057)
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    45110..45121
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    45881..45910
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    45941..45958
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    45965..45976
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    46043..46063
                     /gene="ugpC"
                     /locus_tag="MGF_0247"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            46528..47517
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /db_xref="GeneID:12396365"
     CDS             46528..47517
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="MGF_0259"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type sn-glycerol-3-phosphate transport
                     system permease protein ugpA"
                     /protein_id="YP_005880326.1"
                     /db_xref="GI:385325889"
                     /db_xref="GeneID:12396365"
                     /translation="MFFNWLLKKRQQKRNTELGILDKKVKIWVPLALLFPSFIAIFLF
                     TILPFLMVIEKAFTPLADIFNLKSATFGVRNFELLFTSRPFVIGLRNSFLYSIISLPV
                     TLMIALIISSAIVFVYNKVAKGFWQTIFFLPYVTSSVAISIAFIYILDSSTGVLNAII
                     GKNIPWLTSGEIDGYKALFGILIYGVWRNLAFNVLILSMAMLSVDKTLYKAASIDSAS
                     PIKQFFKITLPSIKKSINFLLTLGILGGLQVFPLAIFSNNPDAAISNGASTVLIFIFR
                     SIRSADYGIAGAATIILFVLGTLYGLFLRNTVNLFDAIILKVKIRNVRIKAKI"
     misc_feature    46792..47418
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(46840..46845,46852..46857,46870..46872,46903..46914,
                     46918..46947,46954..46959,46963..46965,47083..47088,
                     47095..47097,47101..47103,47110..47115,47119..47121,
                     47131..47136,47143..47145,47194..47196,47236..47241,
                     47248..47250,47269..47280,47287..47292,47338..47343,
                     47371..47376,47383..47388,47392..47397,47404..47409,
                     47416..47418)
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(46921..46965,47269..47286)
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(46963..46965,47068..47070,47287..47289,47332..47334,
                     47341..47343,47371..47373)
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(47146..47184,47200..47205,47215..47217)
                     /gene="ugpA"
                     /locus_tag="MGF_0259"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            47492..48469
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /db_xref="GeneID:12396366"
     CDS             47492..48469
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="MGF_0266"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type sn-glycerol-3-phosphate transport
                     system permease protein ugpE"
                     /protein_id="YP_005880327.1"
                     /db_xref="GI:385325890"
                     /db_xref="GeneID:12396366"
                     /translation="MFALKLKFKNWISNLKIKKNYERVSLEIKDTTWRSIILGFIFKS
                     LILLFFGMIIIFPFYFMIVVALAPDAQVLDQRKPILWPDSFNFVNFARVLREADYWYA
                     LLVTSFITALSVILRLFFTMTFGYAFSLKNWKFKRAFWLLYLSILILPESALLIGQFR
                     TITLLQWNDRADPKILISLVTPYVASIFSGYMFKNAFEAIPSRIKESALIDGCSGAKY
                     FFKVAVPLVKPTIWTVTILTSFASWNSYLWPLLLLDSQSKVFNVINLWVIRQGIDPNS
                     DPSGQQIILTNLRMAATIVAIVPMFIVYFIFRKRIMTSVGRRGNNTIKG"
     misc_feature    47612..48427
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    47798..48304
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(47846..47851,47858..47863,47876..47878,47906..47917,
                     47921..47950,47957..47962,47966..47968,48041..48046,
                     48050..48052,48053..48055,48062..48067,48071..48073,
                     48083..48088,48095..48097,48146..48148,48188..48193,
                     48200..48202,48221..48232,48239..48244,48281..48286)
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(47924..47968,48221..48238)
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(47966..47968,48026..48028,48239..48241,48275..48277,
                     48284..48286)
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(48098..48136,48152..48157,48167..48169)
                     /gene="ugpE"
                     /locus_tag="MGF_0266"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            48664..49632
                     /locus_tag="MGF_0272"
                     /db_xref="GeneID:12396367"
     CDS             48664..49632
                     /locus_tag="MGF_0272"
                     /note="MGF_0272; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="exopolyphosphatase-like protein"
                     /protein_id="YP_005880328.1"
                     /db_xref="GI:385325891"
                     /db_xref="GeneID:12396367"
                     /translation="MVKGNILQAVQTIEKYDYIVIFHHIRPDGDCLGSQFGLKELIET
                     NYPNKEVKVVGDKKDCFPFLEMNHDHIDHEWFKNKKVLGIVVDANFKERIECRSLIDD
                     QLFDAILRIDHHPNEDDLDAKAFFIDSSYIAAAEQVADIAYQSKWKVTPKAANYLYLG
                     IYTDSGRFLFKNTSARTYMLASFLADANADLFYINQNLSKVSLSDLKFKQYVFANYKT
                     KDQVIYFVCSKAVQKELNRTSFECARVNMLSNIEDFRIWLFFIEEDDNKWRIDFRSNG
                     PSVRTIALKWGGGGHEMASGAIINGEENIINVVNDCSEQIKSFLEH"
     misc_feature    48664..49629
                     /locus_tag="MGF_0272"
                     /note="Exopolyphosphatase-related proteins [General
                     function prediction only]; Region: COG0618"
                     /db_xref="CDD:223691"
     misc_feature    48700..49149
                     /locus_tag="MGF_0272"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     misc_feature    49432..49578
                     /locus_tag="MGF_0272"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            50551..52545
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /db_xref="GeneID:12396368"
     CDS             50551..52545
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="MGF_0283"
                     /codon_start=1
                     /transl_table=4
                     /product="excinuclease ABC subunit B"
                     /protein_id="YP_005880329.1"
                     /db_xref="GI:385325892"
                     /db_xref="GeneID:12396368"
                     /translation="MAEKKFKLVSKNKPAGHQPEAIKKLVDGINKNKKYQTLLGATGT
                     GKTFTIANVIEKTQKKTLILAHNKTLAAQLYLEFKELFPNNAVEYFVSYFDFYQPEAY
                     IPRTDMYIEKSSVTNDEIEMLRLASLNSLSTRNDVIVVASVACIYPAANPEDFDIYRI
                     ILKVGNTLKLSDLKENLIRLNYARSPECNEPGTFRIKGDVVDIFPGYVNDHIIRLSFF
                     GDELEEIRKIHPTDSSVIEKYTSYVLGPANEYILNFERKDTAIKRIQEELMFRVQEFK
                     NQQKLVEAQRLQQRTEYDIDAIKEFGFCNGIENYAFHLELREKGSTPWTLFDFFGNDW
                     LMVIDESHISVPQVKGMFNTDKSRKTTLVEYGFRLPSALENRPLNYDEFSNKSDQVIF
                     VSATPNDEEIKLSNNEIIEQIVRPTGLLDPTVEIRPRLDQINDLMNELKKQKDKNERT
                     FITVTTIKIAEDLTEYLKERNFKCAYIHNELKTLERSLILNDLRRGKYDCVVGINLLR
                     EGLDIPEVSLVCIFDADKPGYFRSDKALIQTIGRAARNQNGRVIMYADEMTKAMKIAV
                     DETNRRREIQEKFNKDHKITPKTIIKPIYNDLRNKASHKQIEEAMRKTKAKGDKFIKM
                     IEDLRNEMLEAAKNQNYEHAASLRDLIIELETQQLNKTNK"
     misc_feature    50554..52533
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="excinuclease ABC subunit B; Provisional; Region:
                     PRK05298"
                     /db_xref="CDD:235395"
     misc_feature    50662..>50970
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    50677..50691
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    51034..51228
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="Bifunctional transglycosylase second domain;
                     Region: UB2H; pfam14814"
                     /db_xref="CDD:258951"
     misc_feature    51817..52212
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(51913..51924,51982..51987,52060..52068)
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(52084..52086,52162..52164,52174..52176,52183..52185)
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     misc_feature    52207..52332
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="Ultra-violet resistance protein B; Region: UvrB;
                     pfam12344"
                     /db_xref="CDD:256994"
     misc_feature    52417..52521
                     /gene="uvrB"
                     /locus_tag="MGF_0283"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            52591..53748
                     /gene="pstS"
                     /locus_tag="MGF_0294"
                     /db_xref="GeneID:12396369"
     CDS             52591..53748
                     /gene="pstS"
                     /locus_tag="MGF_0294"
                     /note="MGF_0294"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type phosphate transport system periplasmic
                     phosphate binding protein"
                     /protein_id="YP_005880330.1"
                     /db_xref="GI:385325893"
                     /db_xref="GeneID:12396369"
                     /translation="MKPLFRKKILLFFSVVSLSYLMSSCSLNFVVINTRGSSSVQPFM
                     DALSALYAKYEPVEISVQAGGSTSGISSVLDGTSNIGNASRSPRDQVLANPRTTQQWK
                     DLEIKTVALAKDAIAVIYKKPANASSNDFYVDANNISKLYDAFAGFNHVSLSDFYFGN
                     QKLPNDNIVPFARSGAASVSGTAEAFLHNSGLIKQDQLTKQTLEALQGRTDYGINTIT
                     TGESNVETYNFFKTNARLVGSMTYLSLGFILNNLEMIKNDGFDILNYKINDQLIIPSI
                     QTVTDGTYRWVRPYNAIFSLSNKDDNKLNSIKQFIKFTLFNQSADIKKQIDKVYELQG
                     LILLSDKELKQMFLLNDQLSNQSPQELIANHENLFWVSDFSFNPVKFGVEF"
     misc_feature    52684..53577
                     /gene="pstS"
                     /locus_tag="MGF_0294"
                     /note="ABC-type phosphate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: PstS; COG0226"
                     /db_xref="CDD:223304"
     gene            53748..55706
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /db_xref="GeneID:12396370"
     CDS             53748..55706
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="MGF_0303"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type phosphate transport system permease
                     pstC/pstA"
                     /protein_id="YP_005880331.1"
                     /db_xref="GI:385325894"
                     /db_xref="GeneID:12396370"
                     /translation="MLNTNKFNQFKKARSKLFHSISFTAAWLFAITFVGIFAFIFYKS
                     IPGWESYGKSIFRLDFNLVQNKAGIWAPLSVTLFVTFVSLLIAAPIGVNTAIFIKFRL
                     KEKWRKTFRIIINILAGIPSVVFGLFAANSLGFLVQAIFDTRTSWNLITAIIMLTFMI
                     IPTIVAMSYNSLDSVDMSILSASIALGTTKTKSIYKIFKKEAKNGIYVSLLTAFSRAI
                     SESMALNFILTSQNYNIVGHTPFNDFIQSGLKTIGAIISYNFFAENGSENLRSVLYLF
                     GIILFIFTIIINILVLFINKSSTKKKYPWAIKVETFIANIILFIPNKISQSIVYLINL
                     NKRSASYFKVHKNAIRVKAYDYWRQTVEFICMTICVGFILWILIYTFYHGFIAIFSPD
                     QTITSFAANSTGRATVNTLVIIFFGILIAFPISLFIAIYVNEYARNNKAKTTILFFID
                     ALSSTPSILFGIFGLTFFIQTLWLAIGGRSSNSMIAGILTISLVIMPAFIRMLQQALA
                     SVPNSTREASYALGISRSQTILKIILPQVIEHILSSIILSISRILAETAPLYITAGLS
                     SSNHFSLGLWGQTLTVRIYSQLFSTQANAQNIMFESAFMSIFLIFIFILISNLLIPYL
                     FKNKYKILIWWDKWKTKRKNKKDNLNYA"
     misc_feature    53964..54437
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(54012..54017,54024..54029,54045..54047,54075..54086,
                     54090..54119,54126..54131,54144..54146,54219..54224,
                     54228..54230,54234..54236,54243..54248,54252..54254,
                     54264..54269,54276..54278,54327..54329,54369..54374,
                     54381..54383,54402..54413,54420..54425)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(54093..54134,54144..54146,54402..54419)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(54144..54146,54204..54206,54420..54422)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(54279..54317,54333..54338,54348..54350)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    54825..55625
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="phosphate ABC transporter, permease protein PstA;
                     Region: 3a0107s02c; TIGR00974"
                     /db_xref="CDD:233217"
     misc_feature    54972..55439
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(55014..55019,55026..55031,55044..55046,55080..55091,
                     55095..55124,55131..55136,55140..55142,55224..55229,
                     55233..55235,55239..55241,55248..55253,55257..55259,
                     55269..55274,55281..55283,55332..55334,55374..55379,
                     55386..55388,55407..55418,55425..55430)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55098..55142,55407..55424)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55140..55142,55209..55211,55425..55427)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55284..55322,55338..55343,55353..55355)
                     /gene="pstC"
                     /locus_tag="MGF_0303"
                     /gene_synonym="pstA"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            55699..56676
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /db_xref="GeneID:12396371"
     CDS             55699..56676
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /EC_number="3.6.3.27"
                     /note="MGF_0310"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type phosphate transport system ATP-binding
                     protein pstB"
                     /protein_id="YP_005880332.1"
                     /db_xref="GI:385325895"
                     /db_xref="GeneID:12396371"
                     /translation="MHKKIDPQTKELYLQKKGEYKEKIKELVQKKKELLSIDNKDELI
                     KINEKIKRYKILYKNKDPNLIHFKDDYNFDNIFEIDNYNLWYSNKAKHALKDINLGIK
                     KNKVTALIGPSGCGKSTFIRSLNRMHDLTDGVSKTGSIFFLSKNIYSKTLPELELRSK
                     VGMVFQKPTPFSLSIYENIAYALKSHGIKDKTKIDQIVKESLEGAALWDDVKDILFQS
                     AYGLSGGQQQRLSIARAIALKPEVLLMDEPTSALDPIATNKIEQLIHQLKKSYSIVIV
                     THSMAQAQRVSDETVFFYEGRVLEHGTTKQIFTQPNNEKTKDYIDGRIG"
     misc_feature    55921..56673
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="ABC-type phosphate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: PstB; COG1117"
                     /db_xref="CDD:224042"
     misc_feature    55927..56619
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    56029..56052
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    order(56038..56043,56047..56055,56194..56196,56434..56439,
                     56530..56532)
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    56185..56196
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    56362..56391
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    56422..56439
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    56446..56457
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    56518..56538
                     /gene="pstB"
                     /locus_tag="MGF_0310"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     gene            56679..57365
                     /gene="phoU"
                     /locus_tag="MGF_0316"
                     /db_xref="GeneID:12396372"
     CDS             56679..57365
                     /gene="phoU"
                     /locus_tag="MGF_0316"
                     /note="MGF_0316"
                     /codon_start=1
                     /transl_table=4
                     /product="Phosphate transport system protein PhoU"
                     /protein_id="YP_005880333.1"
                     /db_xref="GI:385325896"
                     /db_xref="GeneID:12396372"
                     /translation="MSRNYKSLKYSEQELISKFYEYIDHGIKIHEKLLQALCNYKNHE
                     PYQEILDEIFKMEKHSNIKQADLLDDSTWIISKEQPQTSHLRFIIAIISSSNDIERIC
                     DYANNVAKFLLKNDNISPQKLDVIIDLQENSLNNYKDVVAHLKENDAEETYKFADIRQ
                     QEFESKYKRYLKNFKKYDLNSEDELQLNLLIDTILVIKNIERINDHLVNIVEYFVYIK
                     ESSFFFDKKI"
     misc_feature    56712..57347
                     /gene="phoU"
                     /locus_tag="MGF_0316"
                     /note="phosphate transport system regulatory protein PhoU;
                     Region: phoU_full; TIGR02135"
                     /db_xref="CDD:233742"
     misc_feature    56733..57014
                     /gene="phoU"
                     /locus_tag="MGF_0316"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    57054..57317
                     /gene="phoU"
                     /locus_tag="MGF_0316"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(57441..59609)
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /db_xref="GeneID:12396373"
     CDS             complement(57441..59609)
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /EC_number="1.17.4.1"
                     /note="MGF_0334"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribonucleotide-diphosphate reductase subunit
                     alpha"
                     /protein_id="YP_005880334.1"
                     /db_xref="GI:385325897"
                     /db_xref="GeneID:12396373"
                     /translation="MSDGFKEANGYLAYNAMSKLDEGKNSVLNDAKAVALYMQVHVKP
                     RTKKFNSIHERMDYLIKNDFYEKEVVENVSKEQLEELYGVIKEFDHEFPSFMGAFKFY
                     NSYCLKSNDGKEFYETYSERCLMNALFLGGKNFQNVKNILIEILSGRFQPATPTFLNA
                     GKKQRGEYVSCYLLRVEDNMESIGRAIVTSLQLSKRGGGVALCLTNLREFGAPIKNIE
                     GQASGVIPVMKILEDSFSYANQLGQRPGVGVAYLHAHHPDVMVFLDSKRENADEKIRI
                     KSLALGLVVPDITFELAKNNEQMALFSPYDVQREYGKPFSDIKVTEEYHNMVNNPRIK
                     KTYISARKFFQTIAELHFESGYPYLLFDDTVNNRNPNAGRIVMSNLCSEIVQSSTSTE
                     YNEDFSIKKLGQDISCNLGSVNIDKMMRSAERFEDSVYYAIKSLDHVSKSANLDCAPS
                     VKNGNANNHALGLGAMNLHGFLATHEIYYDSPEALEFTDFFFYTLAYYAFKASNRLAV
                     EQKQTYANFKTSKYADGSYFDKYTKCDPNTYVIKNPKIKEIFSNYKIKVPTQADWQAL
                     TEEIKKTGLANAHLLAIAPTGSISYLSSCTPSIQPVVAPVEVRKEGKIGRVYSLAYKL
                     NEHNYKYYKDGAYELGPNPYIDICAQAQKHVDQAISLTLFMNDTATTRDLNKAYIRAY
                     KSKCASVYYVRVRQNVLEESENLDWAKDQASTVDCEACQI"
     misc_feature    complement(57444..59597)
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="ribonucleotide-diphosphate reductase subunit alpha;
                     Validated; Region: PRK07187"
                     /db_xref="CDD:235952"
     misc_feature    complement(59340..59579)
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="Ribonucleotide reductase N-terminal; Region: RNR_N;
                     pfam08343"
                     /db_xref="CDD:254744"
     misc_feature    complement(57531..59255)
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="Class I ribonucleotide reductase; Region: RNR_I;
                     cd01679"
                     /db_xref="CDD:153088"
     misc_feature    complement(order(57843..57860,58380..58382,58461..58463,
                     58467..58469,58473..58475,59013..59015,59097..59102,
                     59145..59150))
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="active site"
                     /db_xref="CDD:153088"
     misc_feature    complement(order(58887..58901,58908..58913,58920..58925,
                     58929..58934,58944..58946,58980..58982,59025..59027,
                     59034..59039,59046..59051,59058..59060,59067..59072,
                     59109..59111))
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153088"
     misc_feature    complement(order(57537..57542,58386..58388,58461..58463,
                     58467..58469,58473..58475,59097..59099))
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153088"
     misc_feature    complement(order(58929..58931,58944..58946,58986..58988,
                     59025..59027,59061..59063,59070..59078))
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153088"
     misc_feature    complement(order(57561..57566,57570..57575,57585..57590,
                     57594..57602,58554..58556,58575..58577,58587..58589,
                     58728..58733,58737..58742,58749..58751))
                     /gene="nrdA"
                     /locus_tag="MGF_0334"
                     /note="R2 peptide binding site; other site"
                     /db_xref="CDD:153088"
     gene            complement(59706..60161)
                     /gene="nrdI"
                     /locus_tag="MGF_0337"
                     /db_xref="GeneID:12396374"
     CDS             complement(59706..60161)
                     /gene="nrdI"
                     /locus_tag="MGF_0337"
                     /note="MGF_0337"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribonucleotide reductase stimulatory protein
                     NrdI"
                     /protein_id="YP_005880335.1"
                     /db_xref="GI:385325898"
                     /db_xref="GeneID:12396374"
                     /translation="MENTPKLNVPKRKPTGEMRVVYFSSTTENTKKFCDKLGLPATRI
                     PIKPSEEIEVDYDYVLICPTYAGGLDDFKGSVPRQVIKFLNKVQNREHCVGVVASGNT
                     NFGETFGLAGHVLRAKLHVPLLHVFELIGTKYDEELVRERIHKLWNWEE"
     misc_feature    complement(59718..60113)
                     /gene="nrdI"
                     /locus_tag="MGF_0337"
                     /note="ribonucleotide reductase stimulatory protein;
                     Reviewed; Region: nrdI; PRK03600"
                     /db_xref="CDD:179603"
     gene            complement(60164..61183)
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /db_xref="GeneID:12396375"
     CDS             complement(60164..61183)
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /EC_number="1.17.4.1"
                     /note="MGF_0346"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribonucleoside-diphosphate reductase subunit
                     beta"
                     /protein_id="YP_005880336.1"
                     /db_xref="GI:385325899"
                     /db_xref="GeneID:12396375"
                     /translation="MSNNNKYYDKSFSPLGYVANGQKGVMRSINWNVINDPKDLEVWT
                     RVTQNFWLPEKIPVSNDLKSWNELTPEWKQLVTRTFTGLTLLDTIQCTLGDIAQIPNS
                     LTDHEQFVYANFSFMVGVHARSYGTIFSTLNTSDEIEEAHEWVINNEKLQARAKFLVP
                     YYTSDDPLKSKIAAALMPGFLLYGGFYLPFYLAARGKLPNTSDIIRLILRDKVIHNYY
                     SGYKYRLKVQKLPKEKQEEYKKFVFEILDKLIELEKDFLRELYDGFGLADEAIAFSLY
                     NAGKFLQNCGYESPFTPEETKISPEVFAQLSARADENHDFFSGNGSSYIMGVTEETQD
                     DDWEF"
     misc_feature    complement(60263..61099)
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /note="Ribonucleotide Reductase, R2/beta subunit,
                     ferritin-like diiron-binding domain; Region: RNRR2;
                     cd01049"
                     /db_xref="CDD:153108"
     misc_feature    complement(order(60746..60748,60755..60760,60806..60808,
                     60815..60817,60824..60829,60836..60838,60845..60850,
                     61043..61045,61064..61066,61097..61099))
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(order(60539..60541,60551..60556,60809..60811,
                     60821..60823,60830..60832,60923..60925,61031..61033))
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /note="putative radical transfer pathway; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(order(60539..60541,60548..60550,60650..60652,
                     60821..60823,60830..60832,60923..60925))
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /note="diiron center [ion binding]; other site"
                     /db_xref="CDD:153108"
     misc_feature    complement(60809..60811)
                     /gene="nrdF"
                     /locus_tag="MGF_0346"
                     /note="tyrosyl radical; other site"
                     /db_xref="CDD:153108"
     gene            61730..62599
                     /gene="thyA"
                     /locus_tag="MGF_0350"
                     /db_xref="GeneID:12396376"
     CDS             61730..62599
                     /gene="thyA"
                     /locus_tag="MGF_0350"
                     /EC_number="2.1.1.45"
                     /note="MGF_0350"
                     /codon_start=1
                     /transl_table=4
                     /product="Thymidylate synthase"
                     /protein_id="YP_005880337.1"
                     /db_xref="GI:385325900"
                     /db_xref="GeneID:12396376"
                     /translation="MKTYLDLLEKVMTKGEVKKDRTNTGTISYFGTQSRYDLREGFPL
                     LTTKKMAWKAICHELLWFLKGDTNIKYLVDHNVNIWNEWPYEAFKKSNDFKGESLQDF
                     VEKIKTDNQFAQQYGKLGPVYGKQWRDFNGVDQIEWVINEIKTNPFSRRLIVSAWNPG
                     EIKEMALPPCHSFFQFFVNEKYEISLQLYQRSGDLFLGVPFNIASYSLLLLMVAQVTG
                     LKPAEFIHTIGDTHIYSNHLEQVKIQLQREPKKLPKVTLNPDIKNIFDFRFEDISLEN
                     YEHHDPIKGKVAV"
     misc_feature    61736..62455
                     /gene="thyA"
                     /locus_tag="MGF_0350"
                     /note="Thymidylate synthase and pyrimidine
                     hydroxymethylase: Thymidylate synthase (TS) and
                     deoxycytidylate hydroxymethylase (dCMP-HMase) are homologs
                     that catalyze analogous alkylation of C5 of pyrimidine
                     nucleotides. Both enzymes are involved in the...; Region:
                     TS_Pyrimidine_HMase; cd00351"
                     /db_xref="CDD:238211"
     misc_feature    order(61775..61777,61787..61789,61811..61813,61817..61819,
                     62177..62182,62201..62206,62246..62248,62252..62254,
                     62264..62266,62294..62296,62300..62305,62414..62419)
                     /gene="thyA"
                     /locus_tag="MGF_0350"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238211"
     misc_feature    order(61790..61792,61901..61903,61967..61969,61976..61978,
                     62096..62098,62237..62242,62297..62305,62309..62311,
                     62330..62335,62423..62425,62429..62431)
                     /gene="thyA"
                     /locus_tag="MGF_0350"
                     /note="active site"
                     /db_xref="CDD:238211"
     gene            62599..63552
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /db_xref="GeneID:12396377"
     CDS             62599..63552
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /EC_number="1.5.1.3"
                     /EC_number="3.5.4.12"
                     /note="MGF_0354"
                     /codon_start=1
                     /transl_table=4
                     /product="Bifunctional protein including dihydrofolate
                     reductase and deoxycytidylate deaminase family domains"
                     /protein_id="YP_005880338.1"
                     /db_xref="GI:385325901"
                     /db_xref="GeneID:12396377"
                     /translation="MIKLIVAMDEANLIGKKDKMPWHIKEEFEHFRKTTIGHALLFGK
                     TTFLGLPGKLENRKHYVFSRKDQISNADETIRSEKELLELFKAYKDSQDILFIAGGKY
                     IYEHYYQYADELIISRIKNKYEGDVYLNLDLSNYFLMNVEENSKFTVEFWLKKSDNNK
                     TNANVISWDEYFMMLANVSAMRSKDPSTQVGACIVNKKKYVIGLGYNGMPKGLDNIFP
                     WDRTNQDSAKTKYPYVVHAEINAILNTSTVIEDCTLYTNLFPCSNCAKTIVQSGIVEV
                     VYEDNKYEHLPDNKISTHILKSSNIKLRQHKTRHKITEKDK"
     misc_feature    62602..63054
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    order(62611..62613,62662..62664,62677..62679,62767..62769,
                     62890..62892,62908..62910,62947..62949)
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    order(62617..62619,62638..62640,62728..62736,62788..62790,
                     62893..62904)
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    63103..63462
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="Deoxycytidylate deaminase domain. Deoxycytidylate
                     deaminase catalyzes the deamination of dCMP to dUMP,
                     providing the nucleotide substrate for thymidylate
                     synthase. The enzyme binds Zn++, which is required for
                     catalytic activity. The activity of the...; Region:
                     deoxycytidylate_deaminase; cd01286"
                     /db_xref="CDD:238613"
     misc_feature    order(63220..63222,63304..63306,63310..63312,63376..63381,
                     63388..63390)
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238613"
     misc_feature    order(63304..63306,63310..63312,63379..63381,63388..63390)
                     /gene="folA"
                     /locus_tag="MGF_0354"
                     /gene_synonym="cd"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238613"
     gene            complement(63584..63778)
                     /locus_tag="MGF_0362"
                     /db_xref="GeneID:12396378"
     CDS             complement(63584..63778)
                     /locus_tag="MGF_0362"
                     /note="MGF_0362"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880339.1"
                     /db_xref="GI:385325902"
                     /db_xref="GeneID:12396378"
                     /translation="MVLYGATFNNDISFKNVHLLGTTKTYLNKSKFKKKSFYGAKLKK
                     NSKNIICLIGVLNLSNVNKK"
     gene            complement(64127..64957)
                     /gene="citE"
                     /locus_tag="MGF_0365f"
                     /product="citrate lyase beta chain domain protein"
                     /note="MGF_0365f; citrate lyase beta chain, degenerate;
                     this region contains one or more premature stops and/or
                     frameshifts"
                     /pseudo
                     /db_xref="GeneID:12396379"
     gene            complement(65173..66054)
                     /locus_tag="MGF_0374"
                     /db_xref="GeneID:12396380"
     CDS             complement(65173..66054)
                     /locus_tag="MGF_0374"
                     /note="MGF_0374"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880340.1"
                     /db_xref="GI:385325903"
                     /db_xref="GeneID:12396380"
                     /translation="MQLGTILMIIVSLWLLLIIATSKFFIRFENNYWFWFFIGGFMFF
                     YMIIGRQIQFLIPGWNAADDNSPFAVSIRHSRLLLLDICPFFAIFAGFGLMVTKNKLI
                     IRSAAPIALFGGLINLYGELFRLANQYTGKLEAYRFIFIGIGNDQLYFILHVMTTTVA
                     LMLICWTTKWTPRDILNQYLFIAIYACYVLSSIQLDRKITNNANGILIADWYIGGEYQ
                     SVSKILRVPFPTVIPVGVVITMVSITLIWAMRYGVQELNARIIYPSLAKKQTKFDLKY
                     MWKNLKYNYLKRRNKSR"
     gene            66307..66672
                     /gene="rpsJ"
                     /locus_tag="MGF_0376"
                     /db_xref="GeneID:12396381"
     CDS             66307..66672
                     /gene="rpsJ"
                     /locus_tag="MGF_0376"
                     /note="MGF_0376"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S10"
                     /protein_id="YP_005880341.1"
                     /db_xref="GI:385325904"
                     /db_xref="GeneID:12396381"
                     /translation="MTEQKAKSSKTSSEEAKKQKELTEIKIKLKSYDSRLLDQSVKKI
                     FEIVKETGSKFCGPIPLPTKKEVFTIIRSPHVDKASREQFERRTHKRLIIIKNLKNET
                     IQKLKRFVIPSGVELRIYL"
     misc_feature    66376..66669
                     /gene="rpsJ"
                     /locus_tag="MGF_0376"
                     /note="30S ribosomal protein S10; Reviewed; Region: rpsJ;
                     PRK00596"
                     /db_xref="CDD:179076"
     gene            66704..67414
                     /gene="rplC"
                     /locus_tag="MGF_0380"
                     /db_xref="GeneID:12396382"
     CDS             66704..67414
                     /gene="rplC"
                     /locus_tag="MGF_0380"
                     /note="MGF_0380"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L3"
                     /protein_id="YP_005880342.1"
                     /db_xref="GI:385325905"
                     /db_xref="GeneID:12396382"
                     /translation="MKGIFGTKVGMTQVFEENGRLIPVTLVRVEPNQVVSVKTKEKDG
                     YDAVQLGFNQTDEKNLNKPQLGHFKKANTNNYKYLEEVRGMVGYKIGDLLKVEELFQE
                     GQVVDVQARTKGRGFTGAIKRWNFKIGSKGHGAGYPHRFQGSVQAGRGGSQAQRVMKG
                     KKMSGHYGNELVTIQNLSIVGFLPEVSSVMISGAIPGANNSKVRITTSKKNPNTVLTY
                     KLIINKKASKPAGEQAQE"
     misc_feature    66704..67342
                     /gene="rplC"
                     /locus_tag="MGF_0380"
                     /note="50S ribosomal protein L3; Validated; Region: rplC;
                     PRK00001"
                     /db_xref="CDD:234564"
     gene            67441..68070
                     /gene="rplD"
                     /locus_tag="MGF_0387"
                     /db_xref="GeneID:12396383"
     CDS             67441..68070
                     /gene="rplD"
                     /locus_tag="MGF_0387"
                     /note="MGF_0387"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L4"
                     /protein_id="YP_005880343.1"
                     /db_xref="GI:385325906"
                     /db_xref="GeneID:12396383"
                     /translation="MSKIKLFDLSGKVQEEIELNQKLLVSEVHKQAIFDAILAENLSQ
                     IQGTHSTLKKGEVSGGGKKPYQQKHTGRARQGSIRNPHYVGGGIAFGPKPNRNYKIKV
                     NKKVSSLAFKSAITSKVNNNEFLGLVDSIKQDKPSTKAIAKLLKELKVNKKVLIVAFE
                     KNENLEKSSANLPNVSYKLWNQVSVKDLIDANCVLAQKSAINNWVERLN"
     misc_feature    67447..68067
                     /gene="rplD"
                     /locus_tag="MGF_0387"
                     /note="50S ribosomal protein L4; Provisional; Region:
                     rplD; PRK05319"
                     /db_xref="CDD:235404"
     gene            68073..68399
                     /gene="rplW"
                     /locus_tag="MGF_0391"
                     /db_xref="GeneID:12396384"
     CDS             68073..68399
                     /gene="rplW"
                     /locus_tag="MGF_0391"
                     /note="MGF_0391"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L23"
                     /protein_id="YP_005880344.1"
                     /db_xref="GI:385325907"
                     /db_xref="GeneID:12396384"
                     /translation="MQITDVLIKPILTEKTYGIMMSEPRKYTFLVNAKANKNYIKQAF
                     KAIYGVTPIAVNTKIKKPARVRTGTQNPGYSRLEKIAIITVPFGVEVAITGEKPEPKE
                     ESSSKK"
     misc_feature    68082..68363
                     /gene="rplW"
                     /locus_tag="MGF_0391"
                     /note="50S ribosomal protein L23; Reviewed; Region: rplW;
                     PRK05738"
                     /db_xref="CDD:235586"
     gene            68446..69297
                     /gene="rplB"
                     /locus_tag="MGF_0395"
                     /db_xref="GeneID:12396385"
     CDS             68446..69297
                     /gene="rplB"
                     /locus_tag="MGF_0395"
                     /note="MGF_0395"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L2"
                     /protein_id="YP_005880345.1"
                     /db_xref="GI:385325908"
                     /db_xref="GeneID:12396385"
                     /translation="MPVKKIVNRSNSGIHHKISIDYSKVLTTNTPQKSLLAKKKKNSG
                     RNNQGKITVRHRGGGSKRKYRIIDFKRNLHDDKIALVKSIEYDPNRSAFISLIAYENG
                     YRSYILTPQGIKVGDKVVSSSQAIDIKVGNCMPLEFIPEGTMVHNIEMTPGKGAQIAR
                     SAGAYAQILGKDDTGKYINLKLGSKEVRKFLKNCRAVVGIASNVDHNLVLLGKAGTTR
                     HKGIRPTVRGSAMNPNDHPHGGGEGRSPVGRDAPRTPWGKRHMGVKTRNNKKSSTQLI
                     IRRRNSK"
     misc_feature    68446..69294
                     /gene="rplB"
                     /locus_tag="MGF_0395"
                     /note="50S ribosomal protein L2; Validated; Region: rplB;
                     PRK09374"
                     /db_xref="CDD:236488"
     misc_feature    68575..68808
                     /gene="rplB"
                     /locus_tag="MGF_0395"
                     /note="Ribosomal Proteins L2, RNA binding domain; Region:
                     Ribosomal_L2; pfam00181"
                     /db_xref="CDD:249659"
     misc_feature    68827..69219
                     /gene="rplB"
                     /locus_tag="MGF_0395"
                     /note="Ribosomal Proteins L2, C-terminal domain; Region:
                     Ribosomal_L2_C; pfam03947"
                     /db_xref="CDD:202823"
     gene            69318..69581
                     /gene="rpsS"
                     /locus_tag="MGF_0403"
                     /db_xref="GeneID:12396386"
     CDS             69318..69581
                     /gene="rpsS"
                     /locus_tag="MGF_0403"
                     /note="MGF_0403"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S19"
                     /protein_id="YP_005880346.1"
                     /db_xref="GI:385325909"
                     /db_xref="GeneID:12396386"
                     /translation="MSRSSKKGAFVEASLYKKVLDMNAQQKKKIIKTWSRRSTIFPDF
                     VGHTFAVHNGKKFINVYVTEDMIGHKLGEFSPTRTFKGHSSNR"
     misc_feature    69318..69578
                     /gene="rpsS"
                     /locus_tag="MGF_0403"
                     /note="30S ribosomal protein S19; Reviewed; Region: rpsS;
                     PRK00357"
                     /db_xref="CDD:178985"
     gene            69592..70026
                     /gene="rplV"
                     /locus_tag="MGF_0406"
                     /db_xref="GeneID:12396387"
     CDS             69592..70026
                     /gene="rplV"
                     /locus_tag="MGF_0406"
                     /note="MGF_0406"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L22"
                     /protein_id="YP_005880347.1"
                     /db_xref="GI:385325910"
                     /db_xref="GeneID:12396387"
                     /translation="MIAIARQNRVRISPQKARLVCQLIKNKSVIEAQNILVNTDKKGA
                     RIILKLLNSVIANATNNHAMLAEKLYVYEVVANQGPTLKRNLPRAKGSADMIRKRSTN
                     FVIKLSDDKNERKHEVEAIKTRLKKRVLGQNKRKQSVSGEKK"
     misc_feature    69598..69912
                     /gene="rplV"
                     /locus_tag="MGF_0406"
                     /note="Ribosomal protein L22/L17e.  L22 (L17 in
                     eukaryotes) is a core protein of the large ribosomal
                     subunit.  It is the only ribosomal protein that interacts
                     with all six domains of 23S rRNA, and is one of the
                     proteins important for directing the proper...; Region:
                     Ribosomal_L22; cd00336"
                     /db_xref="CDD:238205"
     misc_feature    order(69598..69603,69667..69675,69679..69684,69688..69693,
                     69754..69771,69796..69813,69907..69912)
                     /gene="rplV"
                     /locus_tag="MGF_0406"
                     /note="putative translocon binding site; other site"
                     /db_xref="CDD:238205"
     misc_feature    order(69607..69609,69613..69615,69622..69624,69628..69636,
                     69643..69645,69655..69657,69664..69666,69748..69750,
                     69760..69762,69769..69771,69808..69810,69814..69822,
                     69826..69828,69835..69837,69871..69888)
                     /gene="rplV"
                     /locus_tag="MGF_0406"
                     /note="protein-rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238205"
     gene            70029..70820
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /db_xref="GeneID:12396388"
     CDS             70029..70820
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /note="MGF_0410"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S3"
                     /protein_id="YP_005880348.1"
                     /db_xref="GI:385325911"
                     /db_xref="GeneID:12396388"
                     /translation="MGQKVNSNGLRFGINKNWQSRWVAKTNQQTGDWIVQDEKIRNYL
                     FKKFHSAFISNVDIERTQTSIRVFIYASQPGIILGKEAANIKVILLAINKIVGRHIKV
                     DVDVLEVGNPSLSAKIVARELADAIENRTPLRTAMRQALKRVLKAGAKGIKVLVSGRL
                     NGVEIARDKMYIEGNVTLSTLRTDIDYALEEAQMSYGVIGVKVWINRGEIFGKDFYKK
                     QAHIVKPKGSEANHQRRNSNKSKDYRDNKNKQFNKNHQNQQPAKE"
     misc_feature    70029..70721
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /note="30S ribosomal protein S3; Reviewed; Region: rpsC;
                     PRK00310"
                     /db_xref="CDD:234722"
     misc_feature    70032..70364
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /note="K homology RNA-binding (KH) domain of the
                     prokaryotic 30S small ribosomal subunit protein S3. S3  is
                     part of the head region of the 30S ribosomal subunit and
                     is believed to interact with mRNA as it threads its way
                     from the latch into the channel.  The KH...; Region:
                     30S_S3_KH; cd02412"
                     /db_xref="CDD:239095"
     misc_feature    70263..70274
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239095"
     misc_feature    70395..70643
                     /gene="rpsC"
                     /locus_tag="MGF_0410"
                     /note="Ribosomal protein S3, C-terminal domain; Region:
                     Ribosomal_S3_C; pfam00189"
                     /db_xref="CDD:249666"
     gene            70826..71242
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /db_xref="GeneID:12396389"
     CDS             70826..71242
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="MGF_0416"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L16"
                     /protein_id="YP_005880349.1"
                     /db_xref="GI:385325912"
                     /db_xref="GeneID:12396389"
                     /translation="MLQPKRTKYRKPHNVSYEGKAKGNSYVAFGEYGIMATNGAWIDA
                     RQIESARIAISKQLGKTGKMWIRIFPHMSKTKKPLEVRMGSGKGNPEFWVAVVKEGTV
                     MFEVANIPEAQMKEALTRAGHKLGVTWKIVARQGAQ"
     misc_feature    70895..71221
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="Ribosomal_L16_L10e: L16 is an essential protein in
                     the large ribosomal subunit of bacteria, mitochondria, and
                     chloroplasts. Large subunits that lack L16 are defective
                     in peptidyl transferase activity, peptidyl-tRNA hydrolysis
                     activity, association with...; Region: Ribosomal_L16_L10e;
                     cd01433"
                     /db_xref="CDD:238714"
     misc_feature    order(70898..70903,70910..70912,70958..70963,70970..70972,
                     70979..70981,70991..70993,71000..71002,71018..71026,
                     71030..71032,71036..71038,71048..71053,71072..71086,
                     71126..71128,71180..71185,71192..71197)
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238714"
     misc_feature    70937..70942
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(70973..70981,70988..70993)
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="putative antibiotic binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(71000..71002,71009..71014,71018..71020,71144..71146)
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     misc_feature    order(71066..71071,71078..71083)
                     /gene="rplP"
                     /locus_tag="MGF_0416"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238714"
     gene            71242..71703
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /db_xref="GeneID:12396390"
     CDS             71242..71703
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="MGF_0421"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L29"
                     /protein_id="YP_005880350.1"
                     /db_xref="GI:385325913"
                     /db_xref="GeneID:12396390"
                     /translation="MNKELRAKTNEELIQLVTQLKGRLLEYRFKLAQGELDKTHIIKE
                     TRQTLARVLTILTERDVKVNVNAMVSSFVKEQTKQKEIQESVKKIKQLRVAKLKQNKE
                     KRLANAEKVKAAPKPEQKTKKVKKAPKKTETVKPTTNKNKKNVKAKTKKKG"
     misc_feature    71248..71418
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="Ribosomal L29 protein/HIP.  L29 is a protein of the
                     large ribosomal Subunit. A homolog, called heparin/heparan
                     sulfate interacting protein (HIP), has also been
                     identified in mammals.  L29 is located on the surface of
                     the large ribosomal subunit, where it...; Region:
                     Ribosomal_L29_HIP; cd00427"
                     /db_xref="CDD:238243"
     misc_feature    order(71248..71250,71257..71259,71359..71361,71389..71394,
                     71398..71403,71413..71415)
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238243"
     misc_feature    order(71248..71256,71260..71262,71272..71277,71281..71286,
                     71293..71298,71305..71310,71317..71319,71326..71331,
                     71353..71355,71362..71364,71374..71376,71383..71388,
                     71395..71400,71407..71409)
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="putative translocon interaction site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(71296..71298,71308..71310,71317..71319,71329..71331,
                     71374..71376)
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="signal recognition particle (SRP54) interaction
                     site; other site"
                     /db_xref="CDD:238243"
     misc_feature    order(71314..71316,71323..71328)
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="L23 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238243"
     misc_feature    71335..71340
                     /gene="rpmC"
                     /locus_tag="MGF_0421"
                     /note="trigger factor interaction site; other site"
                     /db_xref="CDD:238243"
     gene            71709..71966
                     /gene="rpsQ"
                     /locus_tag="MGF_0424"
                     /db_xref="GeneID:12396391"
     CDS             71709..71966
                     /gene="rpsQ"
                     /locus_tag="MGF_0424"
                     /note="MGF_0424"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S17"
                     /protein_id="YP_005880351.1"
                     /db_xref="GI:385325914"
                     /db_xref="GeneID:12396391"
                     /translation="MRNSRKVLMGVVVSDKMQKTATVKVESKNRHPFYHKLVISHKKY
                     HVHNEEGENAAKVGDKVLIMETRPLSATKRWRIAKIIERAK"
     misc_feature    71709..71963
                     /gene="rpsQ"
                     /locus_tag="MGF_0424"
                     /note="30S ribosomal protein S17; Reviewed; Region: rpsQ;
                     PRK05610"
                     /db_xref="CDD:235532"
     gene            71994..72368
                     /gene="rplN"
                     /locus_tag="MGF_0427"
                     /db_xref="GeneID:12396392"
     CDS             71994..72368
                     /gene="rplN"
                     /locus_tag="MGF_0427"
                     /note="MGF_0427"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L14"
                     /protein_id="YP_005880352.1"
                     /db_xref="GI:385325915"
                     /db_xref="GeneID:12396392"
                     /translation="MIQFMTRLNVADNTGAREVGVIKVLNGSKRRYASVGDIVVVSVK
                     DAIPSGTVKKGQVLFAVIVRTKKGAQRRDGTHLAFDDNACVIIKNREDFAPRGTRIFG
                     PVARELRDKGFNRIVSLASEVL"
     misc_feature    71994..72365
                     /gene="rplN"
                     /locus_tag="MGF_0427"
                     /note="50S ribosomal protein L14; Validated; Region: rplN;
                     PRK05483"
                     /db_xref="CDD:180117"
     gene            72379..72708
                     /gene="rplX"
                     /locus_tag="MGF_0429"
                     /db_xref="GeneID:12396393"
     CDS             72379..72708
                     /gene="rplX"
                     /locus_tag="MGF_0429"
                     /note="MGF_0429"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L24"
                     /protein_id="YP_005880353.1"
                     /db_xref="GI:385325916"
                     /db_xref="GeneID:12396393"
                     /translation="MQRIKKGDKVVIIAGKHKQKTGIVLQVFVKEQRAIVEGINMVKR
                     HTKENAQNQKGGIIEKEAPIHLSNLALLDHKAKDVRPVKVKYGTDPKTNKKVRLSRKT
                     NNLVGGQ"
     misc_feature    72397..72591
                     /gene="rplX"
                     /locus_tag="MGF_0429"
                     /note="KOW motif of Ribosomal Protein L26; Region:
                     KOW_RPL26; cd06089"
                     /db_xref="CDD:240513"
     misc_feature    order(72418..72426,72460..72462,72505..72510,72574..72579)
                     /gene="rplX"
                     /locus_tag="MGF_0429"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240513"
     gene            72708..73265
                     /gene="rplE"
                     /locus_tag="MGF_0434"
                     /db_xref="GeneID:12396394"
     CDS             72708..73265
                     /gene="rplE"
                     /locus_tag="MGF_0434"
                     /note="MGF_0434"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L5"
                     /protein_id="YP_005880354.1"
                     /db_xref="GI:385325917"
                     /db_xref="GeneID:12396394"
                     /translation="MNLKTKYKTKIVPLLQKEFGFSSVMQVPKIEKIVINMGVGDATK
                     DAKLLELAQAELQAISGQKPVITKAHSSNASFKIRQGQAIGCKVTLRGEKMWNFLEKL
                     INIALPRVRDFRGLSNRAFDARGNYTLGIKEQIIFPEIIYDNVKKIRGFDVTLVISSD
                     NAKYNHRLLLELGMPLIKTKEHANG"
     misc_feature    72708..73241
                     /gene="rplE"
                     /locus_tag="MGF_0434"
                     /note="50S ribosomal protein L5; Validated; Region: rplE;
                     PRK00010"
                     /db_xref="CDD:178791"
     misc_feature    72774..72944
                     /gene="rplE"
                     /locus_tag="MGF_0434"
                     /note="Ribosomal protein L5; Region: Ribosomal_L5;
                     pfam00281"
                     /db_xref="CDD:109342"
     misc_feature    72957..73238
                     /gene="rplE"
                     /locus_tag="MGF_0434"
                     /note="ribosomal L5P family C-terminus; Region:
                     Ribosomal_L5_C; pfam00673"
                     /db_xref="CDD:250045"
     gene            73258..73443
                     /gene="rpsN"
                     /locus_tag="MGF_0436"
                     /db_xref="GeneID:12396395"
     CDS             73258..73443
                     /gene="rpsN"
                     /locus_tag="MGF_0436"
                     /note="MGF_0436"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S14"
                     /protein_id="YP_005880355.1"
                     /db_xref="GI:385325918"
                     /db_xref="GeneID:12396395"
                     /translation="MAKTSLKIKQARHAKFKVRAYTRCKRCGRPHAVYRKFGICRLCF
                     RHLAYNGSLPGVKKSSW"
     misc_feature    73258..73440
                     /gene="rpsN"
                     /locus_tag="MGF_0436"
                     /note="30S ribosomal protein S14; Reviewed; Region: rpsN;
                     PRK08061"
                     /db_xref="CDD:181216"
     gene            73467..73868
                     /gene="rpsH"
                     /locus_tag="MGF_0438"
                     /db_xref="GeneID:12396396"
     CDS             73467..73868
                     /gene="rpsH"
                     /locus_tag="MGF_0438"
                     /note="MGF_0438"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S8"
                     /protein_id="YP_005880356.1"
                     /db_xref="GI:385325919"
                     /db_xref="GeneID:12396396"
                     /translation="MHFDPVADIITKINNANRAKIVELQTEASKLKVAILNILLNEGY
                     IRGYEIYDNKEKTKSILKIKLKFDENRVSSLNGIKQISKPGLRIYVSAEKLPKVLNGL
                     GIAIVSTNEGLMTDKLARAKKIGGEVLAYVW"
     misc_feature    73467..73865
                     /gene="rpsH"
                     /locus_tag="MGF_0438"
                     /note="30S ribosomal protein S8; Validated; Region: rpsH;
                     PRK00136"
                     /db_xref="CDD:234658"
     gene            73887..74438
                     /gene="rplF"
                     /locus_tag="MGF_0441"
                     /db_xref="GeneID:12396397"
     CDS             73887..74438
                     /gene="rplF"
                     /locus_tag="MGF_0441"
                     /note="MGF_0441"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L6"
                     /protein_id="YP_005880357.1"
                     /db_xref="GI:385325920"
                     /db_xref="GeneID:12396397"
                     /translation="MSRIGNRVITVPSNVSVNQTKELLTVKGPLGQLDLKLKEGSKIK
                     VNVENNEIRLTRGDELKQTKMLHGTYNALIKNALEGVTVGFKKELRLVGVGYRASLKD
                     NVLNLQLGYSHPINLDIPKDLKVTVDKNTEITVSGIDKQKVGEFAIQIRKWRMPEPYK
                     GKGVLYLNEQIIRKAGKTAEGKK"
     misc_feature    73887..74423
                     /gene="rplF"
                     /locus_tag="MGF_0441"
                     /note="50S ribosomal protein L6; Validated; Region: rplF;
                     PRK05498"
                     /db_xref="CDD:235495"
     misc_feature    74160..74384
                     /gene="rplF"
                     /locus_tag="MGF_0441"
                     /note="Ribosomal protein L6; Region: Ribosomal_L6;
                     pfam00347"
                     /db_xref="CDD:249789"
     gene            74445..74804
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /db_xref="GeneID:12396398"
     CDS             74445..74804
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="MGF_0445"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L18"
                     /protein_id="YP_005880358.1"
                     /db_xref="GI:385325921"
                     /db_xref="GeneID:12396398"
                     /translation="MKQVNMNRNERRQMRHKRVIKKIRRIDNDRPVMIVVKSNSHISA
                     QVWDFNQNKIIASSSSVSLDLVNGNKENAAVVGTDIANKLLKMKIDEITFGHGGSKYH
                     GRIAALADAARKAGLKF"
     misc_feature    74502..74762
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="Ribosomal L18/L5e:  L18 (L5e) is a ribosomal
                     protein found in the central protuberance (CP) of the
                     large subunit. L18 binds 5S rRNA and induces a
                     conformational change that stimulates the binding of L5 to
                     5S rRNA. Association of 5S rRNA with 23S rRNA...; Region:
                     Ribosomal_L18_L5e; cd00432"
                     /db_xref="CDD:238246"
     misc_feature    order(74502..74504,74511..74516,74724..74726,74733..74735)
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238246"
     misc_feature    74502..74504
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="L21e interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    order(74508..74510,74514..74519,74523..74525,74538..74540,
                     74550..74567,74571..74573,74577..74579,74598..74606,
                     74613..74615,74721..74723,74754..74756)
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="5S rRNA interface [nucleotide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    order(74508..74510,74517..74522)
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="L27 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     misc_feature    74739..74741
                     /gene="rplR"
                     /locus_tag="MGF_0445"
                     /note="L5 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238246"
     gene            74818..75498
                     /gene="rpsE"
                     /locus_tag="MGF_0448"
                     /db_xref="GeneID:12396399"
     CDS             74818..75498
                     /gene="rpsE"
                     /locus_tag="MGF_0448"
                     /note="MGF_0448"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S5"
                     /protein_id="YP_005880359.1"
                     /db_xref="GI:385325922"
                     /db_xref="GeneID:12396399"
                     /translation="MEDIKHNKKPNTNNSAETKKASGANPQANHANPNNRSASVNNNS
                     VNNNKKNSSRSSDERNKRKNEKRTKSEFEEKIVKISRISKTTKGGRTMRFSALVVVGD
                     RKGRVGFGIAKALEVPNAIKKALKMAENNVQKIAMNKHGTLFHDVLGRSGAAKVLIKP
                     APSGTGIIAGGAIRAVVELAGFTDVYTKNMGKNTPINMVRATMDGITSQYTPRQIAKL
                     RSKSLKEL"
     misc_feature    74998..75495
                     /gene="rpsE"
                     /locus_tag="MGF_0448"
                     /note="30S ribosomal protein S5; Validated; Region: rpsE;
                     PRK00550"
                     /db_xref="CDD:234790"
     misc_feature    75028..75225
                     /gene="rpsE"
                     /locus_tag="MGF_0448"
                     /note="Ribosomal protein S5, N-terminal domain; Region:
                     Ribosomal_S5; pfam00333"
                     /db_xref="CDD:144065"
     misc_feature    75256..75474
                     /gene="rpsE"
                     /locus_tag="MGF_0448"
                     /note="Ribosomal protein S5, C-terminal domain; Region:
                     Ribosomal_S5_C; pfam03719"
                     /db_xref="CDD:252121"
     gene            75514..75957
                     /gene="rplO"
                     /locus_tag="MGF_0455"
                     /db_xref="GeneID:12396400"
     CDS             75514..75957
                     /gene="rplO"
                     /locus_tag="MGF_0455"
                     /note="MGF_0455"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L15"
                     /protein_id="YP_005880360.1"
                     /db_xref="GI:385325923"
                     /db_xref="GeneID:12396400"
                     /translation="MKLHELKSAPKSRNHKAKVVGRGHGSGLGKTSGRGQKGQKARKS
                     GRTRPGFEGGQTPLYRRLPKFGFQTVGFKKQTLSVSLDIIAKLNETTIDRELLVKHGI
                     ISSKTNEPIKVIGNKIDKKIHLKINKISEGAKKAIQSAGGSIELI"
     misc_feature    75514..75954
                     /gene="rplO"
                     /locus_tag="MGF_0455"
                     /note="50S ribosomal protein L15; Reviewed; Region: rplO;
                     PRK05592"
                     /db_xref="CDD:235523"
     gene            75970..77466
                     /gene="secY"
                     /locus_tag="MGF_0459"
                     /db_xref="GeneID:12396401"
     CDS             75970..77466
                     /gene="secY"
                     /locus_tag="MGF_0459"
                     /note="MGF_0459"
                     /codon_start=1
                     /transl_table=4
                     /product="preprotein translocase subunit secY"
                     /protein_id="YP_005880361.1"
                     /db_xref="GI:385325924"
                     /db_xref="GeneID:12396401"
                     /translation="MAKTNSKNLLGQKIIKLLRNRDFVISVFVTLFLILLFRVISVIP
                     LPGITISQNKNNLNNGVSDFFDLFNLLGGGGLSQLSLFAVGISPYISAQIIMQLLSTD
                     LIPPLSKLAKSGELGRRRIELITRFVTLPFAVVQAFAIIALINNQRNGAIRFENGGIL
                     HQAFYIVTMTAGTYIGIFIGDIISKKGVGNGITLLILSGILARLPDGFIVMYRVLGGV
                     IISTNPILTSAINFSLYFLAFLVLLLAITFVNSSTRRIPIQQTGEGMVLGNEKLPYLP
                     IKLNAAGVIPVIFASSIMSIPITIAEFQPQSEARWFVEDYLSLRTPVGISLYVVLIII
                     FTFFYSYIQINPEQLAENFNKSHKFIPGVRPGLDTEKHITKVLMRINFIGAPFLAIVA
                     VIPYIISLVLNVPTTLSLGGTGIIIMVSASMELYRSLRSAATTTSYQRLRKDIANRIE
                     VELSLNDYMNKPNLEHDQYGLLGKHKKVEPTQDKKKNPSDPLEVSQLW"
     misc_feature    76003..77292
                     /gene="secY"
                     /locus_tag="MGF_0459"
                     /note="preprotein translocase subunit SecY; Reviewed;
                     Region: secY; PRK09204"
                     /db_xref="CDD:236412"
     misc_feature    76213..77250
                     /gene="secY"
                     /locus_tag="MGF_0459"
                     /note="SecY translocase; Region: SecY; pfam00344"
                     /db_xref="CDD:249786"
     gene            77460..78104
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /db_xref="GeneID:12396402"
     CDS             77460..78104
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /EC_number="2.7.4.3"
                     /note="MGF_0467"
                     /codon_start=1
                     /transl_table=4
                     /product="adenylate kinase"
                     /protein_id="YP_005880362.1"
                     /db_xref="GI:385325925"
                     /db_xref="GeneID:12396402"
                     /translation="MIRLIFLGAPGTGKGTISSYLKEQHGFFHISSGDLFRFYAKEEK
                     TALAEEIKSYINNGLYVPDELTNRTVADFYHKNQSQDKIIFDGYPRTLNQCEYIDEII
                     KFTHVILLQPTDWDMIINRLSSRRSCPQCKRIYNINSVDFKPKVANLCDLCKVELIHR
                     KDDDPSVVSTRINVYNEQTKPVIEYYKKKNLLHAVDANKSFEELYKLVLEIVNK"
     misc_feature    77466..78098
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /note="adenylate kinase; Region: adk; TIGR01351"
                     /db_xref="CDD:233369"
     misc_feature    77466..78071
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /note="Adenylate kinase (ADK) catalyzes the reversible
                     phosphoryl transfer from adenosine triphosphates (ATP) to
                     adenosine monophosphates (AMP) and to yield adenosine
                     diphosphates (ADP). This enzyme is required for the
                     biosynthesis of ADP and is essential for...; Region: ADK;
                     cd01428"
                     /db_xref="CDD:238713"
     misc_feature    order(77553..77555,77568..77570,77640..77642,77715..77720,
                     77724..77729,77739..77741)
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /note="AMP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238713"
     misc_feature    order(77568..77570,77715..77717,77727..77729,77832..77834,
                     77970..77972,77982..77984)
                     /gene="adk"
                     /locus_tag="MGF_0467"
                     /note="ATP-AMP (Ap5A)-binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238713"
     gene            78115..78867
                     /gene="map"
                     /locus_tag="MGF_0474"
                     /db_xref="GeneID:12396403"
     CDS             78115..78867
                     /gene="map"
                     /locus_tag="MGF_0474"
                     /EC_number="3.4.11.18"
                     /note="MGF_0474"
                     /codon_start=1
                     /transl_table=4
                     /product="methionine aminopeptidase"
                     /protein_id="YP_005880363.1"
                     /db_xref="GI:385325926"
                     /db_xref="GeneID:12396403"
                     /translation="MIYIKNPNEIQKIKNAAQIYKKIVKQFNFDYIKNKSLKEIDQML
                     RDFVSQHHANSCYHGYLGFKGYHCLSLNQTIIHGLANDDIFTSKDKLTIDIGIELDNY
                     YCDSAFTILGPDVNLRQKLLSEVTHNCIFDLVKKIVPNQTTTNDLGIWTEEYAKKHGY
                     NVIKDFGGHGCGIKIHEDPIILNYGTKKPGELLTPNMVICIEPMFFEKDNRYYIDPVD
                     SWSVKPVNKNQYVCHWEHMVLIKEDQAEILTL"
     misc_feature    78142..78864
                     /gene="map"
                     /locus_tag="MGF_0474"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    order(78343..78345,78394..78396,78427..78429,78619..78621,
                     78718..78720,78817..78819)
                     /gene="map"
                     /locus_tag="MGF_0474"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            79047..80018
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /db_xref="GeneID:12396404"
     CDS             79047..80018
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /EC_number="1.1.1.27"
                     /EC_number="1.1.1.37"
                     /note="MGF_0480"
                     /codon_start=1
                     /transl_table=4
                     /product="L-lactate dehydrogenase"
                     /protein_id="YP_005880364.1"
                     /db_xref="GI:385325927"
                     /db_xref="GeneID:12396404"
                     /translation="MKKIAVIGCGFVGSTYILDLLQQGVQADYLLVDKNTNLADGHVR
                     DLRDSKSLKSHNGSTFNVGTYDDLKDADVVAITASIPTVPTADGEVFTDRLQLMTANV
                     KILNEIALELKRVGFKGLSIIPTNPCDVMAGVYQKVTGFDPHKIISTGCQLETMRTRK
                     MISEALGVNSDSVEGFVVGEHGSGAIVPWSVFRVGNVPMKQLIAEGKIKEEYVKDIFP
                     RVVKEAFEIIKFKKATYFGIAESMSLITRAYIYNLNMVLGVGVQLDDKYVASGIYFTV
                     PAVVGKHGWKLHSKLQLSQEEQAAFDKSALNIQKVTKDALDLIGFKN"
     misc_feature    79050..79988
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="L-2-hydroxyisocapronate dehydrogenases and some
                     bacterial L-lactate dehydrogenases; Region: HicDH_like;
                     cd05291"
                     /db_xref="CDD:133427"
     misc_feature    order(79050..79052,79125..79127,79212..79214,79545..79547,
                     79551..79553,79560..79562,79617..79619,79632..79637,
                     79794..79808,79812..79814,79890..79892,79914..79919)
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    79062..79976
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="L-lactate dehydrogenase; Region: L-LDH-NAD;
                     TIGR01771"
                     /db_xref="CDD:233566"
     misc_feature    order(79074..79082,79143..79148,79275..79280,79290..79295,
                     79416..79424,79491..79493,79587..79589)
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    order(79086..79091,79098..79100,79110..79115,79170..79172,
                     79176..79190,79197..79202,79512..79517,79521..79523,
                     79557..79559,79734..79739,79749..79757,79764..79766,
                     79776..79778)
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    order(79326..79328,79422..79424,79515..79517,79587..79589,
                     79716..79718,79746..79748)
                     /gene="ldh"
                     /locus_tag="MGF_0480"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133427"
     gene            80469..83377
                     /locus_tag="MGF_r01"
                     /db_xref="GeneID:12396405"
     rRNA            80469..83377
                     /locus_tag="MGF_r01"
                     /product="23S ribosomal RNA"
                     /note="MGF_r01; 23S_rRNA; predicted with RNAmmer-1.2,
                     score=2824"
                     /db_xref="GeneID:12396405"
     gene            83450..83553
                     /locus_tag="MGF_r02"
                     /db_xref="GeneID:12396406"
     rRNA            83450..83553
                     /locus_tag="MGF_r02"
                     /product="ribosomal RNA-5S"
                     /note="MGF_r02; 5S_rRNA; predicted with RNAmmer-1.2,
                     score=73.1"
                     /db_xref="GeneID:12396406"
     gene            complement(83613..86996)
                     /locus_tag="MGF_0543"
                     /db_xref="GeneID:12396407"
     CDS             complement(83613..86996)
                     /locus_tag="MGF_0543"
                     /note="MGF_0543"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880365.1"
                     /db_xref="GI:385325928"
                     /db_xref="GeneID:12396407"
                     /translation="MLFSVFWHILIRMKKAYLLLSALALPLTSFQGGFSYKAAVNEFK
                     LVNHNSNNSTVSLTTRSSPVNLTFTLNPDRSKNTVESIKEQIVNLADQQFQKYFREVQ
                     SWIDEFKEEFRQLYQIDSVEYVESRLYNIDRDTRSFQDILDNSWFVRSNDERTDKSRS
                     AYGEINNFGTYSDSNSANYDFAGKYNPTFKSYVEIIHNYSRVTKQIEIPKYDVKKLPL
                     SDLQLTNGFVKYKANRSLNGAFDPIPNTNNQYYAFTNVDISSDKFTIREKKYTGWEPT
                     LSDLNTNFEKRKNLTSVKLLRWKIHPVDAATYERFTIKPNKNIFPDASNYTEYNKRRL
                     FFWKHPSGKWRIVNDRDLVNATNNWYYGSGYRIIQTRPQDFDRLYDLKDAPKTLNINI
                     DQRSKLISSKYNIFADYFVLPDNFTYKTLNFNITNKTVFNGYRNLINLFLNNLKLVND
                     AIELRENYIYSKLDSNLRFGFWYNDRLIKLIDHIRKIKKYTVNSTQNKYKNLALDYAD
                     ITSLERNTSKEFFNNLISGKGRNYVSNFQRELFYFLGVTTNEIDDYQYNFIMSLPQLF
                     DDFNRATKLVADIYVGSNKISDRVLISNNDIKMIDINLEEIRNQIPQLDLNRNRLQLK
                     LDNLRFVSQEIDDNNGKISNFLNIQNDHLIFKIDDVSVKLNLNYRYDFLNIKYKNSIA
                     QLNDFNVNTFEPLYASDFNHKIGVERSLNISDILIDSYKSIYLNSNSIYINQDGVYSP
                     DQGIWTGDDLTIMSRLADRYSLNFVPNDVTGEFWSIIRVLNGNDFAIPGTEMNPELIP
                     NRLYFLKNDENFKAKFYLVKFKAFNKVIDVNKSRVSFVHEIVPIIKLNYLNNDFEIRL
                     LTDYDNNLLSDQTINLRINQEFSIRKEDSMKLIKVIEPVLAANGLRILNNSIEVNERA
                     NQLNFTLYSLDKVEKTAFNPITNFDLVFEKENNNIFKIIGKFDNNTIFNLNYQVTISD
                     DKITLELLTPDLWNLTPVINSKAKITELIKNELNKYNLTVRSWDNFDVVNKTNEIELI
                     NTSATSFDENEGDIPREEILRNNQQNDQIPTKDNATSNNHQKDKIETKEASSISFDLS
                     DKRNLIIFIVSVSLISLGIIGGVGYGIIKLMKKNKRMVQ"
     misc_feature    complement(<83955..>84272)
                     /locus_tag="MGF_0543"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            87053..88531
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /db_xref="GeneID:12396408"
     CDS             87053..88531
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /EC_number="6.1.1.6"
                     /note="MGF_0544"
                     /codon_start=1
                     /transl_table=4
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_005880366.1"
                     /db_xref="GI:385325929"
                     /db_xref="GeneID:12396408"
                     /translation="MSKKLNDQELVRLDKLNRLIESKQNPYEVTKVANTHNTKSLKEK
                     YDQFSKEQLAEMQMDKPITVSGRVILIRRTFILIQDFYSELQLYINKNKQPDLFKYFN
                     DYLDLGDVVCATGKPMKTNTNELSLDLESLKIISKSLRVPPEKFHGIADEEIRSRKRY
                     LDLVYNKESKERFVYRSKIIAAMRQYFNENGFLEVETPFLHAQIGGAAAKPFITRYNA
                     LDRDYYLRIAPELPLKKLIVGSFEKIYEIGKCFRNEGMDSTHNPEFTSVETYVAYVDY
                     IYMMELTEALIKYIAKTIGISHTNIKNETVDWNKPFKRIKMTELVKQETGIDFTQVKK
                     LDEALDLAKKHKVHVKEHEKTIGHIINLFFEEFCEKKLVEPTFVTHHPVEISPLSKLD
                     YSDPRYTERFELFAFGKELANGFSELNDPIDQRQRFEKQLEEKQKGNDEASEMDEDFL
                     EALENGLPPTGGLGIGVDRLVMMLTGTTSIRDILFFPHVREE"
     misc_feature    87062..88528
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="lysyl-tRNA synthetase; Reviewed; Region: lysS;
                     PRK00484"
                     /db_xref="CDD:234778"
     misc_feature    87236..87541
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="LysRS_N: N-terminal, anticodon recognition domain
                     of lysyl-tRNA synthetases (LysRS). These enzymes are
                     homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs).
                     This domain is a beta-barrel domain (OB fold) involved in
                     binding the tRNA anticodon stem-loop; Region: LysRS_N;
                     cd04322"
                     /db_xref="CDD:239817"
     misc_feature    order(87248..87253,87290..87295,87380..87382,87458..87460,
                     87467..87475)
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239817"
     misc_feature    order(87260..87262,87266..87271,87275..87277,87308..87310,
                     87314..87316,87368..87370,87410..87412,87428..87430)
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="putative anticodon binding site; other site"
                     /db_xref="CDD:239817"
     misc_feature    87548..88522
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="Lys_tRNA synthetase (LysRS) class II core domain.
                     Class II LysRS is a dimer which attaches a lysine to the
                     3' OH group of ribose of the appropriate tRNA. Its
                     assignment to class II aaRS is based upon its structure
                     and the presence of three...; Region: LysRS_core; cd00775"
                     /db_xref="CDD:238398"
     misc_feature    87644..87658
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="motif 1; other site"
                     /db_xref="CDD:238398"
     misc_feature    order(87740..87742,87806..87808,87812..87814,87830..87832,
                     87842..87844,88259..88261,88280..88282,88289..88291,
                     88301..88303,88457..88459)
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="active site"
                     /db_xref="CDD:238398"
     misc_feature    87803..87814
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="motif 2; other site"
                     /db_xref="CDD:238398"
     misc_feature    88448..88459
                     /gene="lysS"
                     /locus_tag="MGF_0544"
                     /note="motif 3; other site"
                     /db_xref="CDD:238398"
     gene            88568..89698
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /db_xref="GeneID:12396409"
     CDS             88568..89698
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /note="MGF_0554"
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone"
                     /protein_id="YP_005880367.1"
                     /db_xref="GI:385325930"
                     /db_xref="GeneID:12396409"
                     /translation="MRWLVKEQNYYEILGVSTKASSSDIKKAFRKLAKKYHPDVNSDP
                     QSLELFQKINEAYEVLSDEKARRDYDEFELDLYDSDDDVDDWTEFVDTKDVFSKIFTN
                     IKSNQQTTSKANKPPFSSQASDTPPSSSNKTTTKTDPNTPKNLYTILGANKKTSVDEL
                     KRLYSILKLKYSTNPKTEANEWLKKEIKCAYTVLSNRESKAKYDKTGIFNFEGVSHLG
                     GVFSRTRHLQELEKRQKKSKATTQSTGTRKVNNKKSSIHNVPYSSPKDRYASFTKFST
                     PQAQKKSAWQAAKFDINIEDYYTNVNIADDELLSLREEVLEEKKKKEEKHNQDPNVKK
                     QTGLARFKENHPILSSVITGLLISVILTVIIVVIIAKTGITK"
     misc_feature    88592..88753
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    order(88676..88684,88706..88708,88715..88720,88727..88732)
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    88997..89179
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /note="DnaJ domain; Region: DnaJ; pfam00226"
                     /db_xref="CDD:249696"
     STS             89201..89298
                     /gene="dnaJ1"
                     /locus_tag="MGF_0554"
                     /standard_name="RH36804"
                     /db_xref="UniSTS:85629"
     gene            89720..90469
                     /locus_tag="MGF_0563"
                     /db_xref="GeneID:12396410"
     CDS             89720..90469
                     /locus_tag="MGF_0563"
                     /note="MGF_0563"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880368.1"
                     /db_xref="GI:385325931"
                     /db_xref="GeneID:12396410"
                     /translation="MNKQDIIEHVNNDHLDTLNIIYRHYVKNQAVQTIKLIDLDLEKM
                     IVLVNDQKIEIPFERKIKELSEIKYVMIEMHERAQYLLNLDSVQEEYNQFLKSNFRSI
                     HLATRNKDNELTCSTTVLYRKNNQLYVYLAKVAQHYQNISFNNQNLGVLLIEDSAIGR
                     SEYLRKTAQYVADFEQVNDQNLVNELLDNLAKNPVETRVANMLKKFAGFVLFEVKLKK
                     GRVNLGFGKAYDVVDHKLVPINMTEEHKMVD"
     misc_feature    89726..89944
                     /locus_tag="MGF_0563"
                     /note="Protein of unknown function (DUF2470); Region:
                     DUF2470; pfam10615"
                     /db_xref="CDD:256092"
     misc_feature    89735..90412
                     /locus_tag="MGF_0563"
                     /note="heme oxygenase, HugZ family; Region: heme_ox_HugZ;
                     TIGR04109"
                     /db_xref="CDD:200360"
     misc_feature    89945..90457
                     /locus_tag="MGF_0563"
                     /note="Pyridoxine 5'-phosphate (PNP) oxidase-like
                     proteins; Region: PNPOx_like; cl00381"
                     /db_xref="CDD:260394"
     gene            90627..91682
                     /locus_tag="MGF_0568"
                     /db_xref="GeneID:12396411"
     CDS             90627..91682
                     /locus_tag="MGF_0568"
                     /note="MGF_0568"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880369.1"
                     /db_xref="GI:385325932"
                     /db_xref="GeneID:12396411"
                     /translation="MNNIFITPQAVGDNTNLAIFINLLIYVAFLLTVPTLLIFCLMFI
                     KPKLKQNQMFNLYAFSSALLLSIGTLGLLFEATDGATGFVNNTLSSYTEVNQTLIKIA
                     IIVGGAILGLTLVISFRFLYIHFTKQDHCNHTHDHSLHIMNEGEDVQHKMKEHKPNVK
                     AAWLVIILLLSHRTIDGFILGGTVSLLTLDPTQINLGFIITFNLHILVEVVIIHYRQI
                     QYGEKRFKAALYNFYTTLLIIPIMIVGAYLNRFLRNVGWIIPLVNASGGVIITFLAVI
                     ELVPEFIHNRSMKTADWYKMLISFAFGLVFAILILSVHNLSHTEHHHGGMMDHGHDHD
                     HGPIAHLISRTKNLLLY"
     misc_feature    90693..91565
                     /locus_tag="MGF_0568"
                     /note="ZIP Zinc transporter; Region: Zip; cl00437"
                     /db_xref="CDD:260422"
     gene            complement(91668..92483)
                     /locus_tag="MGF_0574"
                     /db_xref="GeneID:12396412"
     CDS             complement(91668..92483)
                     /locus_tag="MGF_0574"
                     /note="MGF_0574"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880370.1"
                     /db_xref="GI:385325933"
                     /db_xref="GeneID:12396412"
                     /translation="MTLTTVLYLRNCANNLQRTLDYLKNEKLIVLLDQSVDLTNEIVE
                     KNNLDPTIVLKQKFNNLANGLNYLFKENLITTNFYYILDVRNELDEQLISVLKQNLGE
                     QKLYFWNLKRYQKLYKPVKFKNLICENLDFVNTVFYKKDITPLSVSPHGELAYFDLLF
                     QHLNQDRAYQYLKFLSSINEPELFDPKLRRYKVELEDQNIAFLNKMIAHNHQEYLWYY
                     FEHNLEFVKRIVKRGITFEINRKSSFFKTNGFNPLSFYKLTKKYKELFKLVKQ"
     gene            92569..94305
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /db_xref="GeneID:12396413"
     CDS             92569..94305
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /EC_number="2.7.3.9"
                     /note="MGF_0575"
                     /codon_start=1
                     /transl_table=4
                     /product="phosphoenolpyruvate-protein kinase"
                     /protein_id="YP_005880371.1"
                     /db_xref="GI:385325934"
                     /db_xref="GeneID:12396413"
                     /translation="MKKYEGIGASNGVAIAKAYVLKAPVFNFDNNKIKPTEVEDTITK
                     IKQAFHKSSEQLRELRTIALKNLGEEIAVVFDGHINIVNDPMLFDQISQEVKEHLANA
                     PTAVSKIYDQTKAMFEGIQDAYLRERASDIGDVKKRILSNLLNVALPDLLAINHEVII
                     IADDLTPSETSLLNKQYVKGFATNIGGRTSHSAIMARTLEIPAVLSLKTITETLKHDQ
                     LICIDGNKGVVYSDLSEADITSLKQDQQRYNESQAKLKKYLPPKAVTLDGHETIVAVN
                     IGKPIDLLKGNDYGAKGVGLFRTEFLYMDSANWPDEETQFNAYKQALDYANNETVIIR
                     TLDIGGDKKLNYYQFPEEMNPFLGFRAIRFTNQNPDIFKAQLRALLRAAKFGSLGIMF
                     PMIANLEELFKAKEILEEAKKELDQRKVEYGKPLVGIMIEIPSAAVMSDVLAKYVDFF
                     SIGTNDMIQYSFAVDRMSKDVNYLYQPLNPALLRIVKMTIDGGLKHNVWTGMCGEMAG
                     EPLAIPILLGMGLKEFSMSASSMLKAKELINNLKYSDCKELVNQVINLESQEEVVKKV
                     KEFLAKNNLSVA"
     misc_feature    92578..92955
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    92581..94290
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    93040..93246
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    93355..94191
                     /gene="ptsA"
                     /locus_tag="MGF_0575"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            94386..94931
                     /locus_tag="MGF_0586"
                     /db_xref="GeneID:12396414"
     CDS             94386..94931
                     /locus_tag="MGF_0586"
                     /note="MGF_0586"
                     /codon_start=1
                     /transl_table=4
                     /product="sigma factor-like protein"
                     /protein_id="YP_005880372.1"
                     /db_xref="GI:385325935"
                     /db_xref="GeneID:12396414"
                     /translation="MINLLDINKVIDKYYWYAFKVASKVFYNYYSSLPFESADLHQIS
                     ALAIMDGYNRFDSKKNDNFDGYIKKYVSLYIISTFKKETTNKRKLLNNSSEKDNTTPI
                     CHKTPEYYLKLDEFRTEIKKVLRKFSPNQRKIIMEFLQGSRICDIVKELKTNKHKVSY
                     VITKFKNEIIKNDLIKNSLNY"
     misc_feature    94401..>94793
                     /locus_tag="MGF_0586"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     gene            95365..95637
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /db_xref="GeneID:12396415"
     CDS             95365..95637
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /note="MGF_0592"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S15"
                     /protein_id="YP_005880373.1"
                     /db_xref="GI:385325936"
                     /db_xref="GeneID:12396415"
                     /translation="MALSKDKKTEIIKKFQKNDADVGSVFVQVAVLTEEIKLLTEHLL
                     KNKKDFISKRGLYTKVSKRKNLLNYLKQNDLNAYRNLISELELRHS"
     misc_feature    95383..95619
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /note="Ribosomal protein S15 (prokaryotic)_S13
                     (eukaryotic) binds the central domain of 16S rRNA and is
                     required for assembly of the small ribosomal subunit and
                     for intersubunit association, thus representing a key
                     element in the assembly of the whole ribosome; Region:
                     Ribosomal_S15p_S13e; cd00353"
                     /db_xref="CDD:238213"
     misc_feature    order(95386..95388,95437..95439,95446..95448,95467..95469,
                     95479..95481,95488..95490,95500..95502,95506..95511,
                     95515..95520,95557..95559,95569..95571)
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /note="16S/18S rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(95452..95454,95461..95466,95473..95475,95482..95484,
                     95602..95604,95614..95616)
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /note="S13e-L30e interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(95542..95544,95554..95556,95617..95619)
                     /gene="rpsO"
                     /locus_tag="MGF_0592"
                     /note="25S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238213"
     gene            95668..97449
                     /locus_tag="MGF_0594"
                     /db_xref="GeneID:12396416"
     CDS             95668..97449
                     /locus_tag="MGF_0594"
                     /note="MGF_0594"
                     /codon_start=1
                     /transl_table=4
                     /product="putative hydrolase"
                     /protein_id="YP_005880374.1"
                     /db_xref="GI:385325937"
                     /db_xref="GeneID:12396416"
                     /translation="MCAFFVFIDIFILIINNMAKINFFTLGGQDEQGKNCSVLEVNDD
                     IYLFNAGSLVPINSLLGVEQLIPDYSYIVNHKKKVKGLFIGYPSQSNLGSLLYLLKSL
                     KPQTLTVYTSLIGKTIIESIMDKQRDFEPYKKHVNIVVLNPLKEFKINDSVSVIPFRV
                     FSSIPYSYGFCLSTQDGMIVYIDDFILVNDKNKTFSSDLMDLRMLINNKKVLLLIVGA
                     GQVGKHISNTSPNHRSKQAIEKFINDCKGRSIIACYDDNVYAMFTAATIARKQQRPFI
                     VYSQASINLFNTIIKKNMFNSRDLQTMPISEMNNVKDAIIVVANTPHNLYNQLAKIAT
                     GEDKRLKLDSEDRFILLTPKIAGFESYEAKILDEIARCDVIYKRLNSEVLPIKASNED
                     HKFLVNLLRPQYAVPIQGLYKEFVKYLEVVNQTGNFKEHQKPILLYNGEILSFVNGKL
                     TNKHEELHLNSKCIDTAGVQDVKSMILSERFQMGCNGVVVLAMYFSTKKMEFLDAIDI
                     QTYGVSDESVKLNEAIQKCKTQIKTMQITFITDIKDRIEKNMKKRITMNDYTQFKKTI
                     RKLVGKIFEKSLFKNAAVITSVVELEN"
     misc_feature    95707..97431
                     /locus_tag="MGF_0594"
                     /note="mRNA degradation ribonucleases J1/J2
                     (metallo-beta-lactamase superfamily) [Translation,
                     ribosomal structure and biogenesis; Replication,
                     recombination and repair]; Region: COG0595"
                     /db_xref="CDD:223668"
     gene            97469..99451
                     /gene="ftsK"
                     /locus_tag="MGF_0607"
                     /db_xref="GeneID:12396417"
     CDS             97469..99451
                     /gene="ftsK"
                     /locus_tag="MGF_0607"
                     /note="MGF_0607"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA translocase ftsK"
                     /protein_id="YP_005880375.1"
                     /db_xref="GI:385325938"
                     /db_xref="GeneID:12396417"
                     /translation="MNRELRDKKTNPKVMMADRNYIIRLTIVVFLGIVLFLSFLRAPY
                     FGEFLDGLIFDLMFFGTAKYIFYLASFIVLIILAFPHPIVYKIHRSKMFWLFILLVDL
                     FILLIFGLVHYSLYLTNSQITLPTYVNKFFTEWKDSLWIHGKWLWQNNASQNNASQNN
                     APLLISGGLINSLFIAINAFFPALIAVELALIVLTIIILFIGIYYNIKGFVKLKNKFI
                     KVLGGVINKNFTPFYERWKTNNNSALVVSNNVEENKETFVKEKQIDDLYYENQNSQTN
                     QPSFSKLTQHHQEKEKLPEIRQKSVNERKLNESLLEVIVEKLEQLFKKENFEVELIEK
                     KCGPTEVYLAYEFSDRKQIKRIKNLDKQFVDIFESNVVSINQKGNIVYFYTKAFNESK
                     ISLADVMIKPDETTKNQLNCAIGIDQDFNPINFDLKKEKSFLFIGGLGSGKLACTVSS
                     LISLAISKPTTDLQLAIIDLPDSKLSKLDVLGHLVHPPINSIEEANRFFEKIMTEMKY
                     RNKILDENNVETIDEYNNKNPNQKIKNFVICINDLNDLLDYDFSNIFKIISYIYKVAN
                     KINVYLILVANSITKALIDDDLLTYYGKIINLKVDTPEESDLLVNNKELYKLHKNGDF
                     YIVDPKSRNTLVRGLSCFVEDYVLEDLRRHYSIKEY"
     misc_feature    98669..>99043
                     /gene="ftsK"
                     /locus_tag="MGF_0607"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     gene            99455..99784
                     /gene="trxA_1"
                     /locus_tag="MGF_0619"
                     /db_xref="GeneID:12396418"
     CDS             99455..99784
                     /gene="trxA_1"
                     /locus_tag="MGF_0619"
                     /note="MGF_0619"
                     /codon_start=1
                     /transl_table=4
                     /product="thioredoxin"
                     /protein_id="YP_005880376.1"
                     /db_xref="GI:385325939"
                     /db_xref="GeneID:12396418"
                     /translation="MKSISLKELEQVIQTSKKPIFVKFSWADCGVCKMNAPIIENAAN
                     QRKDQYDWYEIDVDKEQIWAEDQPNHQWAIKIVPVYMIFKNKQKVFEHVNFLAQDKLN
                     TELDKHI"
     misc_feature    99473..99772
                     /gene="trxA_1"
                     /locus_tag="MGF_0619"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    order(99539..99541,99548..99550)
                     /gene="trxA_1"
                     /locus_tag="MGF_0619"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            99793..102408
                     /locus_tag="MGF_0623"
                     /db_xref="GeneID:12396419"
     CDS             99793..102408
                     /locus_tag="MGF_0623"
                     /note="MGF_0623"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880377.1"
                     /db_xref="GI:385325940"
                     /db_xref="GeneID:12396419"
                     /translation="MDLMNGFFSFEHEPVFFEIHYLFYYTWTKEGLKKLEEIGQISFH
                     HYDKIQIEQEKANSWYQLFLILNKTNKPIAGQVYLDNLKYLSNTTAFSKKKAKLLVVN
                     VQQEDYDKFFDNNKNIITTLFNNFYNELLIKDVKDQFVNKWRSKFSFHKKVLAARLFD
                     AFLEKHNKFLELQKSIKLYNDQFYNAKDINLSHFNLLKRNYDELVDSLTYYDEDFKTI
                     NEKNVALINAQKTSEKISHIYFLEDQIKNLKQRIVNLKINKKYGPYSVEQLAEIKRAT
                     NEVKQLVIQNKKQKRDLKMILRSYIKGLKKQCSFNQSRAFIESNYADKIYYLSEWFKA
                     NELVKVIKKIRWITHLDLDNLNQFINQSKKLIIKRTEHIHDFEKTIKLKEKRQLGFLY
                     SDLRYKFKKIAKISLHKSDQEINNLIVDLVEKNKLNYGRYLNELFQKRLYLSRLKLNF
                     KESIKLYRLHLNGYDFYKLFNNKYQAKVYSDDTKKLFNKNVLDKIYQLSINSYQRLYH
                     YYLNLSKTSRNEIQAIIFYINAFSFKLTLAFMDSYKMNPLVSFYSNLMNIHWATRLIW
                     NQTKRFIDEIEIETDSLTNFPKINFDVKNYSKNLKAKFELQYKKYLDNNRKINAKINA
                     RYDEYIVQHSTDVKQKLNTNAYLKFNSESYKKEIESKIVDIKELIILNKARQEQYKLD
                     YLSNNVINDQRFAFDRFNKLKTTIKTLYRNLKLVNKILYKKKLLKTKKAIDIRTISSK
                     LNYYLAIINRWEYLYDLFIDWKPIKYRSKKLRKILTELYLYRSYKDVGINEEINYSYL
                     SFLSSSDAITVYLLSKFAKAPKLLFVENFNLNNKHEYNVFKGLLLKYQNKSQTAIVLN
                     DSDQKLMNDLGIRKF"
     misc_feature    100096..>100713
                     /locus_tag="MGF_0623"
                     /note="DNA polymerase III PolC; Validated; Region: polC;
                     PRK00448"
                     /db_xref="CDD:234767"
     gene            102408..105266
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /db_xref="GeneID:12396420"
     CDS             102408..105266
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /note="MGF_0633"
                     /codon_start=1
                     /transl_table=4
                     /product="excinuclease ABC subunit A UvrA"
                     /protein_id="YP_005880378.1"
                     /db_xref="GI:385325941"
                     /db_xref="GeneID:12396420"
                     /translation="MKKIKKDSANYISIVGARQNNLKNISLDIPKNQLVVITGLSGSG
                     KSSLAFKTIYAEGQRRYLESLSPYARQFLGNNDKPDVDSIEGLSPSISIDQKSTSHNP
                     RSTVGTVTEVYDFLRLLWSRVGDAYCINGHGMIKTTTIKQIIDHVLELEDDSKLQILA
                     PVIKLQKGTFKNEFEKFYKQGFMRVLVDGVVYSLDDKIELDKNQKHDISIVIDRLILN
                     KDNQTKLRITDAIETALTVSNGLIQIIANDQAKYEFSLNHSCDQCGFFIPELEPRLFS
                     FNSPIGACDYCKGLGFTYEPDVDKIIPNKDLTINEGAIDYFKNRINTSSQDWQRFYSI
                     IRHYQIDLNTPIKNLSKKEINYLLEGSDEPIEIVIESANRNGISSRLDYVEGIAKLIQ
                     RRHLETKSSAARDNYSKYTSEQKCKTCDGKKLSPAALSVKIGGLDIIEFTNLNVNKAL
                     DFILGLEFNEEKTKIAKFVLKEILDRLHFLVNVGLEYLTLSRNASTLSGGESQRIRLA
                     TQIGSRLSGVLYVLDEPSIGLHQKDNDKLIKTLLSMRDLGNSLIVVEHDEETMMSADY
                     LIDIGPGAGTYGGKVVAAGTVEEVMKNPASLTGQYLSKKLEIEQPKKLHPGNGQKIVL
                     KGASANNLKNINVEFPLNKLVVVTGVSGSGKSTLINQTLVNGIEKALFNKHVEVGKYK
                     SLIGINNIDKVIKVSQDPIGRTPRSNPATYVSVFDDIREVFANVFEAKARGYTKSRFS
                     FNVSGGRCDDCQGDGVKCIEMHFLPDVYVKCSSCNGKKYNEATLEIKYKNKSIYDVLE
                     MSCQEALEFFKVIPAINRKLQLMCDVGLGYMKLSTNATELSGGEAQRIKLAKYLQRKA
                     TGNTIYVLDEPTTGLHAHDIKKLLSVLNRLVDNGDSVIVIEHNLELIKVADHIIDLGP
                     NGGDDGGYLICAGTPQELVKNYTDSSYTARYLAKIMKS"
     misc_feature    102426..105263
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     misc_feature    102441..>102779
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    103554..104162
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /note="ATP-binding cassette domain I of the excision
                     repair protein UvrA; Region: ABC_UvrA_I; cd03270"
                     /db_xref="CDD:213237"
     misc_feature    104271..105194
                     /gene="uvrA"
                     /locus_tag="MGF_0633"
                     /note="ATP-binding cassette domain II of the excision
                     repair protein UvrA; Region: ABC_UvrA_II; cd03271"
                     /db_xref="CDD:213238"
     gene            105305..106192
                     /gene="tsf"
                     /locus_tag="MGF_0646"
                     /db_xref="GeneID:12396421"
     CDS             105305..106192
                     /gene="tsf"
                     /locus_tag="MGF_0646"
                     /note="MGF_0646"
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor Ts (EF-Ts)"
                     /protein_id="YP_005880379.1"
                     /db_xref="GI:385325942"
                     /db_xref="GeneID:12396421"
                     /translation="MKNMASITELIKQLRASTQAGFMDCKKALEATNNDIDQAIKWLR
                     ENGIAKAAKKVDNVASEGVIKLKLADQKATILEINSQTDFVTKNDQFVAFSNELVDLV
                     HKHEITDVAKIEQLKLASGSTVAETQIHLTAIIGEKISLRRVGFVKEEANSSLATYLH
                     SNSRIGVIVKTSKTDDKEFLKHLAMHIAASNPKFVSQNDVSADFIAKEREIAAAQAQS
                     ENKPKEFIDRIVDGRINKVLEEVCLVNQKFLVNQEQTVQQAAQAKKVEILNFIRYEVG
                     EGIEKQVTNFADEVKAQMK"
     misc_feature    105314..106189
                     /gene="tsf"
                     /locus_tag="MGF_0646"
                     /note="elongation factor Ts; Provisional; Region: tsf;
                     PRK09377"
                     /db_xref="CDD:236491"
     misc_feature    105329..105433
                     /gene="tsf"
                     /locus_tag="MGF_0646"
                     /note="UBA/TS-N domain; Region: UBA; pfam00627"
                     /db_xref="CDD:250010"
     gene            106216..106926
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /db_xref="GeneID:12396422"
     CDS             106216..106926
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /EC_number="2.7.4.22"
                     /note="MGF_0651"
                     /codon_start=1
                     /transl_table=4
                     /product="uridylate kinase"
                     /protein_id="YP_005880380.1"
                     /db_xref="GI:385325943"
                     /db_xref="GeneID:12396422"
                     /translation="MQKPNIIIKISGASLQDKNSNDCYSYQRINSLADQLKSLAKKYN
                     IGLIVGGGNIFRGKLAKDFGVEINKADYIGMLATVINSTLLESKLQSLGLKTKVLSAL
                     EVKGLTNEINPKSLAEVFSDCQIAFFSGGTGNSHFTTDTATVLRAIQINAQLVLIGKD
                     GVDGVYTDDPKKNKKAKFIEQITYQQALNDQLRVMDLTAFSLAKDHNLKLLIFNIEAE
                     QSIIKTIENKNKHTKITN"
     misc_feature    106231..106920
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /note="UMP kinase (UMPK)-Ec, the microbial/chloroplast
                     uridine monophosphate kinase (uridylate kinase) enzyme
                     that catalyzes UMP phosphorylation and plays a key role in
                     pyrimidine nucleotide biosynthesis; regulation of this
                     process is via feed-back control and...; Region:
                     AAK_UMPK-PyrH-Ec; cd04254"
                     /db_xref="CDD:239787"
     misc_feature    order(106240..106242,106249..106254,106363..106371,
                     106630..106635,106690..106692,106696..106698,
                     106705..106707,106711..106713,106717..106722)
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239787"
     misc_feature    order(106363..106371,106381..106386,106426..106428,
                     106435..106440,106609..106611,106615..106620,
                     106624..106632)
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /note="uridine monophosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239787"
     misc_feature    order(106402..106407,106429..106434,106453..106455,
                     106474..106476,106504..106506,106546..106548,
                     106558..106560,106567..106569,106585..106587,
                     106609..106611,106615..106623,106648..106650,
                     106657..106662,106831..106833)
                     /gene="pyrH"
                     /locus_tag="MGF_0651"
                     /note="homohexameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239787"
     gene            106939..107490
                     /gene="frr"
                     /locus_tag="MGF_0657"
                     /db_xref="GeneID:12396423"
     CDS             106939..107490
                     /gene="frr"
                     /locus_tag="MGF_0657"
                     /note="MGF_0657"
                     /codon_start=1
                     /transl_table=4
                     /product="ribosome-recycling factor (RRF)
                     (Ribosome-releasing factor)"
                     /protein_id="YP_005880381.1"
                     /db_xref="GI:385325944"
                     /db_xref="GeneID:12396423"
                     /translation="MEFKTYSDFFDKNANSIINWFEGELAKVRSGRANLKILDNVRAE
                     YYGEQTPLIEMASLSIPEPREILIKPYEKSSVNPIQAALLKANLNLTPVVDGDKIRIK
                     LPLLTEENRKENVKKVKAVGEKAKQEVRFIRRDTLNKIKSDKIADKDLNKYFEEQVDK
                     ITKKYIDLIDSILAKKEKDLLSL"
     misc_feature    106960..107481
                     /gene="frr"
                     /locus_tag="MGF_0657"
                     /note="Ribosome recycling factor (RRF). Ribosome recycling
                     factor dissociates the posttermination complex, composed
                     of the ribosome, deacylated tRNA, and mRNA, after
                     termination of translation.  Thus ribosomes are 'recycled'
                     and ready for another...; Region: RRF; cd00520"
                     /db_xref="CDD:238288"
     misc_feature    order(107026..107037,107245..107256)
                     /gene="frr"
                     /locus_tag="MGF_0657"
                     /note="hinge region; other site"
                     /db_xref="CDD:238288"
     gene            107490..108608
                     /gene="cdsA"
                     /locus_tag="MGF_0658"
                     /db_xref="GeneID:12396424"
     CDS             107490..108608
                     /gene="cdsA"
                     /locus_tag="MGF_0658"
                     /EC_number="2.7.7.41"
                     /note="MGF_0658"
                     /codon_start=1
                     /transl_table=4
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="YP_005880382.1"
                     /db_xref="GI:385325945"
                     /db_xref="GeneID:12396424"
                     /translation="MRIGTQLKDKQPTKNGRLVSTIVIVGVYLLLFIFNSLSDFFNNW
                     SPLRPIVNQDQLVDTLVNASVRTLFSAIVLLIISTVFFLGLKEIANLFFQQNKWTFVL
                     LNSAYFLVSNLVNIVLIQFSIVKPELTLIVYHDKFSNNMIFLIIVGIILLLNLIINPI
                     FLKLNQRLNKINLLHLFSLSIIFSLGFYGINYVLLNKGWTTFLYLIGIIVMIDSFAYI
                     YGKRFGKIKMVPEISPNKTWAGAIYGIITTIFLMVVVSILYAIPIIIGMVTKSNQPLE
                     VIDPHNLLVNIYYITFYQETNNFIIFWWVFCGFAILVLATIAILGDLYFSYVKRQYQI
                     KDYSNVLRGHGGILDRFDGFCFVFIAFIVYQIIISSVR"
     misc_feature    <108033..108596
                     /gene="cdsA"
                     /locus_tag="MGF_0658"
                     /note="CDP-diglyceride synthetase [Lipid metabolism];
                     Region: CdsA; COG0575"
                     /db_xref="CDD:223648"
     gene            108613..109719
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /db_xref="GeneID:12396425"
     CDS             108613..109719
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /EC_number="1.1.1.267"
                     /note="MGF_0665"
                     /codon_start=1
                     /transl_table=4
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="YP_005880383.1"
                     /db_xref="GI:385325946"
                     /db_xref="GeneID:12396425"
                     /translation="MKILVLGATGSIGKQTIDVICQLKYQLVGFSYYQNHSEANNILK
                     QLNPNYVLCHSDPKYNKNVKSDLIELIDKSKPKVIINAINGYHGIEASLIALSKKKDL
                     LLANKESLVIAGSQLEAIRKDTKTTVYPIDSEHSALYDLLKDKKKNQIKQLIITASGA
                     GYFNKDKSELKKLTYNDLLNHPNWKMGAEISINSATFVNKVYEIVEAYHLFKIKDIIP
                     VVERSSTIHAGVIYQDNSIHFHATTNDMRWAIQSALTKFDNRTNVVQSLDLYQKTIQF
                     EKIDFEQYPIFKIAYDILKNPYTTRGAVLTCINEHVVKLFQKQKINFLQITELISNFY
                     WNYQHKKIDDIWQINDLIFKIKAAISSKYAYLDK"
     misc_feature    108613..109707
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Provisional; Region: PRK05447"
                     /db_xref="CDD:235472"
     misc_feature    108619..108954
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Region: DXP_reductoisom; pfam02670"
                     /db_xref="CDD:251461"
     misc_feature    108994..109245
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase
                     C-terminal; Region: DXP_redisom_C; pfam08436"
                     /db_xref="CDD:254800"
     misc_feature    109345..109656
                     /gene="dxr"
                     /locus_tag="MGF_0665"
                     /note="DXP reductoisomerase C-terminal domain; Region:
                     DXPR_C; pfam13288"
                     /db_xref="CDD:257629"
     gene            109722..110537
                     /locus_tag="MGF_0670"
                     /db_xref="GeneID:12396426"
     CDS             109722..110537
                     /locus_tag="MGF_0670"
                     /note="MGF_0670"
                     /codon_start=1
                     /transl_table=4
                     /product="protease"
                     /protein_id="YP_005880384.1"
                     /db_xref="GI:385325947"
                     /db_xref="GeneID:12396426"
                     /translation="MNLSYYTNLTLLILILVFSIITTLTVHEFGHYIFARIYKVHVKE
                     FSIGIGPTLFSFYLHKKKIIVSFRAILAGAFVMLESTKLRQIYIDDPNAKTYNFYLMP
                     KPKNTHALEEVGYWKQILIMIGGIFTNFLCFGIFLGIYAAIYSNAVLDLSKFFRDIFI
                     NLGKGFVLYEAWKPKDMGEIIPGGGAGMRFGSRSASVQQLLITLISINGATAIFNFIP
                     VAPLDGSKIVQYTYEKITRKQINEKLWTWTTIIGVVLVLWVSLGSVINTIIIG"
     misc_feature    109770..110528
                     /locus_tag="MGF_0670"
                     /note="Site-2 protease (S2P) class of zinc
                     metalloproteases (MEROPS family M50) cleaves transmembrane
                     domains of substrate proteins, regulating intramembrane
                     proteolysis (RIP) of diverse signal transduction
                     mechanisms. Members of this family use proteolytic...;
                     Region: S2P-M50; cl10020"
                     /db_xref="CDD:245232"
     misc_feature    109770..110519
                     /locus_tag="MGF_0670"
                     /note="Peptidase family M50; Region: Peptidase_M50;
                     pfam02163"
                     /db_xref="CDD:251129"
     misc_feature    order(109800..109805,109812..109814,110364..110366,
                     110388..110390)
                     /locus_tag="MGF_0670"
                     /note="active site"
                     /db_xref="CDD:100078"
     misc_feature    110364..110375
                     /locus_tag="MGF_0670"
                     /note="putative substrate binding region [chemical
                     binding]; other site"
                     /db_xref="CDD:100078"
     gene            110560..115044
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /db_xref="GeneID:12396427"
     CDS             110560..115044
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /EC_number="2.7.7.7"
                     /note="MGF_0676"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase III alpha subunit polC/Gram
                     positive-type"
                     /protein_id="YP_005880385.1"
                     /db_xref="GI:385325948"
                     /db_xref="GeneID:12396427"
                     /translation="MNKKELKSFFENLNNKLAIPNPLLTFLKKSTVRTIKKIGDNKKT
                     LDLSFILNQPLTVDLYQTYLDYVANFNNKSKDPYFQFNFILDSSLWTSELIQSAIQEI
                     YKSDKNQSFYAEAIELVNEKFYQIVFSNKELQHQSDQQLEWLVTQLENLGFYQINLAT
                     KLDLNLVAINRNKADEEPKKPKARRVVKEDGFSLEECLEKNKILDTSVITPIKDFDPN
                     QPTSLTTLWAKIYHLDYRKNGTNKALRLGLADKNSAVTIFSWITRSKHLTSEHLENFK
                     VGNWIKIQLRVTSSKDDKKYTEILRIDHAELPEWLKPTPEEFTNRHEFFFHTKMSVHD
                     GLNDVDDLKKFCEENKLKDIAITDSGVVQAFADLASWKEKTNSETKVHYGLEVDLFDD
                     RNFIVKNNKDLKLDKLSFVIFDIETTGLNAYYEQIIEIAAVRVKAELNETNHQLEFVQ
                     LGKFEKLIKNEKPLSKFTTQLTGLKDSDLKDAQDEKTVLEEFANFIQKDDVLVAHNGI
                     DFDFIWINTKLDKYKLKPLDNPMLDSLRLAYQLYQFKRYTLENLSLKLGYEYDKTLAH
                     RANYDTELLAKCLMIMLSQIYAKNWRSLLDLNDQEKLLNYLSEKSLKKAANLKINDED
                     NLDQITQSNENLFNRIRLRKAIVYAKNAQGLKALYKLVSLASTKQFYGSPKLFWSDLE
                     KYQNDLLISSHPINGHIVHAAKYDTNENLRKLIKKHSFVLVPLPSLFKQDLYKKNIEL
                     THVHDLINRIISICEQEKILYTFSSAAHYLKQEQKRFYDCLITAEITGKKLHHFYDRD
                     LSTNQNVPDLHIRKNNEVYHDFSFIQDQEILEKLIYRNGEKIANLFNDEGLLPFPKKL
                     HPPKIEGSDDKLIELVWNKAKELFGDEIDPIIKSRIEYELNAIIKNGYGIIYWLAHLL
                     VKKSNDDGYLVGSRGSVGSSIVALLAGISEVNPLQPYYYCKKCKKTKFVDNVDDGHDL
                     VNKPCEFLDCDGEMRGEGHNIPFASFMGFKGEKTPDIDLNFSSFYQAKAHDYVRELFG
                     ESHTTRCGTISTMQDKTAYKIAKDYLEITIGEEESERLAGWYASEMSEIKRTTGQHPG
                     GILVFPKDKEIEDFCPVNYPADDKSSKWKTSHFKFEYLHDTLLKLDILSQEDPTILKY
                     LYEITNVKPEEIPNNDPKVLSLFNLDHCLENVNNNPILKDSTGALGIPEFGTKITREI
                     LKIAKPASVADLIRVSGLSHGTDVWTNNAADLIVDKHYKLNEVIACRDDIMTYLSSLG
                     IENQIAFNIMEDVRKGKKLKPEYEKIMQEFNVSQDYIDSCNKIKYMFPKAHATAYVLM
                     AWKIAWFKVHYPEAFYAAIFSFKVKEHDIETCINGGIRAITKRYNEIKSLINKTKFAK
                     NKSELTLNKKDEDLMPTYELYLEMLERNIKLEQVSLEHSDALHFVVKNNKIYPPFNTI
                     NGLGDEIAKLIVKKRNEEGFKSQADLKTKCKLNKNIWNYFITYQVFGDLKEDEKIRLY
                     "
     misc_feature    110560..115041
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="DNA polymerase III PolC; Validated; Region: polC;
                     PRK00448"
                     /db_xref="CDD:234767"
     misc_feature    111520..>111771
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="Polymerase and Histidinol Phosphatase domain;
                     Region: PHP; cl17102"
                     /db_xref="CDD:266516"
     misc_feature    order(111532..111534,111538..111540,111634..111636,
                     111715..111717)
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="active site"
                     /db_xref="CDD:213985"
     misc_feature    111790..112299
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    order(111799..111810,111814..111816,112072..112077,
                     112084..112092,112255..112257,112270..112272)
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    order(111799..111810,111814..111816,112072..112077,
                     112084..112089,112255..112257,112270..112272)
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    order(111799..111801,111805..111807,112090..112092,
                     112255..112257,112270..112272)
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     misc_feature    <112492..113097
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="Polymerase and Histidinol Phosphatase domain;
                     Region: PHP; cl17102"
                     /db_xref="CDD:266516"
     misc_feature    113155..114438
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="Bacterial DNA polymerase III alpha subunit; Region:
                     DNA_pol3_alpha; pfam07733"
                     /db_xref="CDD:254393"
     misc_feature    114775..>114969
                     /gene="polC"
                     /locus_tag="MGF_0676"
                     /note="Helix-hairpin-helix motif; Region: HHH_6;
                     pfam14579"
                     /db_xref="CDD:258717"
     gene            115066..118446
                     /locus_tag="MGF_0698"
                     /db_xref="GeneID:12396428"
     CDS             115066..118446
                     /locus_tag="MGF_0698"
                     /note="MGF_0698"
                     /codon_start=1
                     /transl_table=4
                     /product="putative helicase superfamily protein"
                     /protein_id="YP_005880386.1"
                     /db_xref="GI:385325949"
                     /db_xref="GeneID:12396428"
                     /translation="MANDWTWLRTRLINNKTKSNTFWIRTRGSSVMDIGVLLKLTSNI
                     YDLSIKGILSYLNSNDTLELDLRKLRELSDLEAFNLFGIETAKELYKEYTDQFSKIFK
                     KLVKEERVTGDTSLFIGLPIIEGCNQWGDSYRAPLLYVEVVLYPVNQYQKIVFKINRS
                     EFWINTTILAVEASKRGILFENKYDSSKLDFEQALEIFRTFDIGFKKPSTNELINFKE
                     MTKKTFLENWEQNGGINNIVNNVVLGNFDIKGDKLLKDFTEILDKEPDTVDEVFNNKK
                     DLLFNYEKFANEYSLSDIYLTSHLDFFQQLAVKHALEGDVVIEGPPGTGKSETILNIL
                     INIALKGKTALFVSEKTTATEVVYNRLGKFKHLALYIPSLNKEPGKFYRQFSDYENYF
                     SENYYDQVHKTPNAKFDPDYLKRYLEQSYIIHKIYNYEINSGDNVYSFLNLILNYKPM
                     DVDHINIDDYTRFDEWLKIYTNQDWMTKHQEYIALFNEIDTKWKASTFATFLKIHQKD
                     PNDIKTLLYAIHLYAKKGIVKDEYRVPFFFRPHEKVIESAKLVTEQINKFIELEQYKS
                     ETKKRTILKNLEVDIKRYHKQYFNSWFVQNHSGAFLSKLNSAQSALDNLTDNYSSDVD
                     VYIQSCKRNLKAEIIKNFYELYRHDKRGLLDVCRQGRNKSFKNIAWWFNLNREIIKKM
                     FKIHIMSFETASILLENKKDLYDYVIVDEASQVFLERAIPALYRAKKYIIAGDTKQLQ
                     PSSFFSSRSDYDDVALDKLADEEILEVEESVNAVSLIHYLKERSRINVVLRYHYRSNF
                     GDLIAFTNDHVYDNELIFMNKAIKQKESFVVHDIIDGKWKDRKNIPEAQAIVSRIQRL
                     TKTADYQKSLGIVAFNRSQADLIELMLDKLNDPLVNEWRERNNDNGEYIGLFVKSVEN
                     VQGDERDIIIFSVAYDKSVVSYGPISSITNGVNRLNVAITRAKDRIELFKTNKASEYN
                     GWGSSSAGTRLFVEYLSYCENVANHSDYTTYDRQTTEIEEKLKDKSLIFDDVKSTLEK
                     AFGQYFTIKRNVDNGSYNFDFVIYHEEVPFLVIDLDIKPFKGMADFNESFIYRNIFLK
                     NRGWKHFIIWSTEWKLNKRKVLLAIKDILDKRIQMNQK"
     misc_feature    115948..117966
                     /locus_tag="MGF_0698"
                     /note="Superfamily I DNA and RNA helicases and helicase
                     subunits [DNA replication, recombination, and repair];
                     Region: COG1112"
                     /db_xref="CDD:224037"
     misc_feature    116008..>116157
                     /locus_tag="MGF_0698"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    116032..116046
                     /locus_tag="MGF_0698"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    117427..117936
                     /locus_tag="MGF_0698"
                     /note="AAA domain; Region: AAA_12; pfam13087"
                     /db_xref="CDD:257490"
     misc_feature    118135..118359
                     /locus_tag="MGF_0698"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cd01037"
                     /db_xref="CDD:238508"
     misc_feature    order(118213..118215,118255..118257,118261..118263)
                     /locus_tag="MGF_0698"
                     /note="putative active site [active]"
                     /db_xref="CDD:238508"
     gene            complement(119205..120692)
                     /locus_tag="MGF_0721"
                     /db_xref="GeneID:12396429"
     CDS             complement(119205..120692)
                     /locus_tag="MGF_0721"
                     /note="MGF_0721"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880387.1"
                     /db_xref="GI:385325950"
                     /db_xref="GeneID:12396429"
                     /translation="MKKYFKIINVTRRQLALFLVYLATIFLASAGIISLMTNAIVSPG
                     GNNFVIYSENLYTISLILPLVFFVIFAITGLAILLTGKESYKFDNKLIQQTYKFKTLL
                     AFIEFVQLIAWLFFLIILIAYFYPINKTIAQIYQEQIATADFTNRSIQTGLLSFISIN
                     NNFFADLKLSVLKYAATLPYFFNKDVFSLSNIIYFALYITLFIPFLKLSLFKPKQRAL
                     ALIPFSGLVLSYLRSTRFNHEELITENNENLKWYQKILLSNKTVFQIKLTSTVVYLSF
                     FFLVGVLTFTAFASYFILTDGYGYTLIPSDTYVAAYSIDFLNYSISEKEILLSLFWWA
                     AAIIMLIVFIVFSMGIILDDNPFVFPKAIRKNKYTLSLTLVVIEIAQWAFLLLVWIFF
                     LSNASWRIISSVEVVPAVYPTPEPVKPDLTNLIYSSSDLFTTTNLFFVALYLSWFLIY
                     AKAGTFSKRTRIFMYIPFATLFFVSKHVIEKRKRKQVNKFNCRLI"
     gene            complement(120838..120957)
                     /locus_tag="MGF_0725"
                     /db_xref="GeneID:12396430"
     CDS             complement(120838..120957)
                     /locus_tag="MGF_0725"
                     /note="MGF_0725; N-term fragment of MGA_0798
                     Subtilisin-like serine protease"
                     /codon_start=1
                     /transl_table=4
                     /product="Subtilisin-like serine protease"
                     /protein_id="YP_005880388.1"
                     /db_xref="GI:385325951"
                     /db_xref="GeneID:12396430"
                     /translation="MKLKTFISVVSLGITTSVVLLSAALQKKKAEVPSTNQYN"
     gene            complement(121271..122722)
                     /locus_tag="MGF_0734"
                     /db_xref="GeneID:12396431"
     CDS             complement(121271..122722)
                     /locus_tag="MGF_0734"
                     /note="MGF_0734"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880389.1"
                     /db_xref="GI:385325952"
                     /db_xref="GeneID:12396431"
                     /translation="MNQNFRTIHVTERQLTLFIVYLLIALSASIGMLVLMSQAVSNDL
                     LSYFFYDQSKFNISLFLPLIFFILLVGITLPILLTGKEKYQFSARVINSPKKIYTAIT
                     FIEMAQLILWVFFLLILITYFFPINQTVDQIYQTKTTTVDFANDQIYSGLLAFIKIDN
                     NFFVDLKRSIIDYAAILPYFYNKNAFIFYNVVYLVFYLGLFLSYIKLALFKSKQRVLA
                     LIPFVGLVISLKSSNNLNEQALDNDSQVNLKWYQKILESNKSVFEIKLTKQLFKLLIF
                     YIFWIVVFTISAALITFLNQGEYKLNWSLENNKRYVIDLRSEVSIDQETLATIQGTIL
                     FLIPIPVFIGSIIFLVLNKNPYVFSAKLTKNKLKLSLVLIIMEIIQLLFIVAYPHLIA
                     AIPNLATFAVIRPTVFLQQPVNPLLSAQDMFTIGIGFLVVLYSIWFLIFIKSGVFAQR
                     AGVLSIVPFASLFFVNKYMVANNTNSNNNNDLP"
     gene            complement(122765..123022)
                     /locus_tag="MGF_0737"
                     /db_xref="GeneID:12396432"
     CDS             complement(122765..123022)
                     /locus_tag="MGF_0737"
                     /note="MGF_0737; N-term fragment of MGA_0802
                     subtilisin-like serine protease intact in Mycoplasma
                     gallisepticum strain R"
                     /codon_start=1
                     /transl_table=4
                     /product="Subtilisin-like serine protease domain protein"
                     /protein_id="YP_005880390.1"
                     /db_xref="GI:385325953"
                     /db_xref="GeneID:12396432"
                     /translation="MKIKKITSIVSLAMITPAVPLFAAFNNDKTGKPSDSKRTYNRNY
                     GLVNNSLEINKQDINPSEDLSGGSYDELYDFENNDYYQGLI"
     gene            complement(123450..124404)
                     /locus_tag="MGF_0747f"
                     /product="putative transposase"
                     /note="MGF_0747f; predicted transposase, degenerate; this
                     region contains one or more premature stops and/or
                     frameshifts"
                     /pseudo
                     /db_xref="GeneID:12396433"
     misc_feature    124923..126755
                     /note="MGF_0748f; Potential ABC-type transport system
                     protein gene region; this gene is intact in strain R(low)
                     but is comprised of 2 CDS regions in strain F"
     gene            124923..125570
                     /locus_tag="MGF_0748"
                     /db_xref="GeneID:12396434"
     CDS             124923..125570
                     /locus_tag="MGF_0748"
                     /note="MGF_0748"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type transport system protein"
                     /protein_id="YP_005880391.1"
                     /db_xref="GI:385325954"
                     /db_xref="GeneID:12396434"
                     /translation="MKSVKSYVYFLHKIMLKKKSSYVLPIVFFALAIIFSIILSVVQI
                     PDRFKNFTIYAIIFAEMILTIFYASLKALNIYKDLEEEGLELLTYSKPINRRDIFIAK
                     FIVFIIFDCYWAILMMVSNLILVLNLKETNLTLIVLLSFTVFFFAFLIFGLFASIIGY
                     KFNGKIALAIPLTIISPLIIGGSIVSSQSTSSANNLAFYLNTKRLLQPAGNEANV"
     gene            125739..126755
                     /locus_tag="MGF_0751"
                     /db_xref="GeneID:12396435"
     CDS             125739..126755
                     /locus_tag="MGF_0751"
                     /note="MGF_0751"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type transport system protein"
                     /protein_id="YP_005880392.1"
                     /db_xref="GI:385325955"
                     /db_xref="GeneID:12396435"
                     /translation="MIDIFNFKNQNIFNTFQSNYTTNLDNYLYYNKLDAPTYSYQLNE
                     NNVLPRYLVNIRDDKTPNYQDVYLVPGALKNNLNPSLDELNNTKIIYARQDADNFDIT
                     FPEDEFNNTNASDIVGKLNWTYIKELLDSKVFNAYSKQFIDNLIKSDGYINGDPSDLT
                     YYHNLLMSEIQNEITDEQSKFNNLDDNITVLEDSSITNKIIKSNIERQIYLTVALVYY
                     IYFNQNNDLLTTALLFNNKLDDNSNNFTPKQLSFNYGTYTYHIGGYANYSTKQEVQNN
                     KVIIRYDLKKSNNFVFQPVTQIMQMTRNEEIINKYLFILLWAVIASLFVVANNILYIR
                     KDYK"
     gene            126755..127459
                     /locus_tag="MGF_0758"
                     /db_xref="GeneID:12396436"
     CDS             126755..127459
                     /locus_tag="MGF_0758"
                     /note="MGF_0758"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type multidrug-like transport system
                     ATP-binding protein"
                     /protein_id="YP_005880393.1"
                     /db_xref="GI:385325956"
                     /db_xref="GeneID:12396436"
                     /translation="MYILEVKRLNKIYQDKKSSRGVFDLNFSVEKGAFHAFIGENGAG
                     KTTTIKSIIGSYRQYEGEILINGISSREAASKSKLGYVPENTIFPKELTTWEYLFSLA
                     KLSGLSSTQAKTKINELLKKFDIVDLVNLKPYSFSSGQKKKVLLMQALINDPELIILD
                     EPAANLDPTARYQLFKLLSQLHNEGKTIFISSHNLSEIDKYVDSYTLIHKGKIVSSGK
                     KGKSLESIFYEEVINK"
     misc_feature    126755..127456
                     /locus_tag="MGF_0758"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    126764..127393
                     /locus_tag="MGF_0758"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    126869..126892
                     /locus_tag="MGF_0758"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    order(126878..126883,126887..126895,127004..127006,
                     127232..127237,127331..127333)
                     /locus_tag="MGF_0758"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    126995..127006
                     /locus_tag="MGF_0758"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    127160..127189
                     /locus_tag="MGF_0758"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    127220..127237
                     /locus_tag="MGF_0758"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    127244..127255
                     /locus_tag="MGF_0758"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    127319..127339
                     /locus_tag="MGF_0758"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            127437..128450
                     /locus_tag="MGF_0764"
                     /db_xref="GeneID:12396437"
     CDS             127437..128450
                     /locus_tag="MGF_0764"
                     /note="MGF_0764"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880394.1"
                     /db_xref="GI:385325957"
                     /db_xref="GeneID:12396437"
                     /translation="MKKSSINKIFVFIASFSIFPSILLSSCVNERKPKDQSEVTIKLK
                     QKQPLTTNEMFVENYLNQIQPDKKLADLYKRTQLTISNAFYDELKAALITASPSNINV
                     LSKSASENSLQVTNSINTIKNTLTKNWFWYLWNINQNTYVLNYFNDDYTDIKGNEETP
                     DNPKNTKSLFDYVQDKYKSYFYNLKNLTFEGIKTFELTNQKHDVYTAKTANYLKLGTD
                     AFIVFFRYTQDNKKEILFSPDVFVKNVENLDLNTLIDAFNTNYILAYENIIKQMINYY
                     TALGEENPEDLAYKEHADNVFFSLYTRNNYASVFNRALDLVNNDQLKLLRYRWGDINE
                     IKN"
     misc_feature    127437..128264
                     /locus_tag="MGF_0764"
                     /note="aromatic cluster surface protein; Region:
                     aro_clust_Mycop; TIGR04313"
                     /db_xref="CDD:234537"
     gene            128434..129447
                     /locus_tag="MGF_0766"
                     /db_xref="GeneID:12396438"
     CDS             128434..129447
                     /locus_tag="MGF_0766"
                     /note="MGF_0766"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880395.1"
                     /db_xref="GI:385325958"
                     /db_xref="GeneID:12396438"
                     /translation="MKLKTKLTKLSLIIPFAFSATSCADYDQRSKLSSHIDHSKDISL
                     RTTSKEELVHKNIIDSLLNLIYKNTPEAQNAKEVYIHQQETNADNIKAQFKQIEEDFN
                     KQFKILEITNWEEELKQKREELIFSRFNPEKAAEIRTRIQELQDLIASARNDDNPIDF
                     FAQYQDFVSKNWFFILNNLNIFDWNFITWALNPYYPESKKILVSEEYQNKVKRLTQFN
                     SLKFSNTYLDDIKLGDESREIGDNDVYYLKKDKLVLRFLIRTVSAPISGVVLSYLPIY
                     FGASRAKNISLNLISSVIHSGFIHRYETGLQQYEVDMPIKQRYGYPAFVFNFLKKDKT
                     NEN"
     misc_feature    128434..129393
                     /locus_tag="MGF_0766"
                     /note="aromatic cluster surface protein; Region:
                     aro_clust_Mycop; TIGR04313"
                     /db_xref="CDD:234537"
     gene            129437..130318
                     /locus_tag="MGF_0769"
                     /db_xref="GeneID:12396439"
     CDS             129437..130318
                     /locus_tag="MGF_0769"
                     /note="MGF_0769"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880396.1"
                     /db_xref="GI:385325959"
                     /db_xref="GeneID:12396439"
                     /translation="MKIKKAFLKFIISSAFVSLALVTIPSYGIKSQVVSQNLDQINLT
                     SDLDLKWRNFLNQTAITNVLHEMFGDNNKAKDEYIKSQFDLINSPYAIKLKSALKYAN
                     LITRPSTAKFDFFSGISYPYPIEQAIKVIDEAQSQNWLWYLYNLTTLVFMQKSDFTRQ
                     NNESAASFAIRDNENKLLYSNFVTLKSNIFIQEVKQVDSDNNVTFYLLNKDGYILQIE
                     IRKDPGEPTSAIIFGYIRTYPKLLEANQINEIFNLNKYVNLYASFGLSSNNETAEVLY
                     KDFYGGVLLQYTAVDID"
     misc_feature    129437..130315
                     /locus_tag="MGF_0769"
                     /note="aromatic cluster surface protein; Region:
                     aro_clust_Mycop; TIGR04313"
                     /db_xref="CDD:234537"
     gene            130319..131245
                     /locus_tag="MGF_0774"
                     /db_xref="GeneID:12396440"
     CDS             130319..131245
                     /locus_tag="MGF_0774"
                     /note="MGF_0774"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880397.1"
                     /db_xref="GI:385325960"
                     /db_xref="GeneID:12396440"
                     /translation="MKKIFKLLNLGLLTALLPIVIASCTNDNSSEKIRMKSDDKVSYS
                     PLPRLFFPKAKYVDDLEAALAKYDLSFSDEQEQNFEKFDLAKFNKLDSQLTKNANEIY
                     RLQKQIAETSISAEVKAEKHQQILVLFDKNSALLSDNIMAFFKYIYNFRMKFYDYALL
                     TDSFKNNSENHSARYLHFALNVNNQFANDNLAAHIHFRYNRSITRVNIVGADLKTSML
                     VDSELREGYRVMYVSLSNVIFKLYVSNDNKILLDSRAIFFSGAIGNIDPQETLDAMEK
                     NPEKLTQFDIENFENKFTALPYVKYPQINSIF"
     gene            complement(131715..132068)
                     /locus_tag="MGF_0783"
                     /db_xref="GeneID:12396441"
     CDS             complement(131715..132068)
                     /locus_tag="MGF_0783"
                     /note="MGF_0783"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880398.1"
                     /db_xref="GI:385325961"
                     /db_xref="GeneID:12396441"
                     /translation="MLMCSLKKQVRNDRVQLQVATENNAQSETANLSKINSANSSVVN
                     NSSIGDSTIISGGNLSSCNSTGNGDTAYLPANVEALVNSTNVSDQVWYKNTSTNSGID
                     IGELLFIKIIELISI"
     gene            complement(132204..132825)
                     /locus_tag="MGF_0790f"
                     /product="putative transposase"
                     /note="MGF_0790f; predicted transposase, degenerate; this
                     region contains one or more premature stops and/or
                     frameshifts"
                     /pseudo
                     /db_xref="GeneID:12396442"
     gene            133720..135693
                     /locus_tag="MGF_0795"
                     /db_xref="GeneID:12396443"
     CDS             133720..135693
                     /locus_tag="MGF_0795"
                     /note="MGF_0795"
                     /codon_start=1
                     /transl_table=4
                     /product="Subtilisin-like serine protease"
                     /protein_id="YP_005880399.1"
                     /db_xref="GI:385325962"
                     /db_xref="GeneID:12396443"
                     /translation="MGYLHLLLEDFMKLNKIISVISLGVTGAAFPLSVVFNSYKKTNT
                     KSFINKTTNGVINKDKTNTKVLNNETENPVYQSSDSFYDFEKNDYFKGFITFKGNFDI
                     FNHDNILKLIRQRPQVLYAKKSLAIKNYYLVTLSFKKNSDDKKQFDSFLNTYDLVGDF
                     YEIENDEKIESNPSIAIINGVEDSYVNGGGLSQNLNRYRNNFESNYYTDLDRNVIIQH
                     VDHQVNYYGQKRIGIAVLEVGQGDKHPERALIDANNSYYFDKKITNVYNRWDPYWNGL
                     FHKPTYGNHSTEVASVISGINGVNPYHNLYGVKVNLFNSSLLYAFSGLDNEIDYIRRI
                     DNLKIVNNSWGIGKPKNANSNLFKYNYYSRFLDLLTANERDLIFVIAAGNEGNTNLPK
                     LFGFDLSYNSILIGSNNDDKSLSWFSSRGSNTYSSPLILANGSSYPFKNSRKSGTSYS
                     APFVSGVLANTLIQYKEKYKLGINSIIAKAALGVSSTNEKNDKTVEKNRLDPSQGVGI
                     LNYQKLWSAFNNLKYIRWTDSSDVLVNNLWKSKNVDKSLAIERLQLKKGDNLRISLSW
                     LFKPSSSTVYRWEQNNKDLTSSINYDEQNFNLIFRKTDGSIFKRTESLNNFEFLQVPI
                     TEDGSYEIIVSKPNQKPSKTETELALSWTKERI"
     misc_feature    134452..135180
                     /locus_tag="MGF_0795"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    order(134572..134574,134749..134751,135061..135063)
                     /locus_tag="MGF_0795"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    order(134572..134574,135061..135063)
                     /locus_tag="MGF_0795"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     gene            135709..137187
                     /locus_tag="MGF_0805"
                     /db_xref="GeneID:12396444"
     CDS             135709..137187
                     /locus_tag="MGF_0805"
                     /note="MGF_0805"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880400.1"
                     /db_xref="GI:385325963"
                     /db_xref="GeneID:12396444"
                     /translation="MENYLKIINITRRQLALFLVFLGTVIFASAGIISFMTYALSDQG
                     FYFVIYDQMKFNISLILPLIFFVIFAVAGLTILLTGKESYQFSNKLIKNPNWLKIVIL
                     FVEIIQLIIWALFIIILMTYFYPINKSIDEIYQAQTSTVDFNNNTIYSGLLSFVQINN
                     NFFADLKISILNYASILPYFYNKDSFTFWNIVYLTLYLSFFLAYVKLSLFKQKQRILS
                     LIPFVGLISYLKTPNKLEQNVFLEPDTTGLKWYQKILASNQTVFKIKLTKTTLSLSLF
                     YLASVLGFVIYAIAITFMYGIGFKLKPSVDVNNAYVYDFNRWNREFNESELRVVSDYR
                     KALPLFFIITFFVMSLGIIFDKNPYTFGVKVRKNQARLSLTLLAIDITQALFITLLIL
                     FLSANAYDKINPTVENKALPVDSDFNDPWSLYTGQDLFITSSLVFVLIYLSWFLAYAK
                     GGVFSRRTRILMYVPFASLFFVNYHVVNKEISNSKSYRCQTI"
     misc_feature    137483..138967
                     /note="MGF_0810f; Potential unique hypothetical membrane
                     protein gene region"
     gene            137582..138967
                     /locus_tag="MGF_0810"
                     /db_xref="GeneID:12396445"
     CDS             137582..138967
                     /locus_tag="MGF_0810"
                     /note="MGF_0810"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical membrane domain protein"
                     /protein_id="YP_005880401.1"
                     /db_xref="GI:385325964"
                     /db_xref="GeneID:12396445"
                     /translation="MMTYALSDQGFYFVIYDQMKFNISLILPLIFFVIFAVAGLTILL
                     TGKESYQFSNKLIKNPNWLKIVILFVEIIQLIIWALFIMILMTYFYPVNKSIDEIYQA
                     QTSTVDFNNNTIYSGLLSFIQINNNFFAHLKISILNYASILPYFYNKDSFTFWNIVYL
                     TVYLSFFLAYVKLSLFKQKQRILSLIPFVGLISYLKTPNKLEQNVFLEPDTTGLKWYQ
                     KILASNQTVFKIKLTKTTLSLSLFYLASVLGFVIYAIAIIFMYGIGFKLKPSVDVNNA
                     YVYDFNRWNREFNESELRLMTDFSTALMTFFIITFVVMSLGIILDKNPYTFDAVVRKN
                     QVRLSLTLLAIDITQSLFYTLIFYFYVANAYDSLYPLVVPLDLALSGDTDHNNAGWLY
                     GSQDLFITSSLVFVLTYLSWFLAYAKGGVFSRRTRILMYVPFASLFFIKYHVGNPKIR
                     NSNINRCRLLY"
     gene            139271..141139
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /db_xref="GeneID:12396446"
     CDS             139271..141139
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="MGF_0818"
                     /codon_start=1
                     /transl_table=4
                     /product="transcription elongation factor NusA"
                     /protein_id="YP_005880402.1"
                     /db_xref="GI:385325965"
                     /db_xref="GeneID:12396446"
                     /translation="MSVDNKSFLEAIQTVAETKNISKKEISTILKDAIIRACAKEDPD
                     QRIDVMIDFDMGLLKIFKLYKVIDDSVGEEEFDEINEIHLRDALATNPTIKVGDDFLK
                     SLSIGDFSRVVATNISQYFRQKLSELVNKQAVSEWTPKLNKIVRGTVEKDENNPNVLL
                     VNLGGIYAYYYKRDWVPNEELQNDVEYDFVLTQIKEQSKSWPLVVSRSDALYVKHVLT
                     ENIPEIKEGIVEIKAIQRVAGQKTKVAVLSNNPDIDPVTLILGDGGIRIKSIAANLIE
                     HSSGVKVSNEVIDVFHWNDDVFKLIANACYPVDIIGVDVLEDSERDKSVDIIVEDQYL
                     PFLIGRAGINVRLLSYMTGWSIDFKSQSAAIEDNINVVPLNYSPVDNAVLVDQFKRNS
                     RRTKIASKQPFKKVETVQTPLIAYSTAVEGDDDIKVDFQKIYEEAKEPRYEMIDLTKY
                     QPKPVVQDDLEEYQPELGDGIEDELVVEQESEVVQEQPEVVEQEQEPSVNVTARYDDV
                     SEQIAHLDLSKPLIVEEEEQRDLVQKTVKTPKKEKKVQKEKEETVEFVNIDESAYDNV
                     QNENTSITELIRELDITQTPKKEVKKVVLIQDKKDKDKDKKKKKSQRQSLDSFENL"
     misc_feature    139280..140752
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="transcription elongation factor NusA; Validated;
                     Region: nusA; PRK09202"
                     /db_xref="CDD:236410"
     misc_feature    139292..139666
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="NusA N-terminal domain; Region: NusA_N; pfam08529"
                     /db_xref="CDD:254856"
     misc_feature    139982..140209
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="NusA-like KH domain; Region: KH_5; pfam13184"
                     /db_xref="CDD:257552"
     misc_feature    140165..140347
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="NusA_K homology RNA-binding domain (KH). NusA is an
                     essential multifunctional transcription elongation factor
                     that is universally conserved among prokaryotes and
                     archaea. NusA anti-termination function plays an important
                     role in the expression of...; Region: NusA_KH; cd02134"
                     /db_xref="CDD:239049"
     misc_feature    140285..140296
                     /gene="nusA"
                     /locus_tag="MGF_0818"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239049"
     gene            141154..141423
                     /locus_tag="MGF_0832"
                     /db_xref="GeneID:12396447"
     CDS             141154..141423
                     /locus_tag="MGF_0832"
                     /note="MGF_0832"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880403.1"
                     /db_xref="GI:385325966"
                     /db_xref="GeneID:12396447"
                     /translation="MKKITQRFDLITKKQLPIDQVYRIVFYQNQLTVDYHYKIKARGV
                     YLNKNEHFIIDKKVKALIQKSFKTKILDEEFNRLSDALRKRGQDE"
     misc_feature    141169..141399
                     /locus_tag="MGF_0832"
                     /note="Protein of unknown function (DUF448); Region:
                     DUF448; pfam04296"
                     /db_xref="CDD:252511"
     misc_feature    order(141172..141174,141220..141222,141286..141288)
                     /locus_tag="MGF_0832"
                     /note="putative RNA binding cleft [nucleotide binding];
                     other site"
                     /db_xref="CDD:238173"
     gene            141416..143263
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /db_xref="GeneID:12396448"
     CDS             141416..143263
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="MGF_0834"
                     /codon_start=1
                     /transl_table=4
                     /product="translation initiation factor IF-2"
                     /protein_id="YP_005880404.1"
                     /db_xref="GI:385325967"
                     /db_xref="GeneID:12396448"
                     /translation="MNKKPTRNKKPVDQRSKINIKSYLKEVQVGVKDGVFIYTDPLSI
                     DQFAKKVNQPVAKIIKHFFSKGINTINLNTILSLEQIGELCLDLGLDFKIEKSVTSEN
                     LLDNIEFKDKKEDLVKRPPIVTVMGHVDHGKTSLLDAIRSTNVTSNEAGGITQHIGAY
                     QVKKNDELITFIDTPGHEAFTEMRARGANLTDIVVLVVAGDDGIKPQTEEAIDHAKNA
                     NVPIIVFVNKMDKSGANFDRVIQQISKYDLSPEEYGGDTIFVQGSAIKKEGINELLDA
                     ILTLAEINEYKANPNADPYGIVVESKLEPGLGPQATVIIKRGTLKVGDYICIGAAYGK
                     VRIMQDENGNNLTEATPSRPVKISGLDAIPQAGEKFLGLATEKEAKELSDSYKLKQQK
                     QKHLSLQESHEKRTRINTNGIKCVDLIIKSDVQGSLEAIKYAISNINIEGVTTNIIRA
                     STGVISETDIKLAQASNSTVISFNLGVSKQIRDLANSDNVQILSYEIIYKMVEDLEKI
                     MKGELDPVYEESVIGQAVVRVLWKHSKIGTIAGSYVTSGKVVKNALCRVLRDDVIIYK
                     SKIASLKSKTTFVDKVEHNKECGIVVENYNDIKEDDIIEVYEIVKKRVY"
     misc_feature    141506..143254
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="translation initiation factor IF-2; Region: IF-2;
                     TIGR00487"
                     /db_xref="CDD:232995"
     misc_feature    141530..141688
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="Translation initiation factor IF-2, N-terminal
                     region; Region: IF2_N; pfam04760"
                     /db_xref="CDD:252785"
     misc_feature    141776..142264
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="Initiation Factor 2 (IF2)/ eukaryotic Initiation
                     Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887"
                     /db_xref="CDD:206674"
     misc_feature    141794..141817
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="G1 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(141797..141799,141803..141805,141815..141820,
                     141827..141829,141836..141841,141887..141892,
                     141944..141949,142016..142021,142124..142126,
                     142136..142138)
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(141800..141820,141947..141949,142094..142099,
                     142103..142108,142202..142210)
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206674"
     misc_feature    141869..141889
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206674"
     misc_feature    141875..141877
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="G2 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    141932..141943
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="G3 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    141938..141994
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206674"
     misc_feature    142094..142105
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="G4 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    142202..142210
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="G5 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    142301..142567
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="This family represents the domain II of bacterial
                     Initiation Factor 2 (IF2) and its eukaryotic mitochondrial
                     homologue mtIF2. IF2, the largest initiation factor is an
                     essential GTP binding protein. In E. coli three natural
                     forms of IF2 exist in the cell; Region: IF2_mtIF2_II;
                     cd03702"
                     /db_xref="CDD:239673"
     misc_feature    142634..142936
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="Translation-initiation factor 2; Region: IF-2;
                     pfam11987"
                     /db_xref="CDD:256778"
     misc_feature    142982..143233
                     /gene="infB"
                     /locus_tag="MGF_0834"
                     /note="mtIF2_IVc: this family represents the C2 subdomain
                     of domain IV of mitochondrial translation initiation
                     factor 2 (mtIF2) which adopts a beta-barrel fold
                     displaying a high degree of structural similarity with
                     domain II of the translation elongation factor...; Region:
                     mtIF2_IVc; cd03692"
                     /db_xref="CDD:239663"
     gene            143263..143622
                     /gene="rbfA"
                     /locus_tag="MGF_0846"
                     /db_xref="GeneID:12396449"
     CDS             143263..143622
                     /gene="rbfA"
                     /locus_tag="MGF_0846"
                     /note="MGF_0846"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribosome-binding factor A"
                     /protein_id="YP_005880405.1"
                     /db_xref="GI:385325968"
                     /db_xref="GeneID:12396449"
                     /translation="MSKIKTLRLEATIHKLLSQAISTEINNSLIKTSVITAIKLSDDK
                     SVAKIYIDCLIPNNIAKTLQAYKDATGVFRHVLSKHLTIRSIPQLVFYYDDSISKGAK
                     IDQILAEIKQEKKENHE"
     misc_feature    143263..143613
                     /gene="rbfA"
                     /locus_tag="MGF_0846"
                     /note="ribosome-binding factor A; Validated; Region: rbfA;
                     PRK00521"
                     /db_xref="CDD:234787"
     gene            complement(143943..145182)
                     /locus_tag="MGF_0863f"
                     /product="putative transposase"
                     /note="MGF_0863f; predicted transposase, degenerate; this
                     region contains one or more premature stops and/or
                     frameshifts; results in three CDS fragments which encode
                     C-terminal, mid, and N-terminal regions, respectively"
                     /pseudo
                     /db_xref="GeneID:12396450"
     gene            complement(145498..147366)
                     /locus_tag="MGF_0872"
                     /db_xref="GeneID:12396451"
     CDS             complement(145498..147366)
                     /locus_tag="MGF_0872"
                     /note="MGF_0872; Intact in F strain relative to R strain
                     homolog"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880406.1"
                     /db_xref="GI:385325969"
                     /db_xref="GeneID:12396451"
                     /translation="MRKRTKFYMYSIATLSSLGIFLSSCTRASQPVQKGEFDDKVVIQ
                     TAQNQFYPLMSAFSQLVDLYNKQFANTPGFLPVELQQSEKTNATSELQLTNNVVGSIR
                     SNSPLVPNIILADLNAAYQINGFNRLLDLSNNPIINESYFDSDIYNNFNKISGSTQSS
                     DKVYAIPFNLTTTDSLVFNKPVMNLLFSLVEQGGGTVDKNSATYKELHMEDFMEKIPN
                     KKWKNLQVKSNEIYKGLTVDDKTFSNLESMFEFSKKFTEGLELKQTPTITGQQRDLKV
                     FMLNYGPTIYQKYLWSKLGNSRDSWLWNLKLQDNQFDLDFSNLKKTANQNTIGEAYDF
                     FKNNYTTLNLNDEQVLKSIYFGTGGKSDWAAWDIRNFDTAFGIASHVGWNQSVVSPFT
                     IRTFRSTEGDVTQQDINNAKNNFASADDVLWKTQLTKLDKNNLNKNTFWIGGSSLIGI
                     STSRQRDEQTKKFLEWLFNNDTRIAVPDSPFNNQSVSQILNSVSAYDLTSKQALSTTA
                     QQALTDTIAKEQAEVDKVKNNPTPETYNNSDWSRIYLNKGALASLTDWLTFKSELNKD
                     PANNSIAFIHTDEKANRILSILNGAVSGITRSADPTNLTKENLLRQINDALGSTDQ"
     gene            148416..148847
                     /locus_tag="MGF_0877"
                     /db_xref="GeneID:12396452"
     CDS             148416..148847
                     /locus_tag="MGF_0877"
                     /note="MGF_0877"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880407.1"
                     /db_xref="GI:385325970"
                     /db_xref="GeneID:12396452"
                     /translation="MQKRNIFKSYKLDLNNDKLMRKKWYMISGITTVLIIFFAVILGI
                     MQRFVNLSGIQYPAVNNARSLNQAMRIMAIVYFAIFFLPYLYFIAAFFSGINQIYRSF
                     TLHMIIWLTIFVGILLMLTTCALLIAGYSNLDSYNLIRNFQ"
     gene            148856..149500
                     /gene="truB"
                     /locus_tag="MGF_0879"
                     /db_xref="GeneID:12396453"
     CDS             148856..149500
                     /gene="truB"
                     /locus_tag="MGF_0879"
                     /EC_number="5.4.99.-"
                     /note="MGF_0879"
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA pseudouridine synthase B"
                     /protein_id="YP_005880408.1"
                     /db_xref="GI:385325971"
                     /db_xref="GeneID:12396453"
                     /translation="MDFNNKIVIIDKPKNISSAFCLNLFKKRFNIKKAGHNGTLDPLA
                     SGVLVVATNKRTKELSQLNQDDKQYLVKLKFNTHTDSYDRLGKVIRTTNYVPEIKQLN
                     DYLTSLDNHSFYQLPPNFSALKVNGVRAYQLARKAVDFELEKRPTTIYKAKLISYYDD
                     YAEILLDVKKGFYVRSFVVDLASQFNTTAMMVDLVRTRSGQYSLKDVIDYQFNK"
     misc_feature    148874..149482
                     /gene="truB"
                     /locus_tag="MGF_0879"
                     /note="Pseudouridine synthases catalyze the isomerization
                     of specific uridines in an RNA molecule to pseudouridines
                     (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130"
                     /db_xref="CDD:260207"
     misc_feature    order(148967..148978,149378..149380)
                     /gene="truB"
                     /locus_tag="MGF_0879"
                     /note="active site"
                     /db_xref="CDD:211324"
     gene            149472..151445
                     /locus_tag="MGF_0881"
                     /note="ribF/trmU"
                     /db_xref="GeneID:12396454"
     CDS             149472..151445
                     /locus_tag="MGF_0881"
                     /EC_number="2.7.7.2"
                     /EC_number="2.8.1.-"
                     /EC_number="2.7.1.26"
                     /note="MGF_0881"
                     /codon_start=1
                     /transl_table=4
                     /product="Trifunctional protein RibF/TrmU (FAD synthetase,
                     Riboflavin kinase, tRNA-specific 2-thiouridylase)"
                     /protein_id="YP_005880409.1"
                     /db_xref="GI:385325972"
                     /db_xref="GeneID:12396454"
                     /translation="MLSIINLTSKTIKEVNKGVDLVIGFFDGIHKGHAKLFKQSDRFN
                     LLTFDHIPKKQRLLYPKVDEIEQLSALSGLEQLLVYDLLNNNLSAQEFIDNYIKLIQP
                     KRIIVGSDFKFGSDQVDYSLFTKNGYEVVVVKKDHCSTSEIKKLIINCDLDQANRLLV
                     APFYLKGTVIKNAQRGRTIGFATANIILDNQLIELTEGSYVCKIIVDNKTHQGICFIG
                     KPKTFDEKQRQCEAHIFDFDQDIYEKKIKVELHQFIRPTVKFNSINELKEAIENDKKT
                     ALSFFHKQEKPRVVVALSGGVDSAVCAYLLQQQGYDVVAAFMQNWDKDLNFELLSDHA
                     DDQIQGCDAKQDYEDAQKLCEQLKIKLYHFNFVEQYWNDVFLKVLEDYKKGLTPNPDV
                     LCNQFGKFGWFINALRKQFGNNIKIAFGHYAKLITKDDEVFLVHTKDHNKDQTYFLTM
                     LKKEQLKNIIFPLSELDKPTVREIAKQANLYVANKKDSTGICFIGERNFKQFLSNYLA
                     IKKGPIILIDENKKIGEHDGLYFYTIGQSRRLHVGGTKEKIFVCNKDYNNNTLYVCYE
                     SSKDQYLSSVSCELENFNWLTDTKDQLLNKKLWIRFRHRQKLQECEIVSYHDDKVIVK
                     YTKQIGVTPGQYGVIYDQNLWVVGGGKITKIIK"
     misc_feature    149481..150314
                     /locus_tag="MGF_0881"
                     /note="FAD synthase [Coenzyme metabolism]; Region: RibF;
                     COG0196"
                     /db_xref="CDD:223274"
     misc_feature    149532..149984
                     /locus_tag="MGF_0881"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    order(149541..149552,149559..149561,149568..149570,
                     149799..149801,149883..149891)
                     /locus_tag="MGF_0881"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    149943..150317
                     /locus_tag="MGF_0881"
                     /note="Riboflavin kinase; Region: Flavokinase; pfam01687"
                     /db_xref="CDD:250798"
     misc_feature    150333..151427
                     /locus_tag="MGF_0881"
                     /note="tRNA methyl transferase. This family represents
                     tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase
                     which is involved in the biosynthesis of the modified
                     nucleoside 5-methylaminomethyl-2-thiouridine present in
                     the wobble position of some tRNAs; Region: tRNA_Me_trans;
                     cd01998"
                     /db_xref="CDD:238956"
     misc_feature    150333..151427
                     /locus_tag="MGF_0881"
                     /note="tRNA methyl transferase; Region: tRNA_Me_trans;
                     pfam03054"
                     /db_xref="CDD:251696"
     misc_feature    order(150345..150353,150357..150368,150420..150422,
                     150426..150428)
                     /locus_tag="MGF_0881"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238956"
     gene            complement(151447..152763)
                     /gene="ach1"
                     /locus_tag="MGF_0901"
                     /db_xref="GeneID:12396455"
     CDS             complement(151447..152763)
                     /gene="ach1"
                     /locus_tag="MGF_0901"
                     /EC_number="3.1.2.1"
                     /note="MGF_0901"
                     /codon_start=1
                     /transl_table=4
                     /product="acetyl-CoA hydrolase"
                     /protein_id="YP_005880410.1"
                     /db_xref="GI:385325973"
                     /db_xref="GeneID:12396455"
                     /translation="MNYFEAYKNKLVSVNQAISLIKNNSNIWFDYLQPKLLLQGLKDT
                     LETNSYSNLNFYYYASSSDYEETIFLDKFNQIVKRHCFFYRANERNALKKYQNGILQN
                     NVEYYPFHFSESTKILNNFAIDTVILITTDIDENGYFNLGLSTCYDLDLIKKAKQVII
                     EVNKNMPHIMGDKHQIHINDVAAIVKSDYQLTEALSVDPSPEHLKIADYVASLIQDRS
                     TIQLGIGAIPNMVCKKLVNKKDLGIHTEILGTGMVELIKLGVVSNKYKEIDQGVSTFV
                     FAVGDQDMYKYLDHNSKFKIARFDYVNNPLNIAKFENFISVNSAIEIDLLGNVNAEQI
                     QHNQYSASGGQADFIRGASYSKNGKSIIAMKSTTSDCKISKIVTKLKGVTTTLRNDLD
                     YVITEYGIISLKAKSVKQRAKLLISIAHPKFRSYLTRVARSKLLID"
     misc_feature    complement(151450..152763)
                     /gene="ach1"
                     /locus_tag="MGF_0901"
                     /note="Acetyl-CoA hydrolase [Energy production and
                     conversion]; Region: ACH1; COG0427"
                     /db_xref="CDD:223504"
     misc_feature    complement(152200..152757)
                     /gene="ach1"
                     /locus_tag="MGF_0901"
                     /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
                     Region: AcetylCoA_hydro; pfam02550"
                     /db_xref="CDD:251367"
     misc_feature    complement(151471..151926)
                     /gene="ach1"
                     /locus_tag="MGF_0901"
                     /note="Acetyl-CoA hydrolase/transferase C-terminal domain;
                     Region: AcetylCoA_hyd_C; pfam13336"
                     /db_xref="CDD:257666"
     gene            153251..155959
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /db_xref="GeneID:12396456"
     CDS             153251..155959
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /EC_number="6.1.1.7"
                     /note="MGF_0904; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_005880411.1"
                     /db_xref="GI:385325974"
                     /db_xref="GeneID:12396456"
                     /translation="MNKHLSGSQIRQIWLDFFKSKKHEIIESKSLVPINDPSLLWINA
                     GVATLKKYFSGEENPINPRLANSQRCIRANDIENVGVTSRHHTVFEMLGNFSIGDYFK
                     KEAIEFGYELLTKFYGLNKDKLYITIYEDDNDAFNYWVDQGIDPHHIIRCDKKRNFWD
                     LGSGPCGPSTEIYYDRGEKYDPNKLGEKLFFEDIENDRYIEVWNIVFSQFNNTGNNNY
                     TELVRKNIDTGASLERFACILQDVPTNYDTDLYLPIIRTIEKHTNHKYVVDHYFSKDQ
                     SEQDVLRAFRVIADHLKCGVFAIADGVLPGAKDRDYIIRKLLRRAFVYAKKLNAKPEY
                     LVETINVIINTYSDFFKYLIPNKEIVIQAITNEANNFTKTLDYGFEIFNEAKTTNNIT
                     AEMIFKLVETYGFPLDLIKELSAEAKIKLDLDGFEELFKKHQEISKANNGEVGLKKQN
                     ENLLKFETQSKFYYDKNNIKTKVVAIFDDKFNPVDQIEVGSGWAVFESTPIYATSGGQ
                     RFDEGYCLKKGNLVVHFDNVIKAPNKQHLHHFKKASFWLNEKVELMHDENWRKLVRKN
                     HSLEHILHATLKNTINETIKQSGAFKSAAKATLDFNYPTKLTDEDLDKIETKMRQVIA
                     DKIPVTVHHVDYETSQKMNAIAYFEEEYKKHELLRVIKIGDYSVELCGGTHVDNTKEI
                     EECFITDLYSLGAGRWRIEIISSYETIYNYLVDKQNEIKQEKNHMFNELGNYDLTHYL
                     DFSKKLHSFNLPTSIKDLRKTLRAFEQIKEEYKAIKLELDKKKTKDRANQIKKLALDN
                     LEHKIVLLFFDKEEHKALSIAHSELVNEKPDHLFFFINKSDNKINYLIGIKNATDKLN
                     AKLLIDKVNVMFGAKGGGKQNFAQGGFSTDKDVGKLKADFVNICIT"
     misc_feature    153260..155932
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="alanyl-tRNA synthetase; Reviewed; Region: alaS;
                     PRK00252"
                     /db_xref="CDD:234701"
     misc_feature    153272..153976
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    153323..153337
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    order(153404..153406,153410..153412,153464..153466,
                     153515..153517,153521..153523,153527..153535,
                     153851..153856,153866..153868,153923..153928,
                     153938..153943,153950..153952)
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    153461..153469
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    153935..153952
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    155222..155353
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; pfam07973"
                     /db_xref="CDD:254556"
     misc_feature    155744..155938
                     /gene="alaS"
                     /locus_tag="MGF_0904"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            155947..156375
                     /locus_tag="MGF_0918"
                     /db_xref="GeneID:12396457"
     CDS             155947..156375
                     /locus_tag="MGF_0918"
                     /EC_number="3.1.-.-"
                     /note="MGF_0918"
                     /codon_start=1
                     /transl_table=4
                     /product="putative Holliday junction resolvase"
                     /protein_id="YP_005880412.1"
                     /db_xref="GI:385325975"
                     /db_xref="GeneID:12396457"
                     /translation="MYYVALDVGSKTLGIATGDGEFKIASPYCVISFNQYDFKQCLAE
                     LKEKTASFFYDFKFVIGMPKNIDQTKSSTTEMVENFIELLKANYKNEVIIYDESYTSI
                     IADQLLIDNQIKAKKRKEKIDKLAAFVILQSFFDDDRYPK"
     misc_feature    155947..156354
                     /locus_tag="MGF_0918"
                     /note="Uncharacterized protein family (UPF0081); Region:
                     UPF0081; pfam03652"
                     /db_xref="CDD:252086"
     gene            156350..156922
                     /gene="smtA"
                     /locus_tag="MGF_0919"
                     /db_xref="GeneID:12396458"
     CDS             156350..156922
                     /gene="smtA"
                     /locus_tag="MGF_0919"
                     /note="MGF_0919"
                     /codon_start=1
                     /transl_table=4
                     /product="SAM-dependent methyltransferase"
                     /protein_id="YP_005880413.1"
                     /db_xref="GI:385325976"
                     /db_xref="GeneID:12396458"
                     /translation="MMMTDILNKFKQLNLELKIPIMRDENLVNLVNQLSRRKISQLLE
                     IGTGIGFSSMYLSLHLPDLVIDTLEKDIQRYQIAKEWLVNFSKINCLLGDCYEFIPTK
                     KYQAIILDGPKAKQMELFNKYLNYLLPGGVMIIDNFFLRNIKPNNKLYHKNLVWQEFI
                     HNLDKKQFNVEIDQSGDGVVYVFSKPSTIA"
     misc_feature    156473..156754
                     /gene="smtA"
                     /locus_tag="MGF_0919"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(156482..156502,156545..156550,156626..156634,
                     156677..156679)
                     /gene="smtA"
                     /locus_tag="MGF_0919"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            156891..157844
                     /locus_tag="MGF_0921"
                     /db_xref="GeneID:12396459"
     CDS             156891..157844
                     /locus_tag="MGF_0921"
                     /note="MGF_0921"
                     /codon_start=1
                     /transl_table=4
                     /product="collagenase/U32-family protease"
                     /protein_id="YP_005880414.1"
                     /db_xref="GI:385325977"
                     /db_xref="GeneID:12396459"
                     /translation="MFLVSQVQSLNQAKKFIDQAIDCILVGYENFALRCTKTLNHEEL
                     KELVDYRNTKKSKTKIFVLINSFIFENQLDDLTQKLVELDQLKVDKVYFQDYAIVQII
                     RENKLNLAVSYHSETMVTSYGQFDFFRENKINHLVIARELFMNEIKQMHEHKKALELE
                     MQIQGYAFFMHSRWKMISNFEAYAKISDKLSSKKQLWIREALRKYPNAIYEDEFGTHM
                     FTGYILCAIKQLKELHDYGLDYVRIDSIMIKEEDHEKVTLIYQDLINKLNNKKAVSDQ
                     LINKKYDEIAKISSPIEIASGFFGGMKEIKHLIKEEGKVKR"
     misc_feature    157107..157802
                     /locus_tag="MGF_0921"
                     /note="Peptidase family U32; Region: Peptidase_U32;
                     pfam01136"
                     /db_xref="CDD:250390"
     gene            157844..159073
                     /locus_tag="MGF_0924"
                     /db_xref="GeneID:12396460"
     CDS             157844..159073
                     /locus_tag="MGF_0924"
                     /note="MGF_0924"
                     /codon_start=1
                     /transl_table=4
                     /product="collagenase/U32-family protease"
                     /protein_id="YP_005880415.1"
                     /db_xref="GI:385325978"
                     /db_xref="GeneID:12396460"
                     /translation="MKYELLAPAGDVQKAMFAIDYGADAVFLGAKAYSLRSSASNFFF
                     KDIKQTVDYAHERNRKVYVAVNVVCHNPLVKGFAKFIANLEETGVDGLIVADPFIIDY
                     TKKHHPNLDLHLSTQQSVTNSKSALFWKSNGLSRVVLAREVTMDELSLLMPKVKDKVE
                     IEYFIHGAVCIAFSGRCMMSNNWSLRDANVGGCAQSCRWRYELKDDKQQHHSDSFTMS
                     PKDMALIDEIKQLMELGVASFKVEGRMKSINYVATVIRSYRYAMDYYLANGFNTNKED
                     EKVILDQVKQDLKSAENRPTNKGFAHNQPGIDAMLYHEEERKISQTFAFIVDEIQDDG
                     YIKVTCKNNFKKAQEYIIYGPNFKIDQVKITSLLNKNKEVVEVANDPMSTYYLKFDQH
                     YDLIKNSIGHIKKTLDY"
     misc_feature    157844..159028
                     /locus_tag="MGF_0924"
                     /note="putative protease; Provisional; Region: PRK15452"
                     /db_xref="CDD:237969"
     misc_feature    157853..158893
                     /locus_tag="MGF_0924"
                     /note="Collagenase and related proteases
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0826"
                     /db_xref="CDD:223896"
     gene            complement(159085..159339)
                     /gene="rpsT"
                     /locus_tag="MGF_0935"
                     /db_xref="GeneID:12396461"
     CDS             complement(159085..159339)
                     /gene="rpsT"
                     /locus_tag="MGF_0935"
                     /note="MGF_0935"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S20"
                     /protein_id="YP_005880416.1"
                     /db_xref="GI:385325979"
                     /db_xref="GeneID:12396461"
                     /translation="MANIKANEKSYRQNQKTNLLTKGFKTSLKNQLKKTKVSKDKKDV
                     EQVYSLADKLAKNNRISKNKARRLKSRAARWSNSATAASR"
     misc_feature    complement(159097..159339)
                     /gene="rpsT"
                     /locus_tag="MGF_0935"
                     /note="Ribosomal protein S20; Region: Ribosomal_S20p;
                     cl00384"
                     /db_xref="CDD:260396"
     gene            159416..160075
                     /locus_tag="MGF_0936"
                     /db_xref="GeneID:12396462"
     CDS             159416..160075
                     /locus_tag="MGF_0936"
                     /note="MGF_0936"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880417.1"
                     /db_xref="GI:385325980"
                     /db_xref="GeneID:12396462"
                     /translation="MNSSFLFIVLLVIIPIGLISYVIYKRKKSKEPGQFSGKTKEERR
                     NEVWKTIKRYLQDNEMYGREIMYSFVAKRPSPNDDRKLHKQFKEETKQYLLEHKLSKK
                     DKKQYLDNRKKEMARERYCIYFQTKDARTQATFDPAIIEAEVLTLPAKSKRDVPERKI
                     QINGLQDFQKEFSWIEPLKNKEDARLKKAEDERLRKLEIKERKKAAKLAKKEAKAKKK
                     I"
     gene            160082..161029
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /db_xref="GeneID:12396463"
     CDS             160082..161029
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /EC_number="2.1.2.9"
                     /note="MGF_0941"
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_005880418.1"
                     /db_xref="GI:385325981"
                     /db_xref="GeneID:12396463"
                     /translation="MNKKKVIFFGTTELSLACLKELLADNFFNVVAIICPPDRVNLNN
                     KKNKLNAVKQYCFDHRLTIYQPEKLSEFYDQLAQMEFDLGVCIAYGQFIPKKVIDLFS
                     DGILNVHPSKLPLLRGGAPIHHAIINGFESTAISIMKLDEKMDHGPVYDQLEIKINPE
                     WNHDDLNQEIIVKSPAFLIKTIKNIYETNLQPKEQNHERFTLGLNIKKEQEHLNLNLD
                     AKSFVNWQKGLWSTPGGYLDYDNQRVKIAACHLVENNREHNDDLVGTIYQIDSSGIYV
                     YLKQGSIAITKYLMPSKKVVDIKQAINGKVPFKLNSKFN"
     misc_feature    160091..161026
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    160091..160699
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    order(160109..160111,160121..160126,160337..160360,
                     160373..160375,160400..160411,160433..160435,
                     160493..160495,160499..160504,160511..160516)
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    order(160112..160117,160121..160123,160187..160189,
                     160199..160201,160205..160216,160340..160351,
                     160400..160402,160406..160411,160433..160441,
                     160694..160696)
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    order(160337..160339,160346..160348,160352..160360,
                     160373..160375,160400..160402,160499..160504,
                     160511..160516)
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    order(160400..160402,160406..160408,160514..160516)
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    160706..160975
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    order(160775..160777,160808..160810,160814..160816,
                     160946..160948,160952..160954,160958..160963,
                     160967..160969)
                     /gene="fmt"
                     /locus_tag="MGF_0941"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            161035..163185
                     /locus_tag="MGF_0942"
                     /db_xref="GeneID:12396464"
     CDS             161035..163185
                     /locus_tag="MGF_0942"
                     /note="MGF_0942"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880419.1"
                     /db_xref="GI:385325982"
                     /db_xref="GeneID:12396464"
                     /translation="MEKKQIFKKTDFLNTFNRPKSLWKFSNTELLAIIQNELGLSKDD
                     YVDLIDQLENENSSVIDFDEIDFITDELNQEESKNIYLNEVSKIKVKAKEYIKRRVLF
                     QEIDYANLEEDNLKFVDGVFNESQIKYTDVFDLQEDKKALRIIDLADYQKTPLITAID
                     LHEIIKKHDYNEAKLLILDGIYFNEKSQYFLQANIDCCLFERHKNGKIKATVYSLKNS
                     TTTKRKDIVVFYYDYRVLAELGYEVVEWNVVLIKYTLSKKNGVEFTTTNTVCHSKNSA
                     AFPEKLKESNFFSKSLIENKASFKRSGYEKLALDYPELKPNNTSFGDLLDILLFNVKE
                     SDNKKTYNFVAEQMSVVKNAFDNVFDQMMQIKETNIGKIVLSNAYFNQFADNVHGTII
                     KYTLGKKVFEPFLLSGNVYKVAKFFNENNQLDFPLVNQNNEPFSITNFMNYVSNNADT
                     LKPVNYFNTLNKVYGSKPIDYFVFDEAKIAFSKLKPKKVYFDFESICHLFAPMDDLLP
                     NMQIVTQNSYIIDNNDSKKLECFNDVMDPCKLDVNWFAKIINDLHQGEDYSYVVYNKS
                     FEKSRLYEMAYYLERYKQYHPQQFLDQKNLDVDFLKKVKEINNNLFDLADFFNLSKKL
                     LVIRSLNGFYSIKKTLLLTSSEHRKKAKAVDYATLNVKRGDMAQNLTAKRFLGLLSDQ
                     EWEQIAIDLATYCENDVRSMIAVEYYIRDLLKAN"
     misc_feature    162499..162939
                     /locus_tag="MGF_0942"
                     /note="Domain of unknown function(DUF2779); Region:
                     DUF2779; pfam11074"
                     /db_xref="CDD:256278"
     gene            163229..163717
                     /locus_tag="MGF_0951"
                     /db_xref="GeneID:12396465"
     CDS             163229..163717
                     /locus_tag="MGF_0951"
                     /note="MGF_0951"
                     /codon_start=1
                     /transl_table=4
                     /product="beta-galactosidase-like protein"
                     /protein_id="YP_005880420.1"
                     /db_xref="GI:385325983"
                     /db_xref="GeneID:12396465"
                     /translation="MIYDKLENFDKYLSVNKYFPRIRAFLEQHNYDLSHLRVGIHEID
                     GMDLYLNVLDSIVYLNTEARYELHHKYGDVHLVFNPGEIYFSQHAEDAKNMKVEIPYN
                     ETKDVTFYISDTTKDGVSHNRLVPSKNSFVVFLPGDLHAPRVSEQPSNNIIKYIFKFR
                     CS"
     misc_feature    163229..163702
                     /locus_tag="MGF_0951"
                     /note="Domain of unknown function (DUF386); Region:
                     DUF386; cl01047"
                     /db_xref="CDD:260763"
     gene            163708..165738
                     /locus_tag="MGF_0955"
                     /db_xref="GeneID:12396466"
     CDS             163708..165738
                     /locus_tag="MGF_0955"
                     /note="MGF_0955"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880421.1"
                     /db_xref="GI:385325984"
                     /db_xref="GeneID:12396466"
                     /translation="MFIRKIFRLISFFFISLLGLFNLNIGLIKENKIVDYKQSLHAEN
                     LTNNADFFYDDLNQTAQAKTIKIFLTDSDYQSVLSSLMLTQYFLNDDIVDDKNSPVVF
                     LYQQQLVNDIDFSINVASNITNWFQNNYPQNQGLIETNNSTIFANNTNISYTSANVLT
                     FLDLIRIYFHNQYINDPQLVNKPLLFDIFISPQLLATIWDNQSLMLYNFLPYLNKFHV
                     IANTNYLKTVFFRNYAQLINNNLINFNPQQVLINYQDDFKKIFVNAKRHLESNTNNNN
                     GFNDDSRDQISLDTFKKTPLYQLVYNQEKFLFYDGVSYQLNNTQVSDTLRLNVRFYQK
                     IYELFFNAKRLMLDPTKVPLLIKQYLNIFLVTDQYNVSDYIYKNRTDFDINKKTFVFL
                     EPLAPSKLNLNELNSSNTITNTKFDEYKSILATFRKIYPHDRYNFIYLTNVNFDGFKN
                     RFDSFQQLLELNDAKIIYTKPISGYFFFYELWNEYQRNIRSNVDSSIILGGVDYNDDN
                     VLEAYDFLTTNTSTRTEQSNLIARNINNFPVPLTFLINDFEPGVLNPPAQYFLLNSSY
                     ITVVQGLINETLNTNQAVNLIGSKRFFDDNNYTSYDPIQAYNRIISQERREISNQATI
                     PIILVVFFVLLIGLVGIMMIFIIYNYKKLRRAQKSWSAYIAKFRKEEDNNHA"
     gene            165698..166435
                     /locus_tag="MGF_0966"
                     /db_xref="GeneID:12396467"
     CDS             165698..166435
                     /locus_tag="MGF_0966"
                     /note="MGF_0966"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880422.1"
                     /db_xref="GI:385325985"
                     /db_xref="GeneID:12396467"
                     /translation="MLSLEKKRITTMPRKHLIANQINKKQQSNAKLWQKLAKEIKAAV
                     KVGGTDPETNYRLKAAIDKALTYNLSKDSINRNIYGNSNKEDDQLIEAEYEIYGPGGL
                     GIIVRTLSDNPNRVISSLNGYISKLKGSLAKPNSVKINFQEQGIILTDLNNYHDEALL
                     ELLIDYELIDINSDEEGYEIITVPNAYYEVKKKLEAAGFKIHHSELKLIPLLYVQLTP
                     EQNEMFERFSASCENDDDIQWIVANNQ"
     misc_feature    165731..166426
                     /locus_tag="MGF_0966"
                     /note="hypothetical protein; Provisional; Region:
                     PRK12378"
                     /db_xref="CDD:237084"
     gene            166470..166544
                     /gene="trnN"
                     /locus_tag="MGF_tRNA01"
                     /db_xref="GeneID:12396468"
     tRNA            166470..166544
                     /gene="trnN"
                     /locus_tag="MGF_tRNA01"
                     /product="tRNA-Asn"
                     /note="MGF_tRNA01; anticodon:GTT; Asn-tRNA; predicted with
                     tRNAscan-SE v., cove score=94.49"
                     /db_xref="GeneID:12396468"
     gene            166549..166625
                     /gene="trnE"
                     /locus_tag="MGF_tRNA02"
                     /db_xref="GeneID:12396469"
     tRNA            166549..166625
                     /gene="trnE"
                     /locus_tag="MGF_tRNA02"
                     /product="tRNA-Glu"
                     /note="MGF_tRNA02; anticodon:TTC; Glu-tRNA; predicted with
                     tRNAscan-SE v., cove score=64.94"
                     /db_xref="GeneID:12396469"
     gene            166739..166814
                     /gene="trnV"
                     /locus_tag="MGF_tRNA03"
                     /db_xref="GeneID:12396470"
     tRNA            166739..166814
                     /gene="trnV"
                     /locus_tag="MGF_tRNA03"
                     /product="tRNA-Val"
                     /note="MGF_tRNA03; anticodon:TAC; Val-tRNA; predicted with
                     tRNAscan-SE v., cove score=88.31"
                     /db_xref="GeneID:12396470"
     gene            166816..166891
                     /gene="trnT"
                     /locus_tag="MGF_tRNA04"
                     /db_xref="GeneID:12396471"
     tRNA            166816..166891
                     /gene="trnT"
                     /locus_tag="MGF_tRNA04"
                     /product="tRNA-Thr"
                     /note="MGF_tRNA04; anticodon:TGT; Thr-tRNA; predicted with
                     tRNAscan-SE v., cove score=91.94"
                     /db_xref="GeneID:12396471"
     gene            166896..166971
                     /gene="trnK"
                     /locus_tag="MGF_tRNA05"
                     /db_xref="GeneID:12396472"
     tRNA            166896..166971
                     /gene="trnK"
                     /locus_tag="MGF_tRNA05"
                     /product="tRNA-Lys"
                     /note="MGF_tRNA05; anticodon:CTT; Lys-tRNA; predicted with
                     tRNAscan-SE v., cove score=78.4"
                     /db_xref="GeneID:12396472"
     gene            166976..167061
                     /gene="trnL"
                     /locus_tag="MGF_tRNA06"
                     /db_xref="GeneID:12396473"
     tRNA            166976..167061
                     /gene="trnL"
                     /locus_tag="MGF_tRNA06"
                     /product="tRNA-Leu"
                     /note="MGF_tRNA06; anticodon:TAG; Leu-tRNA; predicted with
                     tRNAscan-SE v., cove score=72.27"
                     /db_xref="GeneID:12396473"
     gene            167511..167777
                     /locus_tag="MGF_0977"
                     /db_xref="GeneID:12396474"
     CDS             167511..167777
                     /locus_tag="MGF_0977"
                     /note="MGF_0977"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880423.1"
                     /db_xref="GI:385325986"
                     /db_xref="GeneID:12396474"
                     /translation="MDTTRIVFITLSTLALVICLVFWGSSFYMFWKRYRIRRTTYDGA
                     FGKTISDKEMKLTWWQKNGGYLLFISGLMILLFSVAGFVSLTNL"
     gene            167835..170507
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /db_xref="GeneID:12396475"
     CDS             167835..170507
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /EC_number="2.7.1.69"
                     /EC_number="2.7.1.-"
                     /note="MGF_0979"
                     /codon_start=1
                     /transl_table=4
                     /product="PTS system glucose-specific transporter subunit
                     IIABC"
                     /protein_id="YP_005880424.1"
                     /db_xref="GI:385325987"
                     /db_xref="GeneID:12396475"
                     /translation="MASTTNQVHSQKRSSERWKRFSGHFKEVVGKLSAGIMIPIALLP
                     IAGLLLGIFAAIQNNVSQATHPGVFAMAAFFKNGAEAVFGNLPTLFAIAIAVAFTNQS
                     GVAALSAFVGWLIFNATQTALIFPANSQTFTILYYNNVPATALAMNLGLRSLSTSVFG
                     GVIVGAITALLFNKFHTIQLPKVVGFFNGNRFVPIITLLTMLPVALVALMIWPAIGIG
                     LNALGQSLGVLSRNGNFNSLIFGYVERALVPFGLHHAFYAPLWFTSAGGSIANIIVNQ
                     AGSDAIAPLIVTDENGQRVIRSIVGVAANKDAVKPAGFTAQNWMYWGQVVTALNPNTQ
                     INTDSLSGDQRLWFTINSLFVNKSVYLSGSSDPYTFTFKSFADSTLNHPSLIQSITRN
                     GTVISGAQLLKMVNESSTGSVVLQANDTLNFAFPGVNPGQYEQGKHAFMIFGLPAAGA
                     AMIMAAPKDQRKYASSIIISAAFTSFLTGITEPIEFTFLFLAPYLFWGFHAVFCAISF
                     WLTSLLGGNIGQTFSGGIIDLTIYGFIPDALGAKTNSWLPLVIGLFYIPLYYFTFYFL
                     ITKRNIETPGRGTGTRLYTKADYQAKVASKNAASRSDGSANFKPIEITSYKLIKAFGG
                     RDNISAVNACATKLRVSVKTKEKVNFGEIGALGSLGTYAVSDTLVHAVYGGDADIIKS
                     YMQKMINKDYDSSAIEKVIGDPATKEIDPSMPKATPEVDHKLSDVVDVYSPVKGTVTD
                     LADLPDPSFAGKIMGDGVSIEPLDGMFYSPVDGKLELAYDTGHAYFFDVNGAKILIHI
                     GIDTVSLNSNNSDSNNLVGFKMFAKSGDNVSFKKSPVVQANLEMIKKKELSTNSPILA
                     LKETLANYDLKVVVKPGDKVNVGDLLFKLTKKNK"
     misc_feature    167889..169568
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    167907..169898
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="PTS system, glucose-specific IIBC component;
                     Region: PTS-II-BC-glcB; TIGR02002"
                     /db_xref="CDD:233681"
     misc_feature    169668..169907
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="Phosphotransferase system IIB components
                     [Carbohydrate transport and metabolism]; Region: PtsG;
                     COG1264"
                     /db_xref="CDD:224184"
     misc_feature    169731..169751
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    169734..169736
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     misc_feature    170001..170498
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="Phosphotransferase system IIA components
                     [Carbohydrate transport and metabolism]; Region: NagE;
                     COG2190"
                     /db_xref="CDD:225101"
     misc_feature    order(170070..170081,170091..170096,170160..170165,
                     170169..170174,170190..170198,170211..170219,
                     170223..170225,170235..170237,170241..170246,
                     170304..170306)
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="HPr interaction site; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(170070..170072,170076..170081,170085..170087,
                     170091..170096,170163..170165,170169..170171,
                     170181..170183,170217..170219,170223..170225,
                     170235..170237,170241..170246,170250..170252)
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="glycerol kinase (GK) interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238128"
     misc_feature    order(170175..170177,170181..170183,170223..170225,
                     170229..170231)
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="active site"
                     /db_xref="CDD:238128"
     misc_feature    170223..170225
                     /gene="ptsG_1"
                     /locus_tag="MGF_0979"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238128"
     gene            170595..172082
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /db_xref="GeneID:12396476"
     CDS             170595..172082
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /EC_number="1.2.1.-"
                     /note="MGF_0998"
                     /codon_start=1
                     /transl_table=4
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="YP_005880425.1"
                     /db_xref="GI:385325988"
                     /db_xref="GeneID:12396476"
                     /translation="MSNSECIKKKVCNASSYDFKDKYHHLKGLINNQEVGSSKLIEIK
                     SPIDHELSGSFYGMTAEEIDDAYEKADIAFKSWSKAGYEYRKAKILKFAQLLDAHKEE
                     FANLLTDNIAKAYNESLAEVTRSIQYIHDTISVYEEMIAHPLVMDEKIHHVKEKVGKF
                     VREPLGVALNISPWNYPLNTPLSKMIPTLIAGNTVVYKVATQAAIIGIRLAHLFKQAG
                     FDPGVVQCVVGLGREIGDKLNTNKHIKSISFTGSTPVGLSLLKQSAVGNISLELGGKD
                     AALVLSDYDKQKTIKEIVKGAYSYSGQRCTAIKRVFVKNEDADEFVQLLKKEVEKLHL
                     GNPFNNPSLVPVIDQHAANFIKELFDDAVAKKAVVLTGGDFEKNCVEAILLDHVTTDM
                     RVAWEEPFGPILPIIRVKNEAEMVKLHNQSEYGLQASIFTSDQTKFDELANQLEAGTI
                     NWNRSSSRGPDFFPFMGVKDSGVGVQGIKDTILSVTRYKGFVYNR"
     misc_feature    170667..172076
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="NADP+-dependent non-phosphorylating glyceraldehyde
                     3-phosphate dehydrogenase and ALDH family 11; Region:
                     ALDH_F11_NP-GAPDH; cd07082"
                     /db_xref="CDD:143401"
     misc_feature    order(170826..170831,170835..170843,170985..170987,
                     170994..170999,171003..171008,171015..171029,
                     171033..171035,171075..171077,171081..171083,
                     171372..171374,171387..171389,171408..171410,
                     171891..171893,171897..171905,171909..171914,
                     171918..171923,171927..171929,171933..171950,
                     171954..171956,171975..171980,171984..171986,
                     171990..171992,172008..172010,172029..172034,
                     172053..172055,172059..172076)
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="tetrameric interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143401"
     misc_feature    order(170829..170831,170847..170849,171075..171080)
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="activator binding site; other site"
                     /db_xref="CDD:143401"
     misc_feature    order(171105..171116,171186..171188,171192..171197,
                     171285..171287,171300..171302,171339..171341,
                     171345..171350,171357..171359,171786..171788)
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:143401"
     misc_feature    order(171117..171122,171504..171512,171966..171971)
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143401"
     misc_feature    order(171117..171119,171405..171407,171498..171500,
                     171507..171509)
                     /gene="putA"
                     /locus_tag="MGF_0998"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143401"
     gene            172151..172459
                     /gene="rpmE"
                     /locus_tag="MGF_1010"
                     /db_xref="GeneID:12396477"
     CDS             172151..172459
                     /gene="rpmE"
                     /locus_tag="MGF_1010"
                     /note="MGF_1010"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L31"
                     /protein_id="YP_005880426.1"
                     /db_xref="GI:385325989"
                     /db_xref="GeneID:12396477"
                     /translation="MKKDIHPTLNKVSFLCSSCNNKFILLSVIKAKEVHMDVCSKCHS
                     FYIGETTQQVVKGRAEKLSSKFNQGKAHISKKAEANSAKPQAKTTKRSNDKAKSLKDL
                     "
     misc_feature    172151..172366
                     /gene="rpmE"
                     /locus_tag="MGF_1010"
                     /note="50S ribosomal protein L31; Reviewed; Region: rpmE;
                     PRK00019"
                     /db_xref="CDD:234576"
     gene            172541..173623
                     /gene="prfA"
                     /locus_tag="MGF_1014"
                     /db_xref="GeneID:12396478"
     CDS             172541..173623
                     /gene="prfA"
                     /locus_tag="MGF_1014"
                     /note="MGF_1014"
                     /codon_start=1
                     /transl_table=4
                     /product="Peptide chain release factor 1"
                     /protein_id="YP_005880427.1"
                     /db_xref="GI:385325990"
                     /db_xref="GeneID:12396478"
                     /translation="MEYNKQMYETLVAIRATAQKLNKELESLTNDFKRIHAINKELKQ
                     KKQLLEVFELYDKLVVSGLEAEKIINDNTMKEFHELAILDLDAAKEQIPDLEEKLKVL
                     LLPADPNDDKEVIVEMRPAAGGDESSIFVGNMFDLYKEYCSKHNWKINVIEMLPTSVG
                     YSFISFEINGEDVYSKMKFESGVHRVQRVPATEAKGRVHTSTITIAVLPQQDDVEIEI
                     NPADLRIDTYRASGAGGQHVNRTESAVRITHIPTGIVAACQEGKSQIANRETAMKMLR
                     SKLWEAAEKEKNDALSALRKNQVGSGDRAEKIRTYNYPQNRVTDHRINMSLNSLDRFM
                     MGEIDEMIDALRSKEQEEKMKLIMNE"
     misc_feature    172550..173605
                     /gene="prfA"
                     /locus_tag="MGF_1014"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     misc_feature    172766..173080
                     /gene="prfA"
                     /locus_tag="MGF_1014"
                     /note="PCRF domain; Region: PCRF; pfam03462"
                     /db_xref="CDD:251973"
     misc_feature    173165..173506
                     /gene="prfA"
                     /locus_tag="MGF_1014"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            173628..174482
                     /gene="hemK"
                     /locus_tag="MGF_1025"
                     /db_xref="GeneID:12396479"
     CDS             173628..174482
                     /gene="hemK"
                     /locus_tag="MGF_1025"
                     /EC_number="2.1.1.-"
                     /note="MGF_1025"
                     /codon_start=1
                     /transl_table=4
                     /product="HemK-like methylase"
                     /protein_id="YP_005880428.1"
                     /db_xref="GI:385325991"
                     /db_xref="GeneID:12396479"
                     /translation="MTFHELINYLTNNYSKYQEKYSWSFFLLIKHYSEKIENKTDLIT
                     LRNEEIDFNFDQFIKDCNRIYKDEYPVEYIINQIEINGLKLFVDETVLIPRIDTNAVI
                     EKFLEVINLRKDIVNVLDICTGTGLIALTIKKQFPKYQVFGSDISKSAVKIANFNAVN
                     NLLDARFYVADYLEVFEQVSEEIDALIINPPYLDEELKSNYIKEINYEPFNALFAKNG
                     GTFFYEEIFRYLTTNKTKIKVLCMEFSEPIYEKTVQLLKKYGLYDKTAFFNDANDKLR
                     GFIIEWKF"
     misc_feature    173703..174455
                     /gene="hemK"
                     /locus_tag="MGF_1025"
                     /note="protein-(glutamine-N5) methyltransferase, release
                     factor-specific; Region: RF_mod_PrmC; TIGR03534"
                     /db_xref="CDD:234248"
     misc_feature    173976..>174203
                     /gene="hemK"
                     /locus_tag="MGF_1025"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(173988..174008,174060..174065,174135..174143,
                     174192..174194)
                     /gene="hemK"
                     /locus_tag="MGF_1025"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            174470..175018
                     /locus_tag="MGF_1029"
                     /db_xref="GeneID:12396480"
     CDS             174470..175018
                     /locus_tag="MGF_1029"
                     /note="MGF_1029"
                     /codon_start=1
                     /transl_table=4
                     /product="Putative translation factor/ribosome maturation
                     factor (Sua5)"
                     /protein_id="YP_005880429.1"
                     /db_xref="GI:385325992"
                     /db_xref="GeneID:12396480"
                     /translation="MKVLEFERDFDEIVKAINDDKLVILPTDTVFGVICKSKNKIYDF
                     KKRDLNKKLIYFCSDVEQTNINDKLFLDLANRFWPGKLTLIYNKESYRIPNSPYILKI
                     AKICGKIYSSSANISNLNPYKTWEQYYNDSYFNQNNDVVLIRGETTSEQGSTIYDLDS
                     NKILREGELSQSLKEFLANRSK"
     misc_feature    174482..175009
                     /locus_tag="MGF_1029"
                     /note="Putative translation factor (SUA5) [Translation,
                     ribosomal structure and biogenesis]; Region: SUA5;
                     COG0009"
                     /db_xref="CDD:223088"
     gene            175110..175580
                     /gene="rpiB"
                     /locus_tag="MGF_1032"
                     /db_xref="GeneID:12396481"
     CDS             175110..175580
                     /gene="rpiB"
                     /locus_tag="MGF_1032"
                     /EC_number="5.3.1.26"
                     /note="MGF_1032"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribose 5-phosphate isomerase"
                     /protein_id="YP_005880430.1"
                     /db_xref="GI:385325993"
                     /db_xref="GeneID:12396481"
                     /translation="MDKRKIIFVADHTGVFLKQELISMLKTEYHNQYEVIDLGSDDEK
                     SADDYPDFAFMLEDYFKDENTRNIGVAICGTGVGICIAANKIKNVRAGLVTDVQYAEL
                     AIQHDNCNVLVLGARTTSIDVNKEILRKFLSAQFEGGRHQRRVDKISNYEKKQD"
     misc_feature    175122..175571
                     /gene="rpiB"
                     /locus_tag="MGF_1032"
                     /note="ribose-5-phosphate isomerase B; Provisional;
                     Region: PRK05571"
                     /db_xref="CDD:235509"
     gene            175516..176064
                     /locus_tag="MGF_1034"
                     /db_xref="GeneID:12396482"
     CDS             175516..176064
                     /locus_tag="MGF_1034"
                     /note="MGF_1034"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880431.1"
                     /db_xref="GI:385325994"
                     /db_xref="GeneID:12396482"
                     /translation="MKVVDTKEEWIKLVTMKKNKIKDPLKANYFKLDLVPAEFKPSRK
                     KSYIYFGIAIAVLLLSLVFVGLSAAPYVEILNRDVTQAEFVNAVETNGFFTRIYTPDN
                     STIVQPGTVGLDITPLVRSSNVPNIVATIRIAIGAVSIFLFVLFIILIIVSYMYFLGS
                     IKAIDKPTKPYVTEPTIQTKKV"
     gene            176111..176635
                     /gene="recU"
                     /locus_tag="MGF_1036"
                     /db_xref="GeneID:12396483"
     CDS             176111..176635
                     /gene="recU"
                     /locus_tag="MGF_1036"
                     /note="MGF_1036"
                     /codon_start=1
                     /transl_table=4
                     /product="Holliday junction resolvase recU (Recombination
                     protein U-like protein)"
                     /protein_id="YP_005880432.1"
                     /db_xref="GI:385325995"
                     /db_xref="GeneID:12396483"
                     /translation="MHQNRGMFLETLINNTIKHNELAHKGLIFKRHLPINVYNFANRR
                     VAGWLKEKTQTDYYGLYKGHFFDFDAKQSSKINYSLKNIKQHQLDHLRKIHQQGGIAF
                     ILLLIVPKEEFYMIPIEKIDFWLKNQESNTLKYEWIQKSSFKLELFYPGVIGIFEALQ
                     EWIDLITLRRSGGS"
     misc_feature    176120..176590
                     /gene="recU"
                     /locus_tag="MGF_1036"
                     /note="Recombination protein U; Region: RecU; pfam03838"
                     /db_xref="CDD:252197"
     gene            complement(176607..176978)
                     /gene="himA"
                     /locus_tag="MGF_1040"
                     /gene_synonym="hup_1"
                     /db_xref="GeneID:12396484"
     CDS             complement(176607..176978)
                     /gene="himA"
                     /locus_tag="MGF_1040"
                     /gene_synonym="hup_1"
                     /note="MGF_1040"
                     /codon_start=1
                     /transl_table=4
                     /product="Histone-like DNA-binding superfamily protein
                     HimA/HU/Integration host factor"
                     /protein_id="YP_005880433.1"
                     /db_xref="GI:385325996"
                     /db_xref="GeneID:12396484"
                     /translation="MLTKSEICKIIAECTGVSPKLVKACFQVYSDLVKKEIKSQGQVR
                     LPELGTFRVTIGRERISVNPITGAQTRIPPKPKVKFRAAKPLKEVTATIKWKYVSEDD
                     ELLQPKRKAAGFFKNRQNDEE"
     misc_feature    complement(176715..176969)
                     /gene="himA"
                     /locus_tag="MGF_1040"
                     /gene_synonym="hup_1"
                     /note="DNA sequence specific (IHF) and non-specific (HU)
                     domains; Region: HU_IHF; cd00591"
                     /db_xref="CDD:259852"
     misc_feature    complement(order(176718..176720,176727..176744,
                     176748..176750,176754..176756,176808..176813,
                     176817..176819,176829..176831,176835..176837,
                     176841..176849,176853..176855,176964..176969))
                     /gene="himA"
                     /locus_tag="MGF_1040"
                     /gene_synonym="hup_1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259852"
     misc_feature    complement(order(176718..176723,176733..176735,
                     176739..176741,176745..176753,176835..176837,
                     176844..176858,176868..176873,176877..176885,
                     176889..176897,176901..176912,176937..176939,
                     176946..176951,176958..176960))
                     /gene="himA"
                     /locus_tag="MGF_1040"
                     /gene_synonym="hup_1"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259852"
     gene            177118..177567
                     /locus_tag="MGF_1041"
                     /db_xref="GeneID:12396485"
     CDS             177118..177567
                     /locus_tag="MGF_1041"
                     /note="MGF_1041"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880434.1"
                     /db_xref="GI:385325997"
                     /db_xref="GeneID:12396485"
                     /translation="MSHKLSEEQKKETEYQANVEKAITAFNTLFTKEANKFDFIKSVY
                     ENDGVANMEYPRQKLNELMDLIINEPTKHYARNFFINTCLTKITAYEEIEDVLSLFKK
                     NKQILDKFCLYYLLFKQSFNFDDSERSKITKILSNIARELIEVLDLN"
     misc_feature    177175..177564
                     /locus_tag="MGF_1041"
                     /note="Domain of unknown function (DUF1951); Region:
                     DUF1951; pfam09188"
                     /db_xref="CDD:117742"
     gene            177570..177779
                     /locus_tag="MGF_1043"
                     /db_xref="GeneID:12396486"
     CDS             177570..177779
                     /locus_tag="MGF_1043"
                     /note="MGF_1043"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880435.1"
                     /db_xref="GI:385325998"
                     /db_xref="GeneID:12396486"
                     /translation="MARRDKGINLIILIVLLILGIVPGILYALFKFFVPPFSWVIFAI
                     LLLLFVFPAIIYLLTCSDVVVFSRI"
     gene            177952..178461
                     /gene="rplJ"
                     /locus_tag="MGF_1045"
                     /db_xref="GeneID:12396487"
     CDS             177952..178461
                     /gene="rplJ"
                     /locus_tag="MGF_1045"
                     /note="MGF_1045"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_005880436.1"
                     /db_xref="GI:385325999"
                     /db_xref="GeneID:12396487"
                     /translation="MNFKYTMKAIIQKKIEHVNKIAGLLKEAKSFVVFEYSTMTAKAI
                     TALRRKVKTSANQMFVLKNNILKRAIKEAGIDGFDDDIKNQIAVVIGLEDAFLPIKAV
                     HEYVTANEKVKYVCGYLENKKLSAAELSEIAVLPSRDELYSMFLSVLQAPVGKFMYAL
                     KAVADTKQQ"
     misc_feature    177979..178449
                     /gene="rplJ"
                     /locus_tag="MGF_1045"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    order(177991..177996,178003..178005,178135..178146,
                     178153..178155)
                     /gene="rplJ"
                     /locus_tag="MGF_1045"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(178237..178239,178306..178308,178315..178317,
                     178363..178365,178372..178377,178384..178389,
                     178393..178410,178414..178422,178429..178434,
                     178438..178443,178447..178449)
                     /gene="rplJ"
                     /locus_tag="MGF_1045"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            178501..178866
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /db_xref="GeneID:12396488"
     CDS             178501..178866
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="MGF_1048"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_005880437.1"
                     /db_xref="GI:385326000"
                     /db_xref="GeneID:12396488"
                     /translation="MAKLTKEQFIESLKEMTIVEINDVIKAIEEAFGVSAAAPVAAAA
                     AAPAAAAPTEATVVLVSAGDKKVEVIKLVREVTGLGLMDAKKAVDTPPATIKENMNIE
                     EAKALKAKFEAVGAKVDLK"
     misc_feature    178510..178860
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    order(178510..178512,178549..178557,178564..178569,
                     178576..178578,178585..178587,178621..178629,
                     178657..178662,178723..178725,178729..178734,
                     178738..178740,178744..178749,178789..178794,
                     178798..178800,178807..178809)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(178519..178521,178528..178530,178540..178542,
                     178579..178581,178594..178596)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(178561..178563,178570..178575,178585..178587,
                     178594..178596)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(178696..178701,178708..178713,178720..178722,
                     178741..178746,178753..178755)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(178699..178701,178711..178713,178720..178722,
                     178741..178746,178753..178755)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(178699..178701,178708..178713,178720..178722)
                     /gene="rplL"
                     /locus_tag="MGF_1048"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            178915..179088
                     /gene="rpL32"
                     /locus_tag="MGF_1049"
                     /db_xref="GeneID:12396489"
     CDS             178915..179088
                     /gene="rpL32"
                     /locus_tag="MGF_1049"
                     /note="MGF_1049"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L32"
                     /protein_id="YP_005880438.1"
                     /db_xref="GI:385326001"
                     /db_xref="GeneID:12396489"
                     /translation="MAVQQRRSSKHRRDKRRSHDALAVNLINVCKHCGKFKRAHRACS
                     CGMYNELRITKAK"
     misc_feature    178915..179061
                     /gene="rpL32"
                     /locus_tag="MGF_1049"
                     /note="50S ribosomal protein L32; Reviewed; Region: rpmF;
                     PRK12286"
                     /db_xref="CDD:237038"
     gene            179088..179279
                     /locus_tag="MGF_1052"
                     /db_xref="GeneID:12396490"
     CDS             179088..179279
                     /locus_tag="MGF_1052"
                     /note="MGF_1052"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880439.1"
                     /db_xref="GI:385326002"
                     /db_xref="GeneID:12396490"
                     /translation="MNDNLSHKSKDLNLTSVSEVSKYQNSKIKAGLDWFSATAIILLT
                     VIGVCLGICMACLVIIHAS"
     gene            complement(179426..180601)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /db_xref="GeneID:12396491"
     CDS             complement(179426..180601)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="MGF_1063"
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone"
                     /protein_id="YP_005880440.1"
                     /db_xref="GI:385326003"
                     /db_xref="GeneID:12396491"
                     /translation="MSSKRDYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNKDSDAE
                     EKFKEVNEAYEVLSDEEKRKLYDTYGHEGLNASGFHQGGFNPYDVFNSVFSGFDFEGG
                     FGDVFSQFFGGGGSGFHNQEYIEEVDVNLVHEIKINFLEAANGCIKNVKYTRQVTCPD
                     CNGSGSADGDVITCSDCNGEGFVVEQRRTLLGMFQTKKTCPSCKGEGQTIKNKCKKCK
                     SRRMVDEVVERKVSIDSNVFYQDVVIVRGEGHIYKNLVGDLFLRVKIEPSRVFELRDN
                     HVVVNVLVDPLVAITGGTILIPTLKEIKEINLKAGTKNGDIITIANGGINLKLDSRVY
                     GANYNQKGDLIVVINYARPSEYSKQEIAKLKEFIKPNKEVNLYETLMKKELNNKNSQ"
     misc_feature    complement(179495..180586)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="chaperone protein DnaJ; Region: DnaJ_bact;
                     TIGR02349"
                     /db_xref="CDD:233829"
     misc_feature    complement(180425..180586)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(order(180446..180451,180458..180463,
                     180470..180472,180494..180502))
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    complement(179537..180214)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(179852..179854,180041..180043,
                     180143..180160,180203..180205))
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    complement(179948..180130)
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="Zinc finger domain of DnaJ and HSP40; Region:
                     DnaJ_zf; cd10719"
                     /db_xref="CDD:199908"
     misc_feature    complement(order(179951..179953,179960..179962,
                     179993..179995,180002..180004,180071..180073,
                     180080..180082,180119..180121,180128..180130))
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="Zn binding sites [ion binding]; other site"
                     /db_xref="CDD:199908"
     misc_feature    complement(order(179537..179548,179660..179671,
                     179729..179734,179741..179746))
                     /gene="dnaJ_2"
                     /locus_tag="MGF_1063"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            180956..182161
                     /locus_tag="MGF_1065"
                     /db_xref="GeneID:12396492"
     CDS             180956..182161
                     /locus_tag="MGF_1065"
                     /note="MGF_1065"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880441.1"
                     /db_xref="GI:385326004"
                     /db_xref="GeneID:12396492"
                     /translation="MLKKILKWFLLASFVAVPLSSCTNKNKKEMVSNSPPNMDPGNTS
                     GTNENNNPREPLPPINRSEGMKSEDKSGKMEADRSSDSSNETKSLQLSLKSKAVIASD
                     LVTQASGGYSLNWSKFMTNLNSEEQTNSRLLNLIVDDREGQISFDLQVGGNQKLSFKE
                     KVDFDFQFLKALTFNWTDTKPTTTNSSLTQLQKVTNAQGLSEFATPVLSVASDDSTNY
                     FTYLSDWFDVNLTYVSVDKKLEQNDLTFDYQLTINPNKRSFYQIENNSKQPQLWHSDE
                     DRTVLSYPSDLSKAAADVIINKTSELFDKPIDYFYDTTNHTVKTDQLEVTARNNGLIK
                     FSNSKYNDQFAITLVQNSASFNTDRNELTFTVEIKPKDSNEFNSMGGIGRTFTITTYR
                     WTISTLPMN"
     gene            182296..184428
                     /locus_tag="MGF_1075"
                     /db_xref="GeneID:12396493"
     CDS             182296..184428
                     /locus_tag="MGF_1075"
                     /note="MGF_1075"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880442.1"
                     /db_xref="GI:385326005"
                     /db_xref="GeneID:12396493"
                     /translation="MNTGYSQIDKQEKANKLFGKTAIAKAIWIVCLPGLLAAFFAGLY
                     SFFDQILIQKLVPEVWKLNDVYNGLHFSNINVYQRVFDQIFVNDAIVRVPNIYFFDNG
                     YYQASVSQPVPIGYFNSDFIKIFGEQVRSQPIITLDKNVLAQSINNYQILDNIVLLFK
                     NVYNSQIGAVGDNTSQLSNVSIIARQAVNSFQNILLIGNAAIYLVPIGAGVYYTKSIS
                     YKYEKTGRDIWVMSFWTTLILCLIASLICFIIVGAGVQRSLIGTANLSPRVISLLDHN
                     NANEIVSRINNVDLDSLNGVNFVNYPKVILTYDDAMADISALWADQYSWIYASGFFFI
                     GLFSLLSFMIRSEGRNIFVTVASIIANVTNVLLDFIFIKYFSLGLIGGATASVISWVV
                     NLILYVGFVMYFNKKQATWLSFHDLFKVKFNIKIIIPIMILGLSSFIRIVGLTVMFLV
                     YNLLLIRVSGQDFQNYHAGSTPLLILFFVALFGISDGGRPLIGYNYTNRHYKRVHSAF
                     WWSLFVTFTYAIISYIVVFFVAKTVLVNLFNFKDPSTTPMVQPIDNADMATSYIRITM
                     LRIVMFSITICGMMLFQGTNDVIRSYISSAIEGSFISYLVFGTVYGLSTVLPKTDNLN
                     IWVYVSGYAISPFITSVVVLILSILFLRRNLNVKNETIERKMNRLDLMQYNFFINEAK
                     KYNLLTPQQQHELVKLKKEKQELNTNQN"
     misc_feature    <183250..184290
                     /locus_tag="MGF_1075"
                     /note="Na+-driven multidrug efflux pump [Defense
                     mechanisms]; Region: NorM; COG0534"
                     /db_xref="CDD:223608"
     misc_feature    <183253..184068
                     /locus_tag="MGF_1075"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            complement(184495..185169)
                     /gene="metG_1"
                     /locus_tag="MGF_1089"
                     /db_xref="GeneID:12396494"
     CDS             complement(184495..185169)
                     /gene="metG_1"
                     /locus_tag="MGF_1089"
                     /note="MGF_1089"
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA synthetase (MetRS) domain
                     protein"
                     /protein_id="YP_005880443.1"
                     /db_xref="GI:385326006"
                     /db_xref="GeneID:12396494"
                     /translation="MSLSEVGKRLIQETINSDLINNLGNIVHKLIPMLESRQESTILP
                     YLAGNEVEDKYLADLQKLPAEFEKLVEENDIRSAIKLVLNISKEYSSVIEVRKPWELY
                     KNNKTQELANVLFAGTCAIRTVFVLLEPILTTKSKEVYEQMNFTPEQTQLKNINNFEQ
                     LLNHKINKSKKLFQKLDVTDPNVNLKPLEQQETKTKEVKDKKAKESSKQSPKEPTKEQ
                     AKEPTK"
     misc_feature    complement(184741..185127)
                     /gene="metG_1"
                     /locus_tag="MGF_1089"
                     /note="Anticodon-binding domain of methionyl tRNA
                     synthetases; Region: Anticodon_Ia_Met; cd07957"
                     /db_xref="CDD:153411"
     misc_feature    complement(order(184873..184875,184888..184893,
                     184897..184902,185050..185055,185062..185067,
                     185074..185079,185086..185091,185098..185103,
                     185122..185124))
                     /gene="metG_1"
                     /locus_tag="MGF_1089"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153411"
     misc_feature    complement(order(184873..184875,184891..184893,
                     185050..185055,185062..185067,185074..185079,
                     185086..185091,185101..185103))
                     /gene="metG_1"
                     /locus_tag="MGF_1089"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153411"
     misc_feature    complement(185211..186087)
                     /note="MGF_1101f; Potential DnaJ-like molecular chaperone
                     gene region"
     gene            complement(185211..185513)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1095"
                     /db_xref="GeneID:12396495"
     CDS             complement(185211..185513)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1095"
                     /note="MGF_1095"
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone domain protein"
                     /protein_id="YP_005880444.1"
                     /db_xref="GI:385326007"
                     /db_xref="GeneID:12396495"
                     /translation="MFQTKKTCYSCKGEGQTIKNKCKKCKSRRMVDEVVERKVSIDSN
                     VFYQDVVIVRGEEHIYKNLVGDLFLRVKIQPSRVFELRDNHVVVNVLVDPLVAVTR"
     misc_feature    complement(185436..>185513)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1095"
                     /note="Zinc finger domain of DnaJ and HSP40; Region:
                     DnaJ_zf; cl19048"
                     /db_xref="CDD:267401"
     misc_feature    complement(<185217..185438)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1095"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(185696..186087)
                     /note="potential frameshift: common BLAST hit:
                     gi|294660272|ref|YP_003573366.1| DnaJ-like molecular
                     chaperone"
     gene            complement(185696..185824)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1099"
                     /db_xref="GeneID:12396496"
     CDS             complement(185696..185824)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1099"
                     /note="MGF_1099"
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone domain protein"
                     /protein_id="YP_005880445.1"
                     /db_xref="GI:385326008"
                     /db_xref="GeneID:12396496"
                     /translation="MFNSVFSGFDFEGGFGDVFSQFFGGGGSGFHNQEYIEELMLI"
     gene            complement(185917..186087)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1101"
                     /db_xref="GeneID:12396497"
     CDS             complement(185917..186087)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1101"
                     /note="MGF_1101"
                     /codon_start=1
                     /transl_table=4
                     /product="DnaJ-like molecular chaperone domain protein"
                     /protein_id="YP_005880446.1"
                     /db_xref="GI:385326009"
                     /db_xref="GeneID:12396497"
                     /translation="MSSKRDYYEILEVSRSATQQDIKKAFRKLAIKYHPDRIKIQMLK
                     KSSKKLMKLTRY"
     misc_feature    complement(<185977..186072)
                     /gene="dnaJ_3"
                     /locus_tag="MGF_1101"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     gene            186426..187616
                     /locus_tag="MGF_1102"
                     /db_xref="GeneID:12396498"
     CDS             186426..187616
                     /locus_tag="MGF_1102"
                     /note="MGF_1102"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880447.1"
                     /db_xref="GI:385326010"
                     /db_xref="GeneID:12396498"
                     /translation="MRKKIFKLLALSSVLAVPLSSCMDKESKSGTKDEGSESNNKKED
                     DSLSDDKKDSGGGETGESGDKSGSGDSNLNEDQKPPATDESNDNAAIELTLKSTAVVA
                     SDLINQQNGTYSLNWTKFNTNISEQKQASATLSNLTVNDREGTISFNLATNDNRTFSF
                     NQTVDFSFENLKSLNFNWTDVKQTTNDASLEQIKAVTNSEQLSEFAMPALYTSSNDHT
                     NYFPYLSKWFIVNLTHQRHSKKLEENEITFQYQLSNHQKTDFYNIKNGSSERQIWFSN
                     ENTSFLVYPSDLSRAANSLVVNTSSELFNKPIDNFYDTTDGAVKTDELERSVKNGGFV
                     KFTNNDYGTKFDISLVNSTASYNADTRELSFTVQVRSVNDDYHNSRSIQKIFRVTLGK
                     NADE"
     misc_feature    187734..189786
                     /note="MGF_1109f; Potential conserved hypothetical protein
                     gene region"
     gene            187734..188063
                     /locus_tag="MGF_1109"
                     /db_xref="GeneID:12396499"
     CDS             187734..188063
                     /locus_tag="MGF_1109"
                     /note="MGF_1109"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880448.1"
                     /db_xref="GI:385326011"
                     /db_xref="GeneID:12396499"
                     /translation="MNCLFTRLIGRFLRVYTVFFDQILIQKLVPEVWKLNDVYNDQHF
                     SNISVYQRVFNEIFKMIVLLKFLIFISLITIITKHLFLSLYQLVILIRILSRFLVNKF
                     DLNQQSL"
     misc_feature    <187791..>187913
                     /locus_tag="MGF_1109"
                     /note="alpha-mannosidase; Provisional; Region: PRK09819"
                     /db_xref="CDD:182093"
     gene            188187..189395
                     /locus_tag="MGF_1113"
                     /db_xref="GeneID:12396500"
     CDS             188187..189395
                     /locus_tag="MGF_1113"
                     /note="MGF_1113"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880449.1"
                     /db_xref="GI:385326012"
                     /db_xref="GeneID:12396500"
                     /translation="MCRYIARQAVNSLQNILLIGNAAIYLVPIGVGVYYTKVISYKYE
                     KTGRDIWVMLFWSTLILCLIASLVCFIIVGAEFQRHLIGTTNLSPNIISLLRTNNTQQ
                     IVSNINNVDNQSLNGINFTIYPKVILAYDNAMADISAHWADQHSWIYASGFFIIGLFS
                     LLSFMIRSETRNIFVTVASIVANLTNVLLDFIFIKYFSLRLIGGAAASVISWVVNLLL
                     YVGFLMYFNKKQSTWLSFADLFKVKFNIKIIIQIMILGLSSFIRIVSLTVMFLVYNLL
                     LIKVSGQDFQNYHAESVPLIILFFVALFGISDGGRPLIGYNYTNRHYKRIHSAFWWSL
                     FVTFSYAIISYIIVFFVAKTVLVNLFNFKDPSTTPMVQPIDNADMARSYIRITMLRIV
                     MFSITICGMM"
     misc_feature    <188610..189380
                     /locus_tag="MGF_1113"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     gene            189358..189786
                     /locus_tag="MGF_1120"
                     /db_xref="GeneID:12396501"
     CDS             189358..189786
                     /locus_tag="MGF_1120"
                     /note="MGF_1120"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880450.1"
                     /db_xref="GI:385326013"
                     /db_xref="GeneID:12396501"
                     /translation="MWCSQLRSVEWCSSKEKMMWFGSYVSSAIEGSFISYLVFGAVYG
                     LSTVLPKTDNLNIWVYVSGYAISPFITSVVVLILSILFFRRNLNVKSETIERKMNRLD
                     LMQYNFFVNEAKKYNLLRPQQQHELVKLEKEKQELNTNQN"
     gene            complement(189855..191648)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /db_xref="GeneID:12396502"
     CDS             complement(189855..191648)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /EC_number="6.1.1.10"
                     /note="MGF_1132"
                     /codon_start=1
                     /transl_table=4
                     /product="methionyl-tRNA synthetase"
                     /protein_id="YP_005880451.1"
                     /db_xref="GI:385326014"
                     /db_xref="GeneID:12396502"
                     /translation="MNKINKDEQTMLKNKKCYISTPIYYASGNPHIGHAYTTILGDFL
                     ARFKKQRGYDVFFLSGTDEFGKKIETKAKSLNLTPQKMVDQYSSKFKELFDLLNIELT
                     RFVRTTEPKHQEVVKKIFGLFYLKKYIYLDQWQGLYCVDCEENYTTSSVLKKADLVEK
                     TNLDLSMDPDDQLYCHVGHKISSINEPSYFIKLSEFSNFIKESLTDNVPSVFPTSRNK
                     EMLNNFVNVGLKDLSISRTSISWGIETPLNKSHRIYVWLDALFSYLTSMGFGSEDDKL
                     YQEFWNNDSSERIHLIAKEITRFHRIYWVIFLKMLGIKQPTRMISHGWILDENGNKMS
                     KSLNNIIDPIELAELFGVDQLRYYLLKELSLSEDGKVGKRLIQETINSDLINNLGNLV
                     HRLIPMLESRQESTILPYLAGNEVEDKYLADLQKLPAEFEKLVEENDIRSAIKLVLNI
                     SKEYSSVIEVRKPWELYKNNKTQELANVLFAGACAIRTVFVLLEPILTTKSKEVYEQM
                     NFTPEQTQLKNINNFEQLFNHKINKSKKLFQKLDVTDPNVKLKPLEQQETKTKEVKDK
                     KAKESTKQANKESSKQSPKQPINEQAKKTTK"
     misc_feature    complement(190023..191606)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="methionyl-tRNA synthetase; Reviewed; Region:
                     PRK11893"
                     /db_xref="CDD:237012"
     misc_feature    complement(190542..191603)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="catalytic core domain of methioninyl-tRNA
                     synthetases; Region: MetRS_core; cd00814"
                     /db_xref="CDD:173907"
     misc_feature    complement(order(190749..190751,190761..190763,
                     190860..190862,190869..190874,190881..190883,
                     191463..191465,191574..191576,191580..191585))
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="active site"
                     /db_xref="CDD:173907"
     misc_feature    complement(191547..191558)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    complement(190641..190655)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173907"
     misc_feature    complement(190125..190511)
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="Anticodon-binding domain of methionyl tRNA
                     synthetases; Region: Anticodon_Ia_Met; cd07957"
                     /db_xref="CDD:153411"
     misc_feature    complement(order(190257..190259,190272..190277,
                     190281..190286,190434..190439,190446..190451,
                     190458..190463,190470..190475,190482..190487,
                     190506..190508))
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153411"
     misc_feature    complement(order(190257..190259,190275..190277,
                     190434..190439,190446..190451,190458..190463,
                     190470..190475,190485..190487))
                     /gene="metG_2"
                     /locus_tag="MGF_1132"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153411"
     gene            complement(191668..193038)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /db_xref="GeneID:12396503"
     CDS             complement(191668..193038)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="MGF_1143"
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase EngA"
                     /protein_id="YP_005880452.1"
                     /db_xref="GI:385326015"
                     /db_xref="GeneID:12396503"
                     /translation="MLKVAIVGKPNVGKSTLFNRLIKNRIAIVDDTPGITRDRIFGDV
                     EWLTKRFQIIDTGGLTTESDIFQRAIEQQVQFAIDEADIILFVCSYKEGINADDHYAA
                     KLLKKHKNKKIIFVLNKIENQNKDQLNLSSYFSLGFGKPMIISAEHAIGIGDLLDEII
                     RLKNQFANKKEQELVATFCIIGKPNVGKSSLLNQLLKKERVLVSDIPGTTRDAIDATF
                     SYNKELYKVIDTAGIRRKGKIETRIEKFSVQRTQQAISRSKMILLMLDGSVDLSEQDE
                     VIGGLCYEANLPTIIVVNKWDLVKKDDKTMELFKKQIRSKFKYLPWSPIIFISAKANL
                     RIDTIFQTIKLIQAQLKIKISTSLLNDVVQKAHMINQPPIFNGNRLSITYTTQAQGQI
                     PTFVLFCNNPDYLHFSYARYLENKIREAFGLSYVPITLYFKSKNARNRKLSKDVKFKQ
                     TGYDLE"
     misc_feature    complement(191725..193038)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="GTP-binding protein Der; Reviewed; Region:
                     PRK00093"
                     /db_xref="CDD:234628"
     misc_feature    complement(192559..193026)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="EngA1 GTPase contains the first domain of EngA;
                     Region: EngA1; cd01894"
                     /db_xref="CDD:206681"
     misc_feature    complement(192994..193017)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G1 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(order(192598..192606,192676..192678,
                     192682..192687,192991..193002,193006..193008))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206681"
     misc_feature    complement(order(192922..192933,192943..192963))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(192931..192933)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G2 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(order(192796..192801,192862..192879))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(192865..192876)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G3 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(192676..192687)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G4 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(192598..192606)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G5 box; other site"
                     /db_xref="CDD:206681"
     misc_feature    complement(192001..192507)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="EngA2 GTPase contains the second domain of EngA;
                     Region: EngA2; cd01895"
                     /db_xref="CDD:206682"
     misc_feature    complement(192472..192495)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G1 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(order(192046..192054,192148..192150,
                     192154..192159,192469..192480,192484..192486))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206682"
     misc_feature    complement(order(192400..192441,192448..192450))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(192409..192411)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G2 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(192343..192354)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G3 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(order(192265..192270,192340..192345))
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(192148..192159)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G4 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(192046..192054)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="G5 box; other site"
                     /db_xref="CDD:206682"
     misc_feature    complement(191740..191982)
                     /gene="engA"
                     /locus_tag="MGF_1143"
                     /note="KH-domain-like of EngA bacterial GTPase enzymes,
                     C-terminal; Region: KH_dom-like; pfam14714"
                     /db_xref="CDD:258851"
     gene            complement(193031..193705)
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /db_xref="GeneID:12396504"
     CDS             complement(193031..193705)
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /EC_number="2.7.4.14"
                     /note="MGF_1148"
                     /codon_start=1
                     /transl_table=4
                     /product="cytidylate kinase"
                     /protein_id="YP_005880453.1"
                     /db_xref="GI:385326016"
                     /db_xref="GeneID:12396504"
                     /translation="MTKQINSQQIAIDGPAGSGKSTVAKLVAQRLGFDYLSTGKIFRA
                     FYYLIKENNWSIDQLISNFNKYECAFNGDQVVINKENISQLLNDPTISKGASEIAQDP
                     KIRAFALSLQQDYANKKPVVMDGRDITSVVLPNAILKVFLTASAQQRAIRRIKQLNLE
                     LNKATLEQFTNEIQQRDDNDTNRKLAPLMIVKDAIVIDSDQLSIKQVVDKIISLYKQR
                     LGVNYA"
     misc_feature    complement(193046..193705)
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /note="Cytidylate kinase [Nucleotide transport and
                     metabolism]; Region: Cmk; COG0283"
                     /db_xref="CDD:223360"
     misc_feature    complement(193106..193681)
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    complement(order(193157..193159,193325..193330,
                     193391..193393))
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    complement(order(193166..193168,193178..193180))
                     /gene="cmk"
                     /locus_tag="MGF_1148"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            complement(193708..194349)
                     /locus_tag="MGF_1151"
                     /db_xref="GeneID:12396505"
     CDS             complement(193708..194349)
                     /locus_tag="MGF_1151"
                     /note="MGF_1151"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880454.1"
                     /db_xref="GI:385326017"
                     /db_xref="GeneID:12396505"
                     /translation="MSRLSQNKIIRETKKKQAQLNKIFNKEDESIVKYKQELDKISSN
                     ILIDYQTNKPRLLDLKVNYSDTNLKHINELKDLLSSFDSNDLINIIDQARFLNNYSSD
                     LTTNNQKKSWILNDPGLADINKIEENFENIKALSGNFVTNSHTDLDKLKKIIELAKEK
                     INDPDFFKPVEKIKIGTNRKKAKHFKILLGFIIGLISISIFFLFIIIGIFKVA"
     misc_feature    complement(193861..>194295)
                     /locus_tag="MGF_1151"
                     /note="Prominin; Region: Prominin; pfam05478"
                     /db_xref="CDD:253212"
     gene            194440..194991
                     /locus_tag="MGF_1152"
                     /db_xref="GeneID:12396506"
     CDS             194440..194991
                     /locus_tag="MGF_1152"
                     /note="MGF_1152"
                     /codon_start=1
                     /transl_table=4
                     /product="glutamine amidotransferase-domain protein"
                     /protein_id="YP_005880455.1"
                     /db_xref="GI:385326018"
                     /db_xref="GeneID:12396506"
                     /translation="MKLLVLTIKEFQDIELVSFASILTASGKFSKIDYYSPEEKDSVV
                     GQFNVAHIKTIKSFNVNDYDAIYVPGGMGAIHLRTNQKGLAAVHEFVKANKWVIAICD
                     SPNALSENKILSPEDKYISWSDGTMNHPNRIKDFNVQLNRSNKLITGRCSLTTLELAF
                     YTLEVLFSKEFSEELRAKLTGVA"
     misc_feature    194443..194970
                     /locus_tag="MGF_1152"
                     /note="DJ-1 family protein; Region: not_thiJ; TIGR01383"
                     /db_xref="CDD:213612"
     misc_feature    194446..194937
                     /locus_tag="MGF_1152"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:260141"
     misc_feature    194740..194742
                     /locus_tag="MGF_1152"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153222"
     gene            195039..195112
                     /gene="trnC"
                     /locus_tag="MGF_tRNA07"
                     /db_xref="GeneID:12396507"
     tRNA            195039..195112
                     /gene="trnC"
                     /locus_tag="MGF_tRNA07"
                     /product="tRNA-Cys"
                     /note="MGF_tRNA07; anticodon:GCA; Cys-tRNA; predicted with
                     tRNAscan-SE v., cove score=59.17"
                     /db_xref="GeneID:12396507"
     gene            195190..195266
                     /gene="trnP"
                     /locus_tag="MGF_tRNA08"
                     /db_xref="GeneID:12396508"
     tRNA            195190..195266
                     /gene="trnP"
                     /locus_tag="MGF_tRNA08"
                     /product="tRNA-Pro"
                     /note="MGF_tRNA08; anticodon:TGG; Pro-tRNA; predicted with
                     tRNAscan-SE v., cove score=90.32"
                     /db_xref="GeneID:12396508"
     gene            195272..195348
                     /gene="trnM"
                     /locus_tag="MGF_tRNA09"
                     /db_xref="GeneID:12396509"
     tRNA            195272..195348
                     /gene="trnM"
                     /locus_tag="MGF_tRNA09"
                     /product="tRNA-Met"
                     /note="MGF_tRNA09; anticodon:CAT; Met-tRNA; predicted with
                     tRNAscan-SE v., cove score=88.58"
                     /db_xref="GeneID:12396509"
     gene            195353..195428
                     /gene="trnM"
                     /locus_tag="MGF_tRNA10"
                     /db_xref="GeneID:12396510"
     tRNA            195353..195428
                     /gene="trnM"
                     /locus_tag="MGF_tRNA10"
                     /product="tRNA-Met"
                     /note="MGF_tRNA10; anticodon:CAT; Met-tRNA; predicted with
                     tRNAscan-SE v., cove score=84.44"
                     /db_xref="GeneID:12396510"
     gene            195522..195612
                     /gene="trnS"
                     /locus_tag="MGF_tRNA11"
                     /db_xref="GeneID:12396511"
     tRNA            195522..195612
                     /gene="trnS"
                     /locus_tag="MGF_tRNA11"
                     /product="tRNA-Ser"
                     /note="MGF_tRNA11; anticodon:TGA; Ser-tRNA; predicted with
                     tRNAscan-SE v., cove score=63.65"
                     /db_xref="GeneID:12396511"
     gene            195678..195754
                     /gene="trnM"
                     /locus_tag="MGF_tRNA12"
                     /db_xref="GeneID:12396512"
     tRNA            195678..195754
                     /gene="trnM"
                     /locus_tag="MGF_tRNA12"
                     /product="tRNA-Met"
                     /note="MGF_tRNA12; anticodon:CAT; Met-tRNA; predicted with
                     tRNAscan-SE v., cove score=81.57"
                     /db_xref="GeneID:12396512"
     gene            195756..195829
                     /gene="trnD"
                     /locus_tag="MGF_tRNA13"
                     /db_xref="GeneID:12396513"
     tRNA            195756..195829
                     /gene="trnD"
                     /locus_tag="MGF_tRNA13"
                     /product="tRNA-Asp"
                     /note="MGF_tRNA13; anticodon:GTC; Asp-tRNA; predicted with
                     tRNAscan-SE v., cove score=58.44"
                     /db_xref="GeneID:12396513"
     gene            195831..195906
                     /gene="trnF"
                     /locus_tag="MGF_tRNA14"
                     /db_xref="GeneID:12396514"
     tRNA            195831..195906
                     /gene="trnF"
                     /locus_tag="MGF_tRNA14"
                     /product="tRNA-Phe"
                     /note="MGF_tRNA14; anticodon:GAA; Phe-tRNA; predicted with
                     tRNAscan-SE v., cove score=83.01"
                     /db_xref="GeneID:12396514"
     gene            196025..196101
                     /gene="trnR"
                     /locus_tag="MGF_tRNA15"
                     /db_xref="GeneID:12396515"
     tRNA            196025..196101
                     /gene="trnR"
                     /locus_tag="MGF_tRNA15"
                     /product="tRNA-Arg"
                     /note="MGF_tRNA15; anticodon:GCG; Arg-tRNA; predicted with
                     tRNAscan-SE v., cove score=71.93"
                     /db_xref="GeneID:12396515"
     gene            196527..198485
                     /locus_tag="MGF_1168"
                     /db_xref="GeneID:12396516"
     CDS             196527..198485
                     /locus_tag="MGF_1168"
                     /note="MGF_1168"
                     /codon_start=1
                     /transl_table=4
                     /product="Subtilisin-like serine protease"
                     /protein_id="YP_005880456.1"
                     /db_xref="GI:385326019"
                     /db_xref="GeneID:12396516"
                     /translation="MRIKNLISFISLGIITTAVPFSAILNNNKSKVDHSKDLPSNQNS
                     VLVNNNVEIAKQAKDVSEESFVESNNSLYDFENNDYYDGFITFNGNVSIYDKNSILEL
                     IKKQPQVLDAKKSLALDNYYLVNFFFRKGSNDKERFDSFLKKYDLIGDFYIIDENKND
                     KNDLENNAIFNRNHTINNSSEKYENKYNRNFSSNGYTDDERNKAIAFTRNQITYGREK
                     RIGVAVLEVGESYDMRKALIDANDSYYFNPKVTNVWNRFDPYVFAIFPIWPLHGQHAT
                     EVGSVISGTNGVNPYHDLYGIKVNTEDFHAINGLGAARSGLENEIAYIKGLNNVKVVN
                     NSWAKKVSWNNNPNLFKYNYYSRYLDLLTANENEMIYVFAAGNEGNNKNEKFRHLYAY
                     QLSYNSIIVGSNTNYGYRSSFTTLGSDTHSPFILANGSEYPFYKGTGYGTSFASPFVS
                     GVLANTLHQYREKYKLGINSIIAKAVLGVSSSDVSGYPNTNQAGLHRDYGVGLLDYKK
                     INSAFNNLNYIRWNHSSQVILNNRWTHKNGGDGSLIVKSVPLKKGDKLRIGLSWLFKP
                     SNSISYNNNNKENADLTTTIDFTDQDFNLYLKKDGKVIYFSKTKNNFEFIKYGVVEDG
                     NYEIVVSKYTQILPNYSDTQLALSWTVE"
     misc_feature    197229..197969
                     /locus_tag="MGF_1168"
                     /note="Peptidase domain in the S8 and S53 families;
                     Region: Peptidases_S8_S53; cl10459"
                     /db_xref="CDD:263972"
     misc_feature    order(197346..197348,197535..197537,197853..197855)
                     /locus_tag="MGF_1168"
                     /note="active site"
                     /db_xref="CDD:173787"
     misc_feature    order(197346..197348,197853..197855)
                     /locus_tag="MGF_1168"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173787"
     gene            198507..199961
                     /locus_tag="MGF_1183"
                     /db_xref="GeneID:12396517"
     CDS             198507..199961
                     /locus_tag="MGF_1183"
                     /note="MGF_1183"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880457.1"
                     /db_xref="GI:385326020"
                     /db_xref="GeneID:12396517"
                     /translation="MKKYLKIINVTRRQLSLFIAYLLTTIFASIGILTLMNQSVLNNG
                     YWYIIYDQTKFNISLILPLVFFILFFAITLVILLTGKERYWFEEKLLNKPKRVKVIFS
                     LAETIQLILWAFFLIILITYFYPINQSTDQIYQTKISTADFNNDQIHSGLLSFVKINN
                     NFFADLKVSIINYAAIVPYFYNKSALIFWNVVYLVSYLSLFLVYLKLSVFKQKQRVLA
                     LIPFIGLFSYLRSTNKLIQQPLFNQEEANLKWYQKILQSNKTVFQIKLTSTITYLSLV
                     YLFSILGFAIFAISTAFIDANGYQLRSTNDNNAYVIDLSSTASANEESWVRIIGTSLL
                     LIPIVTLIGFTIGILLDKSPYLLSQKVRRNKLILSLTLIIIEITQLLSLIVLLYFFIF
                     IPNILFVSSVSSAVVQVEARGIMLSKLDLFMIGISFMLVLYLSWFLIYVKAGIFSKES
                     RILALIPFSSLFFIKKKVVESQEKINGTYKSNIA"
     gene            200085..200161
                     /gene="trnR"
                     /locus_tag="MGF_tRNA16"
                     /db_xref="GeneID:12396518"
     tRNA            200085..200161
                     /gene="trnR"
                     /locus_tag="MGF_tRNA16"
                     /product="tRNA-Arg"
                     /note="MGF_tRNA16; anticodon:GCG; Arg-tRNA; predicted with
                     tRNAscan-SE v., cove score=79.7"
                     /db_xref="GeneID:12396518"
     gene            200581..202086
                     /locus_tag="MGF_1196"
                     /db_xref="GeneID:12396519"
     CDS             200581..202086
                     /locus_tag="MGF_1196"
                     /note="MGF_1196; Mgal gene family 17 protein"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880458.1"
                     /db_xref="GI:385326021"
                     /db_xref="GeneID:12396519"
                     /translation="MMDQKRYFKIINVSRRQLALFLVYLATILFATAGIVSVMSYALV
                     SPGGNNFTVYSEKLFKTSLVLPLIFFISFAISGLVILLTGKEGYRFSDQLLRQRFKFR
                     ILLTLIEIIQVVAWAFFLVILIGYFYPINKSLSQVYQDQLASLNFGNGSIKTGLLPYI
                     HINNNFFADLKLSILNYAATVPFFFNKDMFSFANIIYFALYIALFIPYLKLSLFKKEE
                     RILSLVPFSGLLISLRLFYSENGDETLLKHNDAGLRWYQKILLSNRTVFQIKLTSTVV
                     YLSFFFLIAVLAFLTTAITLIIRTNENGYTLILSEKFINAYSINFLAIPSSEEYLLRY
                     FRLSSFIIMMIIFIVFSMGIILDDNPYVFPKTIRKSKIGLSLSLIGIEIAQWSFLILF
                     WGFFVANAEPQLVDLRDGYRILPQRFPYPIRTNPDYTYLLYSSSDLFSTTNLFFLALY
                     FSWFLIYAKAGMFSKKTRLLMYIPFASLLFVKHHALNTETETKNSYKCQIL"
     gene            complement(202372..203187)
                     /locus_tag="MGF_1206"
                     /db_xref="GeneID:12396520"
     CDS             complement(202372..203187)
                     /locus_tag="MGF_1206"
                     /note="MGF_1206"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880459.1"
                     /db_xref="GI:385326022"
                     /db_xref="GeneID:12396520"
                     /translation="MNKNKIVSKLTGLASLGFGISFALTSCTVITNSGLFKVITAADV
                     SSKKAYSTITDELTSPIQTAIYGTNLINNGNYVLTVLTNTDPEQNYFINGGDLSTGAN
                     WNGPYARAVERWQQDRTNPNYDRGILFLLYWDLFDNQRAPSNQLNPFSRVTSGTGFAR
                     NDQSAVQYRDIVDFIIKTYPTETSGWLNRTDGTTKIMNIAFSNDGTGKITPHFYMGST
                     SASPTPATPSTASSVRQSLALKSASIDNSQPSNHDLTIDDSFSTFLAGIYTRN"
     gene            203247..204167
                     /gene="miaA"
                     /locus_tag="MGF_1207"
                     /db_xref="GeneID:12396521"
     CDS             203247..204167
                     /gene="miaA"
                     /locus_tag="MGF_1207"
                     /EC_number="2.5.1.75"
                     /note="MGF_1207"
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="YP_005880460.1"
                     /db_xref="GI:385326023"
                     /db_xref="GeneID:12396521"
                     /translation="MIYSKRLILVVGPTGTKKSYLANMLAKKLNVPIISADAYQVYKE
                     LNAGVNKPSEKTLSEIKYHFISNISIFDEWSIAHFNKRAKEILEQAPDWTIVCGGSHL
                     YVNSLINDYQLEKQELDNELFDALDKLDNQEIFNQLCEYDCQEAIKIGKNNRKRLLRA
                     LYLFKKYGKKARNDSKKFDYVVVKCMSDKEKLFPYLSKRLDEMIHDLNWTKEIEYLDK
                     IITDKKLDKELIAMKALGYKEIYDAWKNNQPIDKEIINKKLKRLAKHQLTWTRNKFND
                     GMKQFTFNFFEDDANKTCDEIIQYIKSSHD"
     misc_feature    203259..204155
                     /gene="miaA"
                     /locus_tag="MGF_1207"
                     /note="AAA domain; Region: AAA_17; cl19128"
                     /db_xref="CDD:267481"
     gene            204160..205206
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /db_xref="GeneID:12396522"
     CDS             204160..205206
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /note="MGF_1214"
                     /codon_start=1
                     /transl_table=4
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="YP_005880461.1"
                     /db_xref="GI:385326024"
                     /db_xref="GeneID:12396522"
                     /translation="MTKHLYIHLPLCQKICTFCDFKRELIDRHNPKKVVQDLVDEIER
                     KQFSDEQFSSIYLGGGTPNVFDDELLDYFLSKIKKYAAKTCEFTIECNPDLVTKSQAQ
                     ILKKNLVNRASVGIQIVNNKILKYLNRTHDINHCYEAMQNLYDAGITNINIDLMYALP
                     HMKKEDVLENIKFIKKTKPNHISFYGLDLKPGAYLTKTPYKIDLDQEAMQLRVMKAEL
                     NKINYKRYEVANWCRLKKYQSVHNKAYWLTKDYAAIGWGAHGFENKVEYYYDGSIQNW
                     QIKKNRLTDEQFYQRVLIMGLRLKDGVDITKEPYKTAYEKYQNKLKFVTVKNNHLRAD
                     NIDLLNNSIIDILE"
     misc_feature    204160..205200
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK05904"
                     /db_xref="CDD:235641"
     misc_feature    204193..204744
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(204193..204195,204199..204201,204205..204207,
                     204211..204219,204331..204333,204337..204342,
                     204427..204435,204502..204504,204625..204627,
                     204715..204720)
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    205006..205158
                     /gene="hemN"
                     /locus_tag="MGF_1214"
                     /note="HemN C-terminal domain; Region: HemN_C; pfam06969"
                     /db_xref="CDD:253997"
     gene            205314..208265
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /db_xref="GeneID:12396523"
     CDS             205314..208265
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="MGF_1220"
                     /codon_start=1
                     /transl_table=4
                     /product="Chromosome segregation ATPase SMC"
                     /protein_id="YP_005880462.1"
                     /db_xref="GI:385326025"
                     /db_xref="GeneID:12396523"
                     /translation="MLFLKKFHAQGFKSYADNISFTFDEHVTGIVGPNGSGKSNVVDA
                     LKWVLGERSMKNLRGKTSDDVIFFGSQEKPASKFAEVSLTFDNSQGYLHDKRKEITVT
                     RRVYRGSGVSEYLINNEPSSLKEINDIFLDSGLTKGSLCIISQNTVSSFIEAKPEDRR
                     QIFEDAAGIGRYAKKKQDAIRQIARTNDNLKEITTIVNELNRDLKKLNQQAEKAILYA
                     ETKEKLKDLEITLSVNEYLISQKEIEALSEQIAEIDERLLKNDPQLQINQEKLEAFKK
                     RYNSADQNVQKIQDELQKIYHEIVLLEKRNVFNDLQLKSDLDSNDKNKKINALEQLLK
                     SSEEQLKKYFELISTWEEELKEKDVDKTDLANELENLKKSLATFQVKRYEANLQVQFY
                     QNQKINQFAQDAGVRTVLNNKDAIGGVHGIVQDFIKVEPEYELAISTALNKAAKNIIV
                     DSNQDAINAVNFLKANKAGRATFLPLANLKDRDVKPEHLEVLEQVEGYLGIAANLVNY
                     HDQYDPAIRALLGQIIIASDLEAATKISKFTYQLYRVISLGGDIVNAGGAITGGAESK
                     QTHSLFNLDEKIDTLKNELLVAEKNINELNKKLEFLTADYTKKDKEFNEQKIAIQRYQ
                     DLIVIEQKKLDDYKIQYEQLTDKTFDGKDVKWDDKKIKDKLFSLETKKATLVQDLKIN
                     QEAKDMYQKQVNQLEKDVTLFYKEIDEDKNDKLKRREQLTKHENTIYLAKSKINESYN
                     MAIEFAIENYNKPLPISLSQARSEVVKLQSTLNNLGAINMEAIQELDIKKERYEKLYS
                     QQQELINARERINQAIIRLDEKAIFEFDQLINNLNKELPKTFYYLFGGGNCEIRYSNP
                     EEKLTSGIEVFASPPGKNIGNLNLLSGGEKALVALSVLFSILKVSSFPLVVLDEAESA
                     LDLANVERFANIIKNSSDQTQFLIITHREGTMVKCDKLIGATMQTKGVTKMLSVSLHQ
                     AKDMAEEIESQ"
     misc_feature    205320..208223
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     misc_feature    205323..>205589
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="ATP-binding cassette domain of barmotin, a member
                     of the SMC protein family; Region: ABC_SMC_barmotin;
                     cd03278"
                     /db_xref="CDD:213245"
     misc_feature    205407..205430
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213245"
     misc_feature    order(205416..205421,205425..205433)
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213245"
     misc_feature    <206085..206381
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="The Bin/Amphiphysin/Rvs (BAR) domain, a
                     dimerization module that binds membranes and detects
                     membrane curvature; Region: BAR; cl12013"
                     /db_xref="CDD:264507"
     misc_feature    206562..206918
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="SMC proteins Flexible Hinge Domain; Region:
                     SMC_hinge; smart00968"
                     /db_xref="CDD:214944"
     misc_feature    <207903..208205
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="ATP-binding cassette domain of barmotin, a member
                     of the SMC protein family; Region: ABC_SMC_barmotin;
                     cd03278"
                     /db_xref="CDD:213245"
     misc_feature    207954..207983
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213245"
     misc_feature    208026..208043
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="Walker B; other site"
                     /db_xref="CDD:213245"
     misc_feature    208050..208061
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="D-loop; other site"
                     /db_xref="CDD:213245"
     misc_feature    208122..208142
                     /gene="smc"
                     /locus_tag="MGF_1220"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213245"
     gene            208265..209311
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /db_xref="GeneID:12396524"
     CDS             208265..209311
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="MGF_1235"
                     /codon_start=1
                     /transl_table=4
                     /product="signal recognition particle receptor ftsY"
                     /protein_id="YP_005880463.1"
                     /db_xref="GI:385326026"
                     /db_xref="GeneID:12396524"
                     /translation="MSFIKRLFSKFKKKPDTVEEIKKKNQENSLFETTQEKFDDGLKK
                     SSNSFSDIINQLSTKYVSLNEAFYEDLFDAFVQLDIGYNATKKIVDAIVEEIKYQKVV
                     DPTLIKQIIIDKLFVYYIQDSEVNIDLNYQDHRQNVFLVVGVNGVGKTTSIAKLANYY
                     KKLNKKVLLIAADTFRAGAIQQLNIWAERLEVDIYKDESKKDPAAVIYEGLNFAKQRD
                     YDLVICDTSGRLQNKVNLMNELKKINNVIEKFIGRNVDETLLVLDATTGQSGLIQAKV
                     FHEVSKITGIILSKMDSSSKGGIILGIKDLFNIPVKLIGLGEQLDDLVSFDLQKYLIS
                     LTANLNLDYEKTSN"
     misc_feature    208283..209281
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="signal recognition particle-docking protein FtsY;
                     Provisional; Region: PRK10416"
                     /db_xref="CDD:236686"
     misc_feature    208382..208609
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    208673..209209
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="The signal recognition particle (SRP) mediates the
                     transport to or across the plasma membrane in bacteria and
                     the endoplasmic reticulum in eukaryotes. SRP recognizes
                     N-terminal sighnal sequences of newly synthesized
                     polypeptides at the ribosome. The...; Region: SRP;
                     cd03115"
                     /db_xref="CDD:239389"
     misc_feature    208691..208714
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="P loop; other site"
                     /db_xref="CDD:239389"
     misc_feature    order(208781..208783,208946..208948,209129..209131,
                     209138..209143)
                     /gene="ftsY"
                     /locus_tag="MGF_1235"
                     /note="GTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239389"
     gene            209286..209612
                     /locus_tag="MGF_1239"
                     /db_xref="GeneID:12396525"
     CDS             209286..209612
                     /locus_tag="MGF_1239"
                     /note="MGF_1239"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880464.1"
                     /db_xref="GI:385326027"
                     /db_xref="GeneID:12396525"
                     /translation="MIMKKQVISFEQWNLLNELFSYYHKLLSDKIKLYLEEFLINNLS
                     YNEIATNYQISKYAVYDQIQKGIEQLKNYEQLLLLNQLSKQRLKLYEQISDPNLKQAL
                     LILEQK"
     misc_feature    209313..209597
                     /locus_tag="MGF_1239"
                     /note="Putative helix-turn-helix protein, YlxM / p13 like;
                     Region: UPF0122; cl17893"
                     /db_xref="CDD:266911"
     gene            209675..210295
                     /locus_tag="MGF_1242"
                     /db_xref="GeneID:12396526"
     CDS             209675..210295
                     /locus_tag="MGF_1242"
                     /note="MGF_1242"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880465.1"
                     /db_xref="GI:385326028"
                     /db_xref="GeneID:12396526"
                     /translation="MSSKLKLIKPIDYSKEIKITQFFIDPAMMEQQRQRIKAALPKEM
                     NDETMMQYELLQLSIKDNVFSAIMNYLAEHFEFEIDQAEVKKLIEQLKASGLGAQREE
                     LLANMADKIIKKGLMFDYLSEQWKVKVSDNEVKNMLDIYYEKTNQSIHDVLNDRQKFE
                     SVRSSIFEEKMVLKTISMFLIRFNMQNPNYVEESETDKSSESKSVN"
     misc_feature    209849..210196
                     /locus_tag="MGF_1242"
                     /note="Bacterial trigger factor protein (TF) C-terminus;
                     Region: Trigger_C; pfam05698"
                     /db_xref="CDD:253332"
     gene            210295..210579
                     /locus_tag="MGF_1250"
                     /db_xref="GeneID:12396527"
     CDS             210295..210579
                     /locus_tag="MGF_1250"
                     /note="MGF_1250"
                     /codon_start=1
                     /transl_table=4
                     /product="single-stranded DNA binding protein"
                     /protein_id="YP_005880466.1"
                     /db_xref="GI:385326029"
                     /db_xref="GeneID:12396527"
                     /translation="MLNTVLLEGLIDSYKWSKNKTGFYVTITQKRKFGNQTFTDYYVI
                     YANDQLGLELEKYVLEHEYLAIKGSLTTYQDKKSKVWKTQILAEKILVRK"
     misc_feature    210295..210567
                     /locus_tag="MGF_1250"
                     /note="Protein of unknown function (DUF3217); Region:
                     DUF3217; pfam11506"
                     /db_xref="CDD:256489"
     gene            210592..212313
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /db_xref="GeneID:12396528"
     CDS             210592..212313
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /EC_number="6.1.1.3"
                     /note="MGF_1252"
                     /codon_start=1
                     /transl_table=4
                     /product="threonyl-tRNA synthetase"
                     /protein_id="YP_005880467.1"
                     /db_xref="GI:385326030"
                     /db_xref="GeneID:12396528"
                     /translation="MLNYFNTALLMVQMILKKQDPSIKFGQMSVNDQGFYLDYLSQTL
                     NINPEDFNKLIKSLAKLCSSAQPISLKTVDLKIANQLLSDQPYLLELINEAKEKTVNL
                     ATVDNHHYYLPMAQLVDNTKLVKAFNFQSVGGAYFKGDKDNLVMVRLNGFGFENDKVM
                     QDYLEIIEEQKQRDHRRINKILELFTFNQLAGPGMPIWLPNGQIVRQLIGDYVHSVQK
                     KFGFMAVNTPILGNVDLYKKSGHYNHYAKDMFPELALLDGDKMMLRPMTCPHHCLVYL
                     NKPRNYYDLPMRLSEDALLHRYEASGGLTGLERVRAMTLLDNHIFCRLDQIKTEILNA
                     YQVIKEVIGTFNLKFHRIDLSLHDPNDKQSFIDNEQMWARSENQLEDALKDLGLEYTK
                     QVGEAAFYGPKIDFQVKTALNKIITVSTIQLDFSLPSEEKFDIKYKTKDNTYEQGVII
                     HLGIIGTYERFVATLLEQTKGALDLWLAPKQAVIIPVNNSVHLEGCNQLLEKLLAKDL
                     RVTVDSRDERLNKKIRDHQVNKIPVQIIVGDNELKNPDLITYRLYGQEDSNQLELTKF
                     IELFKKP"
     misc_feature    210610..212307
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK12305"
                     /db_xref="CDD:237050"
     misc_feature    211111..212028
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    order(211120..211122,211159..211161,211312..211314,
                     211324..211326,211333..211338,211384..211386,
                     211480..211482,211486..211488,211492..211500,
                     211513..211521,211528..211530,211534..211536,
                     211831..211833,211840..211845,211855..211857,
                     211957..211962,211969..211971)
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    order(211132..211134,211150..211152,211156..211164,
                     211168..211170,211174..211176,211180..211185,
                     211189..211191,211198..211200,211243..211248,
                     211258..211263,211267..211269,211273..211281,
                     211285..211287,211339..211347,211351..211353,
                     211360..211368,211372..211374,211408..211413,
                     211420..211428,211432..211440,211477..211479,
                     211483..211485,211492..211494,211522..211527,
                     211606..211608,211744..211752,211903..211905,
                     211909..211911)
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    211258..211281
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    211477..211488
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    211957..211971
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    212026..212304
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    order(212050..212055,212161..212163,212179..212181,
                     212203..212205,212236..212238,212242..212244)
                     /gene="thrS"
                     /locus_tag="MGF_1252"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            212326..213150
                     /locus_tag="MGF_1257"
                     /db_xref="GeneID:12396529"
     CDS             212326..213150
                     /locus_tag="MGF_1257"
                     /note="MGF_1257"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880468.1"
                     /db_xref="GI:385326031"
                     /db_xref="GeneID:12396529"
                     /translation="MGKNKLLIIDVDQHLVYDQGYDIDQLTKTIQELKAHFEILISSS
                     SWFENIINFNNLIKLGLNDISYLAANGACLRKKSDRKFYYESFFKKNDYDLINHLALI
                     KQSGILLKGASSIDSYDNLLATYFLNYNTIKQARMRWKDQIYWNNDYKSFNQAIQKML
                     INQIYLFNIKEWINSSDFNQTILNHDRFNFIQLNETDGLFINKEVNKFATIKKHFPNT
                     FLIYLSLHNQIDPKANERFDYLVVPDNVNEAVLQSAHFVFKPNELNLLIDNLKSII"
     gene            213265..216465
                     /gene="hlp3"
                     /locus_tag="MGF_1260"
                     /db_xref="GeneID:12396530"
     CDS             213265..216465
                     /gene="hlp3"
                     /locus_tag="MGF_1260"
                     /note="MGF_1260"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence-associated protein Hlp3"
                     /protein_id="YP_005880469.1"
                     /db_xref="GI:385326032"
                     /db_xref="GeneID:12396530"
                     /translation="MIMNPKIHNKILKNLAKLKKKAFTKYAAYDFNFAYDKNGNVYLV
                     GVDNVTNQTFNLIKPVFKFLKKPLPAELYGMDQQPFYFVNNHHYIDALNSDTGEQELL
                     RYNVIDQSLVNAQTNDLVDPAFYTDLEGYELDLSQYTGSLLDLSNEVIPVEQQPVEQE
                     EVNLTPEQVEEAEQVEQQPVDQQQVQQVDPNLNEQPVEGDNQNFTQQYYDQQLGYADQ
                     NVDYGYDPQQYTQEQDYVDNTQQYDQVQDYVDPNQQYYDDQQQYDQQGYDQGYDQQYD
                     QQGYDQQGYDQGYDQQQYDEQPTQQVEAVVEQIEPVVDEVVEEQQPVEVAKPAPTKPV
                     RPRPQPGKKATKYAIKKPEPKPEVVKEEPIEPVVEKEEVVAVVEQVVDQPVEVKKEEP
                     IPAPVVVADDEIKLASEQPVKKKINLDDLQQIPVVIKLPKFETPKLPEPKADSEQKEE
                     VAVKVVEQPVENPQVQETKDHHALPKVKIEKRQEVELVPSKLDDHYDLIEEENDDFFV
                     DKFKFEDVKLSDLLVEQKPIEVNQPVQQPVVLEQSTPPVQAQPQVVEPKLEITKLEEL
                     VEIKTDNTESLNKLETLIDENKKIIDQFKQLKEEAKKSNSNINLEKVAKQLVDYLTNK
                     LNEKTAALNKPEPSTPELNKVEQAKQKAVEQLVYEQVVSQPREKVVQQPKEVVAKPYF
                     EESDDLLRSVSNKPKQPTSELLDFLVQQVVDGEEDDLPPPTNFDKRPNQNVRQKLDEI
                     NQVETQGFNQTQFVPPQSLNQVETPNQRLFLEPEIQVQPQALYTASREHEQVQPKAQH
                     QQPTTRIEREEVVNKLQREPLVPPARVAYHSNREFDDLYQNHYEQRTARINPQDPYYD
                     QGYEQPDPYQEQYLDQGYQQQVDPRYQQEAYQEYNRPLPPNQEYGYYPPAYESRRDYQ
                     PYEPRRANYEVRKPLAYEFSKQPAPRRYQQLPNRYNEFDQSRQLAYPVHKGTLRTEAD
                     FLRFREGYGYDYDRPSTQYYRSNYDTYVREVRRPIRQLGMIEPVAEFRSRALAPRRVT
                     RPTYGLRRVSRISSLAPRGYNQQPRVRRVPVSRGYW"
     misc_feature    214894..>215421
                     /gene="hlp3"
                     /locus_tag="MGF_1260"
                     /note="pathogenicity island 1 effector protein SipB;
                     Provisional; Region: PRK15374"
                     /db_xref="CDD:185272"
     gene            216459..217274
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /db_xref="GeneID:12396531"
     CDS             216459..217274
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="MGF_1278"
                     /codon_start=1
                     /transl_table=4
                     /product="putative choline kinase"
                     /protein_id="YP_005880470.1"
                     /db_xref="GI:385326033"
                     /db_xref="GeneID:12396531"
                     /translation="MIMDRSKNHALDFFIKHTNYSPNQVSRIEPIHNGFTNLSYLIET
                     SDQQKYQIRFALNNELVNRVNEYQVITLLKNDLFIYFDQETGDCIKKWIVGQEVDYFD
                     QTRLKNLAKAIKKLHQVPLGNCSILPIDYYKGIENAKLATRHKRLYLSLINKYRDLPK
                     HLTHSDLNAHNILVDEYNQIHLIDFEWSRINNAYFDLANMARESLSLEQAYYLVDCYG
                     GLDLKIFNEFLIISCLFALIWTYNMQQTDKIIAYRKGVEKRLAYYLESFVVNL"
     misc_feature    216534..217127
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="Choline Kinase (ChoK). The ChoK subfamily is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs), RIO
                     kinases, actin-fragmin kinase (AFK), and...; Region: ChoK;
                     cd05151"
                     /db_xref="CDD:240172"
     misc_feature    216537..217064
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    order(216552..216554,216558..216560,216564..216569,
                     216573..216575,216609..216611,216615..216617,
                     216684..216686,216726..216737,216741..216749,
                     216954..216956,216960..216962,216966..216971,
                     216975..216977,217005..217010,217017..217019,
                     217065..217067,217077..217079)
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="active site"
                     /db_xref="CDD:240172"
     misc_feature    order(216552..216554,216567..216569,216573..216575,
                     216609..216611,216615..216617,216684..216686,
                     216726..216737,216741..216749,216966..216968,
                     216975..216977,217005..217010)
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240172"
     misc_feature    order(216558..216560,216564..216566,216954..216956,
                     216960..216962,216969..216971,217017..217019,
                     217065..217067,217077..217079)
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240172"
     misc_feature    order(216648..216650,216657..216662,216669..216674,
                     216690..216701,216930..216932)
                     /gene="licA"
                     /locus_tag="MGF_1278"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240172"
     gene            217342..218259
                     /gene="mgc2"
                     /locus_tag="MGF_1284"
                     /db_xref="GeneID:12396532"
     CDS             217342..218259
                     /gene="mgc2"
                     /locus_tag="MGF_1284"
                     /note="MGF_1284"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadhesin protein MGC2"
                     /protein_id="YP_005880471.1"
                     /db_xref="GI:385326034"
                     /db_xref="GeneID:12396532"
                     /translation="MFSLKKLKSKLVGVSFVFSGAISLGTGIGLTSEHKYEHSPTLVL
                     HEGETNSVGPRKITSEPWFYPVVGAGAGLIVVSLLLGLGIGIPIAKKKERMMIQEREE
                     HQKMVESLGIIEQQNKTEAIESTTAVPTEEVNVQEPTQPADVNVVNNPQMGINQPGFN
                     QPQINPQFGLNPQQRINPQGFGGPMPPNHMGMRPGFNQMPPQMGGMPPNHMGMRPGFN
                     QMPPNQMGGMPPRPNFPNQMPNMNQPRPGFRPQPGGGVSMGNKAGGGFNHPGAPMGPN
                     RMNFPHQGMNQPPHMAGPRAGFPPQNGPR"
     misc_feature    217345..218241
                     /gene="mgc2"
                     /locus_tag="MGF_1284"
                     /note="Cytadhesin P30/P32; Region: Cytadhesin_P30;
                     pfam07271"
                     /db_xref="CDD:254134"
     gene            218419..221778
                     /gene="gapA"
                     /locus_tag="MGF_1292"
                     /db_xref="GeneID:12396533"
     CDS             218419..221778
                     /gene="gapA"
                     /locus_tag="MGF_1292"
                     /note="MGF_1292"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadhesin protein GapA"
                     /protein_id="YP_005880472.1"
                     /db_xref="GI:385326035"
                     /db_xref="GeneID:12396533"
                     /translation="MKKLIFKFSVGITPFALIGLGSFGLAVSGAKPNNLKPVNQVGEM
                     NSQDQSNLLEKARRWRNSNFTSLSIDGTNPGALVLTGSKSISRIDLYGNVIWTFDPGN
                     TKDLTGKVGFYDASNRLTAFSGNVPFDLSDLSSKTVVEATQDQEDPNVFYLLLIPDAA
                     VQQEQKTKDQVFENYFMSDAPATGDTSAQAGGDASSSGGAGTGVGAAVPAGTPAAASS
                     TARLVEENSTDMRTTNPATSETVIEYNSDQNKIPKPKALLDSNESSDTINSGKSYSSI
                     NAQKNLQGVIVKVNENLFNSENPFAVENMAFIKPKDMVDNYPSTWTQGSANGKMSNVL
                     QFYQHNNPNVVENSLFRAKYFPRRLETKTDTPLIDSSFSPHEHPEWYENNQFVMPWMQ
                     YITNLGGLYAKDGMVYLFGGNGTWVNNESALSIGVFRTKFENRTAEAPGNTKTVGYPY
                     GILLSAISFDVTGNRLVPGTASLGQDVGYHFVPRLAVGGVSSPRGANGNIFLGSAITW
                     GTNGGNFLDTKWHSPTVIQNAPTTFVTVNSSGALQNIGTPQQTSTPMPNDNGNESIPY
                     RWTNSYDYNSVRFAALISKPAGGNTKQVESLFTTALKLDTLNSLPDQFTPQNNIFFSY
                     AMLDGHQWSLGTRKDSTWLTTNTINNFTYNTQQQLATSAGENANPRNILNALTTAKGF
                     DRRNIGNVVYTKSNNTNNFTYYYQVGGAITTWPEVQVNYKTSANITYYNLTSTDFGRV
                     RPETQTTTISSKLNGAYLSSTGDKEGWYNGSIYVKQANFTPSSQGYTWQDFKGLTTTA
                     SNAVISNWTKAGYSIRPDDDTVFSVSKIPFEKEITAAVNVKSLDSYYVQLNGETSVNT
                     VARVSPDSSALALNPNRVTNPLMNRDNVIGQGAFISRNDIPSSFFENKINDIVATEAD
                     GTEILDSKYINSIYRYTPPQNNPDIRLRLLVIDRSRATNDFIKLLPQVLVDGEYVPVP
                     QANSVFVSDQEFTGFNALPGYVLPVAISIPIIVIALALALGLGIGIPMSQNRKMLKQG
                     FAISNKKVDILTTAVGSVFKQIINRTSVTNIKKTPQMLQANKKDGASSPSKPSAPAAK
                     KPAGPSKPSAPGAKPTAPAKPKAPAPTKKIE"
     misc_feature    218443..221598
                     /gene="gapA"
                     /locus_tag="MGF_1292"
                     /note="adhesin P1; Region: termin_org_P1; TIGR03839"
                     /db_xref="CDD:234371"
     misc_feature    <219523..219657
                     /gene="gapA"
                     /locus_tag="MGF_1292"
                     /note="Trypsin-sensitive surface-exposed protein; Region:
                     CytadhesinP1; pfam12378"
                     /db_xref="CDD:257016"
     gene            221800..224976
                     /gene="crmA"
                     /locus_tag="MGF_1316"
                     /db_xref="GeneID:12396534"
     CDS             221800..224976
                     /gene="crmA"
                     /locus_tag="MGF_1316"
                     /note="MGF_1316"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule A (CrmA)"
                     /protein_id="YP_005880473.1"
                     /db_xref="GI:385326036"
                     /db_xref="GeneID:12396534"
                     /translation="MNISKKLKSYTLIGGLAVLGTLGSASFGFKQSDKSNDNTQLVNQ
                     ARTLDANSVKLAGLGQNGSLFNTVLRDVDDNFITAASGTIIKLDSFTKPLYGLDLSDD
                     FAGYKVKQIVSDYTTSRNRFDQRQTRAYYALLVNDDAIVHLKRINTNQNRIGNLNNNS
                     KFVIGGVDNPAHVIRFTDDGTKFNFTKQTQGEIVNDFILDAPILPKDLHPDWYNLYIQ
                     RKILPNDVNTAVVPWPVGRVSGTNATDGTFDFGNGVASSTNPIEQTKTTTNNQMSMTF
                     DSSAMPSANNRYDSELNVKHRIKTSFGLDEKFVYPEWTGQEENANLTRLTNRPSGNNY
                     WILNIPGTPNVTLKEDTVNVFSRLYLNSVNSLSFIGDSIYIFGTSELPSLWYYAFPTR
                     LSDLTALNQVKSADAEASSTDTGTTTNGTTTTTGGTGSAPSAGTGTTTNTPTVTNPIL
                     STYRSFGIDSKPTSVNKIDETNWGDPNVIEARIYSEYRLGIQNEIPLVNAGNFIQNTI
                     GGVGFTSSGSRVVLRASYNSDQRPTGNFQPFLYVFGYLGYQQTRADTFWYGRYKLLNN
                     SPYDVLDAARVGTETNRSQRNSLTYPVMGGYLTEEGARSFSNISYIREASDTPQSRSI
                     FQSGYSDNTYEYIQSALGFDGIRNNLNVGVKASSFLNSNRPNPNGLEMIAATTYLRSQ
                     IGLARTSGLPNQQPFGTTHEVISVTPRDQFSSIKNIRTIIPGKQLWYFLFTNENNKSS
                     VYTLRLADSSNPDASSSFSPTRLIDVNEIGVILPLLDNSFYTVNAAGNVALFSSNPGS
                     PGSYTAVNTFNQNLSDIAFEGSGAKYTSDFWGTIQFKPDEYLIQNGFTSQVARNFVTN
                     QSFLNSLVDFTPANAGTNYRVVVDPDGNLTNQNLPLKVQIQYLDGKYYDAKLKNDNLV
                     TFSYNNFAALPSWVVPTAIGSTLGILAIMIILGLAIGIPLRAQRKLQDKGFKTTFKKV
                     DTLTAAVGSVYKKIITQTANVKKKPAALGAGKSGDKKPAAAKPDAPAKPSAPKASSPA
                     KPTAPKSGAPTKPTAPKPAAPKPTAPKE"
     misc_feature    224665..>224970
                     /gene="crmA"
                     /locus_tag="MGF_1316"
                     /note="Histone H1-like nucleoprotein HC2; Region: HC2;
                     cl19298"
                     /db_xref="CDD:267651"
     gene            225132..227897
                     /gene="crmB"
                     /locus_tag="MGF_1336"
                     /db_xref="GeneID:12396535"
     CDS             225132..227897
                     /gene="crmB"
                     /locus_tag="MGF_1336"
                     /note="MGF_1336"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule B (CrmB)"
                     /protein_id="YP_005880474.1"
                     /db_xref="GI:385326037"
                     /db_xref="GeneID:12396535"
                     /translation="MLKAHIKRSLILFIILIVAAISLIFIGLFGFKKPNINQVKLNNQ
                     SSSLITNQPSDQIIRRYSLNSIRWNANANFSSSPTKDGGLLVITADGRLERIDSFGYL
                     KWELNLRNINALASVDEKQNLVYSDNRIVTKPLDPVFINSVSKKVVAEAIQSQEDPTI
                     YYLLAVSDQILTNDVKDQLLSFQQLATDLTSQGVVLKIKEEPTQINDPVGIIDYATIS
                     PTDLTQNYPTSWKTNTLSLYGDNGSFRKADHPSWFNNDSNFISLPWLQYITNLANLYE
                     YKDNVFLFGGNGNWVNDDQSGRQQATKYLSIGVFRIRFHKNLSTRPTVTGYPYAHLLS
                     SLTSNDPDTQKLLLGQNTNYTLVPRIAVGGVKQGLGENKNSVFLFGSITTGLNNTDNP
                     NQVVLDSANYTNEELANLNTLSSVPLSAKNALKNSVGPRALIGLFFNLDDLISLPDQI
                     VQANISSTYYLNQNSYPFRLIAPWTTTLAQPDIDALNVASENKSITGTLYNLTIRHGF
                     KENDLGGLIQLDDSSYGVAVGPYILRIYLPSLSRSISNKPNWLYRLSNIDFINYDINS
                     PINFNPIFEFKDFRGIGVIHSNKSYLFSLFAPSSLITTTPKLYYSAFGDQINRNANFN
                     VLTIPKTNGILQFNNRDGLALQNNDFSFHLYSVNNDDLQDNGIINPVVQRVKFLGSGN
                     FNQPNRLDLIGTSLNDLFELQDNETILKPDRIKAIYNYFPVNNNQDYQLKLKVINLDY
                     DQGTFRLVPYVFSKVTNDYQIIPDHNDGLTTNNSFLNFKRSIGIDDIYLYVGIGVPVL
                     ILLVSIGLMTLVGMALVRERKRLIRSFRTNNLKIDGLVLSIGSVFKSLIHSSKRFKRL
                     LSNDKNEKEQKQMMQKILNKTASINDKQSTNYSNQSFNQDDQSRVNFSNLREYKAKTK
                     MISEDEY"
     misc_feature    225780..225992
                     /gene="crmB"
                     /locus_tag="MGF_1336"
                     /note="Trypsin-sensitive surface-exposed protein; Region:
                     CytadhesinP1; pfam12378"
                     /db_xref="CDD:257016"
     gene            227904..230465
                     /gene="crmC"
                     /locus_tag="MGF_1351"
                     /db_xref="GeneID:12396536"
     CDS             227904..230465
                     /gene="crmC"
                     /locus_tag="MGF_1351"
                     /note="MGF_1351"
                     /codon_start=1
                     /transl_table=4
                     /product="cytadherence related molecule C (CrmC)"
                     /protein_id="YP_005880475.1"
                     /db_xref="GI:385326038"
                     /db_xref="GeneID:12396536"
                     /translation="MIKKQLRQVQINSLVKIVISLILSLFLFLGFTQTFNHSSRSDKL
                     VNQAQLVADNNQDYQQLKTEQNHYVTNSNNDYFVLTKTGVVKLDVFGNVYYNYSFATN
                     FINYQTVDFVADSLRADYYYLLIKNPIVSINGNDLNSLSVSSPAYVLQLKDENNTLNV
                     LKTFQLSSYRFSRDIATLYNRIGFESSSSSSNLSGLLDKPTNSTLLNNISAYYDHAIS
                     KLVFINNRLGVFGSNNQLSLWFYLFNINQTNDFSTNNDLNLVTIFPQLYGTTNLNWAL
                     NNISNVNQATTAQFVINNIRLYTPAYFVIGANVVKQNLVNPNGLLNAQQTAIYSLHLG
                     LVPAPISAITNNNQFGYKISANYYNSDNLNYSNLFVSGMISQTKVAQITNNLNLFNEF
                     FSASHTTRLNLSKINSKTQTAYHYSVQEDRSNQTNNSYPNLIGILIIKDEMMGFLYSA
                     DSYNLLSQINYHLISDDISMAGFDLLTTMALKDGKWHLSFFDPRQSISWINQISPTIS
                     QLNNGTLAINYTKLYQANQQGSIFLTLILGEQAFYTLVTQNNRVDLNLIFYDQKTQSF
                     SDATFFNNGVPSFDNIPNSDGSKLWGMISFKPSSYLVNQDLNTTSAMRLSNNNLLLNN
                     LYDYTPGEIDWKPRVEAIALNDSTLRLSIQFPYFDGNYYSPNQKLVNLAFPSIIYDNL
                     NAYPVYVVPTIVISAIVVFILVVAFIFLIVLQILKTKKVSLDLFRNANRKVDKLNDSV
                     NIIYEKIETKLYSPQSEPKKLVNNQTRQINPPFNNQTVQINPTNRFNPNQQPRRYYPQ
                     HPNQTRTYPYQQTTFMPPHQRPGFNQPRKVNPRPQANSEPTAQFGFYDRTKQPNQ"
     misc_feature    <230004..>230417
                     /gene="crmC"
                     /locus_tag="MGF_1351"
                     /note="Cytadhesin P30/P32; Region: Cytadhesin_P30;
                     pfam07271"
                     /db_xref="CDD:254134"
     gene            230544..231803
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /db_xref="GeneID:12396537"
     CDS             230544..231803
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /EC_number="6.1.1.21"
                     /note="MGF_1368"
                     /codon_start=1
                     /transl_table=4
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_005880476.1"
                     /db_xref="GI:385326039"
                     /db_xref="GeneID:12396537"
                     /translation="MSNKQITAVRGTTDWFDQAMILFNAISHKIIALSDLYTYQRIKT
                     PVFEHAELFSRNLEHSDIVKKELYQLIDRSERKLALRPEGTASIIRAVNEHKLLDQNP
                     WPLKLYYLEPMFRYERPQKGRMREFYQYGIELVGELDQLDYLQTILFAKKILDIFNFD
                     CVLNINWLGNFASRKRWVEQLNQYFKQYQDQLSELSVSRLDSYGVLRILDDKNESKKD
                     FVRSAPTIDQFISLEEQTQFKQLLEQLDQLGIKYVYNSSLVRGLDYYSELVFEFILAN
                     NDQAQSTLIGGGCYQNLIAELTNKPLKAIGFALSIERFISYLDDKTKDSLINQDQKPR
                     YLLINLVPNKELATLNLSQELINHNYQVYYQHKLNKVDKAIKYALRAKFTHLIIMGND
                     EWSKQTMTIKDLASQTQQTIKYKEFIK"
     misc_feature    230565..231764
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="histidyl-tRNA synthetase; Region: hisS; TIGR00442"
                     /db_xref="CDD:213530"
     misc_feature    230601..231500
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    order(230613..230615,230649..230651,230664..230684,
                     230751..230756,230790..230792,230796..230798,
                     230811..230816,230823..230828,230916..230921,
                     230940..230942,230964..230966,230976..230978,
                     230985..230987,231405..231407,231459..231464)
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    230658..230684
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(230790..230792,230796..230798,230886..230888,
                     230892..230894,230913..230915,230922..230924,
                     230928..230930,230940..230942,231321..231323,
                     231327..231329,231333..231338,231390..231392,
                     231405..231407,231462..231464,231471..231473,
                     231480..231482)
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    230883..230897
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    order(231459..231473,231480..231482)
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    231549..231797
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="HGTP anticodon binding domain, as found at the
                     C-terminus of histidyl, glycyl, threonyl and prolyl tRNA
                     synthetases, which are classified as a group of class II
                     aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon
                     binding domain is responsible for...; Region:
                     HGTP_anticodon; cl00266"
                     /db_xref="CDD:260312"
     misc_feature    order(231561..231566,231669..231671,231687..231689,
                     231711..231713,231741..231743,231747..231749)
                     /gene="hisS"
                     /locus_tag="MGF_1368"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238379"
     gene            231813..233561
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /db_xref="GeneID:12396538"
     CDS             231813..233561
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="MGF_1373"
                     /codon_start=1
                     /transl_table=4
                     /product="Aspartyl-tRNA synthetase"
                     /protein_id="YP_005880477.1"
                     /db_xref="GI:385326040"
                     /db_xref="GeneID:12396538"
                     /translation="MLKPLDFTNRKPIIELKQAQLLNQDVEIVGWVKNVRKLGNFNFI
                     EVADKSALIQVFDQKNQYANLSREDLVFIKGKLQLKKVANPNLELGDRELLINQLTLI
                     SKSKTPPFLIEDNTDALEEVRLKYRYLDLRRPVLQKNMKLRSDFFLIVRNFLTSQGFI
                     EIETPILSKTTPEGARDYVVPSRLGPNMFYALPQSAQIYKQLLMISGFERYFQISRCF
                     RDEDLRKDRQPEHVQIDMEVSFMSKEQFFKLVEAMFIHIFDRLMNVKIEPNFMRMSYD
                     EAMNRFGTDKPDLRFGCELVDVSAVFVDHEFSVFKQFALKNRLKAIVLDEILISYKEH
                     KVMEKYAKDNYAKGLSWFSYDQNQIIDGSIKRFISSDDLKNLGLLNKKGTIFFVGDDD
                     LNVINKSLGAVRIQLNELYQLANEDEYKFLWIVDWPLYEWDDKTNSYQSAHNLFTAPE
                     AKYLSTFNEDKANAKAASYDLVLNGFELGSGAIRITDPSLQKAVMSSLGLSEAEMNDK
                     FGFLLDAYQYGAPQHCGIGLGSDRLLMILTKSKSIRDVIAFPKNNQGFDLMNNSPSEA
                     INQQFLDELYLAIKEK"
     misc_feature    231867..233558
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="aspartyl-tRNA synthetase; Validated; Region: aspS;
                     PRK00476"
                     /db_xref="CDD:234775"
     misc_feature    231867..232220
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="Asp_Lys_Asn_RS_N: N-terminal, anticodon recognition
                     domain of class 2b aminoacyl-tRNA synthetases (aaRSs).
                     This domain is a beta-barrel domain (OB fold) involved in
                     binding the tRNA anticodon stem-loop.  Class 2b aaRSs
                     include the homodimeric aspartyl-; Region:
                     Asp_Lys_Asn_RS_N; cl19106"
                     /db_xref="CDD:267459"
     misc_feature    order(231903..231905,231957..231959,232020..232022,
                     232119..232121)
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="Dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239766"
     misc_feature    order(231912..231914,231918..231923,231939..231941,
                     231972..231974,231975..231977,232008..232010,
                     232089..232091)
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:239766"
     misc_feature    232230..233474
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="Asp tRNA synthetase (aspRS) class II core domain.
                     Class II assignment is based upon its structure and the
                     presence of three characteristic sequence motifs. AspRS is
                     a homodimer, which attaches a specific amino acid to the
                     3' OH group of ribose of...; Region: AspRS_core; cd00777"
                     /db_xref="CDD:238400"
     misc_feature    order(232239..232247,232254..232256,232263..232268,
                     232275..232277,232284..232295,232299..232319,
                     232338..232340,232347..232361,232371..232382,
                     232425..232430,232437..232442,232458..232460,
                     232470..232472,232500..232502,232530..232532,
                     232545..232547,233343..233345,233352..233357,
                     233361..233372,233454..233459,233463..233465)
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238400"
     misc_feature    232305..232319
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="motif 1; other site"
                     /db_xref="CDD:238400"
     misc_feature    order(232329..232337,232395..232397,232401..232403,
                     232410..232412,232467..232469,232473..232475,
                     232488..232496,232503..232505,232509..232511,
                     233139..233144,233241..233243,233250..233252,
                     233262..233264,233388..233393,233397..233399,
                     233406..233408)
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="active site"
                     /db_xref="CDD:238400"
     misc_feature    232464..232475
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="motif 2; other site"
                     /db_xref="CDD:238400"
     misc_feature    232758..233012
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="GAD domain; Region: GAD; pfam02938"
                     /db_xref="CDD:251630"
     misc_feature    233397..233408
                     /gene="aspS"
                     /locus_tag="MGF_1373"
                     /note="motif 3; other site"
                     /db_xref="CDD:238400"
     gene            233575..235743
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /db_xref="GeneID:12396539"
     CDS             233575..235743
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /EC_number="3.1.7.2"
                     /note="MGF_1389"
                     /codon_start=1
                     /transl_table=4
                     /product="Guanosine polyphosphate
                     pyrophosphohydrolases/synthetase"
                     /protein_id="YP_005880478.1"
                     /db_xref="GI:385326041"
                     /db_xref="GeneID:12396539"
                     /translation="MDFQSVNNRLEDFKQILIKNNYSEASIKKFLSAFEFAKFWHADQ
                     KRKSGEPYIIHPLETSIKLAEWRMDDDTIIAGLLHDLLEDTSVDKRLISSTFNNNVLD
                     LVKAVTKISSEAKKNREGLLLHKNELDYTIRVFSSISKDLRPIIIKIADRFHNLSTIQ
                     YLKSDRQKIIAQETFDIYAQIAGRLGMYWIKTQLLDITFKIINPTAFDDTQSLINAHK
                     LINSLKWINFEQQIKKILDGNHLNYELTSRIKSVYSTYQKLNYRHNSQNIKNIHDIYA
                     LRIIVENEFDVYQVLGLVHLNFKYIPRLFKDYICAPKNNLYQSIHTTVLVDGTLIEVQ
                     IRTKSMDRNSNLGLASHWAYKLNIDISETDEYKTEVLNRFQVDIFNEKRARDLTLIKD
                     LTKGSLIDVLVSNNNKNYSLSSSVTALELAYRVDPKQFIFLDKIMCSNDNILFDKLLE
                     DGDVVSFEYSNEIKINESWLKRIKNPAIKKELIAIIEQLNQYEDSEKEFLEKLRKHLK
                     KNVISQNDILERVKILGFKRLSDYVKYVNKTNFTDNEQYDFFSKNYNWKKILKKLKVH
                     KPKWLFLNSYFKEIPGINFASIKISTCCSILPYIPSAGLIQKNILNVHSPNCKNIKKL
                     NNEKIIALHWSEEKLAARPRLFRSYVKLQGAWSGNVVNDILLIIINNNAKLFSLNVTK
                     DKKNNTFMADLGIYVQDMRHLNFIMDEITLKDMSFNWNLL"
     misc_feature    233671..235731
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="(p)ppGpp synthetase, RelA/SpoT family; Region:
                     spoT_relA; TIGR00691"
                     /db_xref="CDD:213552"
     misc_feature    233671..234138
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="HD domain; Region: HD_4; pfam13328"
                     /db_xref="CDD:257658"
     misc_feature    234253..234600
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    order(234316..234318,234322..234324,234391..234396,
                     234406..234408,234490..234492,234496..234498,
                     234511..234513,234517..234519,234523..234525,
                     234535..234537,234568..234570,234574..234576,
                     234580..234582)
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    order(234316..234318,234490..234492,234496..234498,
                     234511..234513,234517..234519,234523..234525,
                     234535..234537,234568..234570,234574..234576)
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    order(234391..234393,234568..234570)
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    235549..235704
                     /gene="spoT"
                     /locus_tag="MGF_1389"
                     /note="ACT domains are commonly involved in specifically
                     binding an amino acid or other small ligand leading to
                     regulation of the enzyme; Region: ACT; cl09141"
                     /db_xref="CDD:263730"
     gene            235751..237373
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /db_xref="GeneID:12396540"
     CDS             235751..237373
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /EC_number="6.3.4.2"
                     /note="MGF_1401"
                     /codon_start=1
                     /transl_table=4
                     /product="CTP synthase"
                     /protein_id="YP_005880479.1"
                     /db_xref="GI:385326042"
                     /db_xref="GeneID:12396540"
                     /translation="MTSKKTKYIFVSGGVYSSVGKGLIVASIASIFKHQNFKINILKL
                     DPYLNVDSGTMSPYEHGEVFVTSDGTETDLDLGYYERFLVQDLNERSSITSGKVYFSV
                     INKERKGEYLGKTVQLIPHVTNEIKRRIALAATDENNQSYDLVFCEIGGTIGDLESLP
                     FIEAIKQIIRENNKHDTAFIHVVPIISLSNSEQKTKPLQHSLKELNNLGINPDFLVIR
                     SKESLDLKTKHKIASATYLNKDHIFNSVDLNNTYFLPDYLNQQKIHEKIANKLQITID
                     PKIKLSAWDDLAKKINNQDNLVRKIAIIGKYTQFKDAYLSLIESLNLAGYHNHVKLEI
                     DWIESSLYDDASLEEVNHKLKDVHGIIVPGGFGSRGVEGKIKFIQVARTKKIPFLGIC
                     LGMQLACVEYARNVLGMTDANSSEFNSQTTYPIFKIMNPDDLNYGGSLRLGDYLVSLK
                     DQTLTKAIYQQDSIKRRHRHRYEFNNDYLNQFNDGEFIVSGIYLQENLVETIELKNHP
                     FFIGCQYHPEFSSKITAAEALFDSLVKKIKML"
     misc_feature    235763..237364
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="CTP synthetase; Validated; Region: pyrG; PRK05380"
                     /db_xref="CDD:235437"
     misc_feature    235766..236602
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="CTP synthase N-terminus; Region: CTP_synth_N;
                     pfam06418"
                     /db_xref="CDD:253716"
     misc_feature    236648..237352
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cytidine Triphosphate Synthetase; Region:
                     GATase1_CTP_Synthase; cd01746"
                     /db_xref="CDD:153217"
     misc_feature    order(236837..236851,236924..236929,236936..236938,
                     236996..236998,237155..237166,237296..237298,
                     237302..237304)
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="active site"
                     /db_xref="CDD:153217"
     misc_feature    order(236843..236845,236927..236929)
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="putative oxyanion hole; other site"
                     /db_xref="CDD:153217"
     misc_feature    order(236924..236926,237296..237298,237302..237304)
                     /gene="pyrG"
                     /locus_tag="MGF_1401"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153217"
     gene            237384..240314
                     /locus_tag="MGF_1410"
                     /db_xref="GeneID:12396541"
     CDS             237384..240314
                     /locus_tag="MGF_1410"
                     /note="MGF_1410"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880480.1"
                     /db_xref="GI:385326043"
                     /db_xref="GeneID:12396541"
                     /translation="MKVSFDYLLKSFIIFVLMVLSIVGITFGSIKTAELTPKGRFYNG
                     DINTTIYFSPYELKTDENQNNGVQLNQTFDFSQPRNAEQTELIPQQAWTNLANSYSQK
                     LFALGFSEINVAFNDNIPLPANNQVDRSWLNSNNTLPALVISVNKTLEKTPNERERIF
                     DERLKRTIQTTLNNQYNLTLETTDGYVLLDNNEIIKDSIRVIQPSASSTNSGLSFEVK
                     LKNNQKFSSNSDNSNQVLDYFVNLIPKSSDYFTSNGQGSVEDIRNRLFVSNNTTDVLG
                     NRNLVLWNDKLGALNYVRNIFNVVQNSNQWFALNNTEQALWNFLHATGGYEPSANVKN
                     LVAPFKSAQDIQLNDLYYIYAEPKAYVAAAADAKDKPEEITTPQGSRNPRSSTPTDFS
                     GLFSPFILYELRTTNVDGSESQLLNSLFPTNITINNNGDAVLSLTQRLNSSATYMNFD
                     YNQANSLATLIRESSPNNTFYVVDNSSTINQPLVNKTFINLSQYQSGFLAVGIILLFL
                     SLIMIVGFKVQGFFGIFGLILSAVITFLIYSRFNAFVDLFSFIGLIGVIIFNFLVQLF
                     INLNFKRNVSNKISLLESWRSTHNKTFLKVVDLYLILLVIGLFMSFISKYESQSIGIL
                     LIISSLIGFFINYGLSVLLVKIFNSINNFSPKFYLYKHTYKNLESISGNLSKDAMAFN
                     DLVITIDEQVDKTFSKNYKYQIMDKRSLVALLLFVGLIILGGFALSNFINRSFFINSD
                     SLYDSLNTILIALGSTTLIGLAYFLLRYQWIVIIGYLFYGLVNFGIILGVLFLSRNIV
                     SSEFGYLFLLISLFSYIYSLANFVFVTTNLYSYFNLQEIYQPQSVKKIVNNTAVATID
                     LYLYSTIISTAVYFIFYGLNYGGGGLNLNDEFNQQLVYFGVFSLFNVSLININAIFLL
                     NPLIGLLMIKKSNTNSIYWSKVSLKTKQEEKNFDLIDEQLLEGINLHKRSSRVVYQEP
                     KADN"
     misc_feature    237852..>238130
                     /locus_tag="MGF_1410"
                     /note="6-carboxyhexanoate--CoA ligase; Region: BioW;
                     cl00625"
                     /db_xref="CDD:260540"
     misc_feature    238782..>239054
                     /locus_tag="MGF_1410"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            240318..240854
                     /gene="apt"
                     /locus_tag="MGF_1430"
                     /db_xref="GeneID:12396542"
     CDS             240318..240854
                     /gene="apt"
                     /locus_tag="MGF_1430"
                     /EC_number="2.4.2.7"
                     /note="MGF_1430"
                     /codon_start=1
                     /transl_table=4
                     /product="Adenine phosphoribosyltransferase"
                     /protein_id="YP_005880481.1"
                     /db_xref="GI:385326044"
                     /db_xref="GeneID:12396542"
                     /translation="MKTELIAQLKKTIITVKDFPKPGILFYDITPILLDPKLFDQVIS
                     VMAEVAKKSNADMIASPESRGFLFGVPLANKLKLPFVLVRKQNKLPRATFSASYDLEY
                     GKNNVIEIHQDAIKPNSKVMIVDDLLATAGTVDAISRLVKQAKSEVVSYSFLIRLKDL
                     GGIDKLDQTKAIDYILEY"
     misc_feature    240441..240848
                     /gene="apt"
                     /locus_tag="MGF_1430"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(240501..240503,240507..240509,240690..240698,
                     240702..240716,240786..240788)
                     /gene="apt"
                     /locus_tag="MGF_1430"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            240938..241720
                     /locus_tag="MGF_1435"
                     /db_xref="GeneID:12396543"
     CDS             240938..241720
                     /locus_tag="MGF_1435"
                     /note="MGF_1435"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880482.1"
                     /db_xref="GI:385326045"
                     /db_xref="GeneID:12396543"
                     /translation="MLNRQFIPNSFLQQEVSFVKKAFLKSHLYAGIAFLLSFFAALII
                     TTIAQRTGLTNSLGFLIASSVSLTVGFLIVIISSFWLNVYRSMRTLVSIYLFSWVFLT
                     FGLSGVLLSVDNYNIRELEGIDLTQINTALLIVGLVYIVTSFLGYKMSNKAGFRLAKF
                     LFVLFIVSSIIILVVNIVFIFGINQGVFSLYFLLITILSLVFSVLALILSSFMTRKVA
                     ESIQLSDNEQLINNFIAYTSFILFFRLFILFIDILRIISYRR"
     gene            241781..242254
                     /locus_tag="MGF_1439"
                     /db_xref="GeneID:12396544"
     CDS             241781..242254
                     /locus_tag="MGF_1439"
                     /note="MGF_1439"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880483.1"
                     /db_xref="GI:385326046"
                     /db_xref="GeneID:12396544"
                     /translation="MSNHKPPILKRFLVGLAFFVFFLVLLFGFIYLFFSLLWYDKEFN
                     PVKLYENFFSNQALTWFKRDGTYEWGRASYREFATMLPDPESPFGKIKNFIPVLYNAD
                     SFLGTDNNQLKAGFFGYFIPLGISFVSSLFVSLIIYAIVRAIVRSIVKRNQRAQN"
     gene            242326..242805
                     /gene="greA"
                     /locus_tag="MGF_1441"
                     /db_xref="GeneID:12396545"
     CDS             242326..242805
                     /gene="greA"
                     /locus_tag="MGF_1441"
                     /note="MGF_1441"
                     /codon_start=1
                     /transl_table=4
                     /product="Transcription elongation factor greA (Transcript
                     cleavage factor greA)"
                     /protein_id="YP_005880484.1"
                     /db_xref="GI:385326047"
                     /db_xref="GeneID:12396545"
                     /translation="MAKTKKHLLTQEGLKKLQAELRLLVDVKRADVIKLIQEAREQGD
                     LSENADYDSAKATQSEIESRITEIQDILNHYEIIKEVDTKNKRVIVGAKVTIHDHSDE
                     CNYTYEIVGPIESDPAENKISHESPVAKAIMDKKEGESAEVIGIEHPYKVTIKKIVL"
     misc_feature    242332..242796
                     /gene="greA"
                     /locus_tag="MGF_1441"
                     /note="transcription elongation factor GreA; Reviewed;
                     Region: greA; PRK00226"
                     /db_xref="CDD:234693"
     misc_feature    242350..242556
                     /gene="greA"
                     /locus_tag="MGF_1441"
                     /note="Transcription elongation factor, N-terminal;
                     Region: GreA_GreB_N; pfam03449"
                     /db_xref="CDD:251961"
     misc_feature    242578..242796
                     /gene="greA"
                     /locus_tag="MGF_1441"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            242896..242981
                     /gene="trnY"
                     /locus_tag="MGF_tRNA17"
                     /db_xref="GeneID:12396546"
     tRNA            242896..242981
                     /gene="trnY"
                     /locus_tag="MGF_tRNA17"
                     /product="tRNA-Tyr"
                     /note="MGF_tRNA17; anticodon:GTA; Tyr-tRNA; predicted with
                     tRNAscan-SE v., cove score=76.96"
                     /db_xref="GeneID:12396546"
     gene            242985..243059
                     /gene="trnQ"
                     /locus_tag="MGF_tRNA18"
                     /db_xref="GeneID:12396547"
     tRNA            242985..243059
                     /gene="trnQ"
                     /locus_tag="MGF_tRNA18"
                     /product="tRNA-Gln"
                     /note="MGF_tRNA18; anticodon:TTG; Gln-tRNA; predicted with
                     tRNAscan-SE v., cove score=65.57"
                     /db_xref="GeneID:12396547"
     gene            243065..243139
                     /gene="trnK"
                     /locus_tag="MGF_tRNA19"
                     /db_xref="GeneID:12396548"
     tRNA            243065..243139
                     /gene="trnK"
                     /locus_tag="MGF_tRNA19"
                     /product="tRNA-Lys"
                     /note="MGF_tRNA19; anticodon:TTT; Lys-tRNA; predicted with
                     tRNAscan-SE v., cove score=82.93"
                     /db_xref="GeneID:12396548"
     gene            243149..243234
                     /gene="trnL"
                     /locus_tag="MGF_tRNA20"
                     /db_xref="GeneID:12396549"
     tRNA            243149..243234
                     /gene="trnL"
                     /locus_tag="MGF_tRNA20"
                     /product="tRNA-Leu"
                     /note="MGF_tRNA20; anticodon:TAA; Leu-tRNA; predicted with
                     tRNAscan-SE v., cove score=68.12"
                     /db_xref="GeneID:12396549"
     gene            243239..243312
                     /gene="trnG"
                     /locus_tag="MGF_tRNA21"
                     /db_xref="GeneID:12396550"
     tRNA            243239..243312
                     /gene="trnG"
                     /locus_tag="MGF_tRNA21"
                     /product="tRNA-Gly"
                     /note="MGF_tRNA21; anticodon:TCC; Gly-tRNA; predicted with
                     tRNAscan-SE v., cove score=75.59"
                     /db_xref="GeneID:12396550"
     gene            243697..245127
                     /locus_tag="MGF_1453"
                     /db_xref="GeneID:12396551"
     CDS             243697..245127
                     /locus_tag="MGF_1453"
                     /note="MGF_1453"
                     /codon_start=1
                     /transl_table=4
                     /product="putative amino acid permease"
                     /protein_id="YP_005880485.1"
                     /db_xref="GI:385326048"
                     /db_xref="GeneID:12396551"
                     /translation="MTKKTFNDRTFALLTINYVVGFGFIATIVDIVNIGYWAILILFL
                     TSFIATATAFAFSRLISAFPNETGGSISYAKKTNYKFLTCFTGFNQYVQVPLFAATGP
                     LFLVRIAEVLTANETTLWIVRGVSIAFYISLVLLVVLRVRVSKWFIFATAIIKWISLG
                     IGIIGLVILVARNASNLVENFKNVKDVNAYLIFSTIITFMFAFGGVETTPNIANNVQF
                     NKFSKALIIAIVTIIGFYTIAYILFLNLNLNLISDGFIQVYKTVLGTTGLVIFSIYLL
                     FYNISSTMTSTLANPKVLVSAAQIGFLPSFLTRTNRFNQHRNAIITNAVLIIVSMFIF
                     TLLPMFLKLNTNFFRNVINMGTIAFLLQYVLSFITIFVLVKQKKITNIRWWELLFYGL
                     AVLFILVPSLIYLFPFLVGQSWTVENTITIVTYSIFFLVFLIYFFIANHKNKINLDAK
                     IEEPQEDENVVVNQENQQLNENKGTV"
     misc_feature    243724..244980
                     /locus_tag="MGF_1453"
                     /note="Amino acid permease; Region: AA_permease_2;
                     pfam13520"
                     /db_xref="CDD:257840"
     gene            245235..245657
                     /locus_tag="MGF_1460"
                     /db_xref="GeneID:12396552"
     CDS             245235..245657
                     /locus_tag="MGF_1460"
                     /note="MGF_1460"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA-binding ferritin-like protein"
                     /protein_id="YP_005880486.1"
                     /db_xref="GI:385326049"
                     /db_xref="GeneID:12396552"
                     /translation="MQENVKDLLTLQASLFVLETKVRNFHWNIKGDDFFPVHEELGKL
                     YEEAADKVDLVAEKIVMLENTAYGSYKEALKNSLLKEESAKPISSKELFKVLQKDLKT
                     ILEFIGKMQKISYRVQPILDEIILFLDMWLWKVTKSLA"
     misc_feature    245256..245633
                     /locus_tag="MGF_1460"
                     /note="DPS protein, ferritin-like diiron-binding domain;
                     Region: DPS; cd01043"
                     /db_xref="CDD:153102"
     misc_feature    order(245289..245294,245304..245306,245310..245315,
                     245346..245348,245379..245381,245391..245393,
                     245400..245405)
                     /locus_tag="MGF_1460"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(245310..245312,245346..245348,245358..245360,
                     245391..245393,245403..245405)
                     /locus_tag="MGF_1460"
                     /note="DPS ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(245577..245579,245598..245603)
                     /locus_tag="MGF_1460"
                     /note="ion pore; other site"
                     /db_xref="CDD:153102"
     gene            246018..247985
                     /locus_tag="MGF_1467"
                     /db_xref="GeneID:12396553"
     CDS             246018..247985
                     /locus_tag="MGF_1467"
                     /note="MGF_1467"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880487.1"
                     /db_xref="GI:385326050"
                     /db_xref="GeneID:12396553"
                     /translation="MRRKNILKFVSLLGIGSFVMLAAASCTSAPAPAPTPTPTPTPTP
                     TPTPNPNPGDEAAARELTAARASLTSLLNSKNTNVEMYADYAKIQNALKSAYTTAEQT
                     SQNSSTTLEQVKSATSNLQTAIDKAATDKKNFDQSHNELLMAYRNLKTTVSQKSATVS
                     SLGLSNPQYSAILKKVNASYQAAEKILSATLDPISGPAPTPKSIAQAGNSISIETNPE
                     TLKPFKTNADMFNSYQFYKLDSTKLTDVQSKNTMPSNYSFVGYSVGLDNANWSFAQRT
                     VWTNGSDTGSTTRLLNQSADSAQATQPEGASNPEATATKLLTDVSWIYSLTGTNAKYT
                     LKFTYYGPETGYLYFPYKLIKQADSNNLGLQYKLNTAAQPTPIIFGTQANASGPAATV
                     DSINIAKVMIPGLAFGENTIELSVPATKVAPMIGNMYFTSNANSQGTIYNQIFGNTES
                     NESNSTVVSVNLLKGYGLAADWSTYIAEYSGAGLTLNNEKKADEKYYLIGFVGGTSER
                     RIYSITENVQKLPSSVTNQNSRTYTFYVNAPKAGAYYIKGVFTSGISRDLKFSTEDMS
                     SNNNVTVKQLSTGNYSTITLRTFDTSATKGPTQVTTDSTGRKTLTLVEGLNKIVVSGA
                     TENMGNAPNFGYLEFILNETQPETTNVSNPS"
     misc_feature    246672..247946
                     /locus_tag="MGF_1467"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            248321..250951
                     /locus_tag="MGF_1483"
                     /db_xref="GeneID:12396554"
     CDS             248321..250951
                     /locus_tag="MGF_1483"
                     /note="MGF_1483"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880488.1"
                     /db_xref="GI:385326051"
                     /db_xref="GeneID:12396554"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTQATTPTPNPKPTPNPNP
                     PSGGMNGGNTNPGNGGGMDNSAKQLAAAKTEAKAVIDASAELSDSVKEALKRQVDATT
                     TGPAARDLKTKAEALVSAVKALSGSVTAAKTLQAEEQYTNVSQDFKTTLEAKLTAATA
                     LLEDGTKLKNLDASGNLDTTKASLESSKTDLDAAVAAVKPELTFAKTKASVVKTASEL
                     RPLVNEALLAELQKQANDLPKNDQSKADKLDSELKSLKASLTSLQDLVSKGLAMQVDY
                     PQKYYDADNKDAFDAALLKASSVFPAFKWTAESIMVPDPTNGALPNPRAWTKARDKSE
                     FKLQNFVMAPAQAAAPTPTEPAAAESASAIVRVANGEAASPDGAVSREAQTTPAPAPM
                     ADLASTVSYLKSLNDSLKAESDKLNGDTTTNKTAYYKLVEGRTLYWDGFMPKIVVEGY
                     QPAGHGSNKDTNETTNREKLKAWFGKESNWTGLSEQLTKKLGAERFKNVKLTFKDVIY
                     ETISTGSDVKIPKVTFTVAAKDGYQLGNEKGTTTTLELKIRVLYTSQNQTQNALKYQG
                     VSFSREPSQTRTINDANVKANVNVYLNYTGPAIVLDADLPAVGSANNTTINGTSPIKD
                     TDLATKVKALLNKTANQNDPTDLMKAITKYVQTFDPKYLSTRTDNGYRAWVSWMQVED
                     KGNGKVLHQRELKQPADIFLQQMKDDTEAVYLAIGGTTDDQWLNAFLIRIPLTKFVKP
                     LTTFTATPASAPAQTGSGTGSTQQAQSSSTTDTTQTDGNSTSKTTDYGTKDDQSQTSN
                     TVSKEGSGDSSENGETHSTTSTTTSGTTTTSNKSSSSESQTSSSGSSTTKTESTATSG
                     TGSTQQAQSSPTTGTSSSSN"
     misc_feature    248510..248665
                     /locus_tag="MGF_1483"
                     /note="GA module; Region: GA; pfam01468"
                     /db_xref="CDD:201812"
     gene            251356..253422
                     /locus_tag="MGF_1500"
                     /db_xref="GeneID:12396555"
     CDS             251356..253422
                     /locus_tag="MGF_1500"
                     /note="MGF_1500"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880489.1"
                     /db_xref="GI:385326052"
                     /db_xref="GeneID:12396555"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTQASTPTPTPTPTPTPTP
                     TPNPEPKPNPGGGDTNNPPSGGMNGVDTNPGGGQGMMNATNQELVNAKKALSDLIGGE
                     SKTVELYADYAKIKADLTSAYAVAKTTSDSSTSTLDQVKTATSTLQTAINTAASDKEK
                     FDQQNSQLLMAYKVLKDTLNKKEAIVMSLNQEKYSAILSEINAASSTAEEIVKQTLNP
                     VNGNLPVVDTLNAENTKILEAIKEEKINSEKSNADLFANYQLYKLDRTKLMSEGSNNT
                     KQPGNYSFVAYASDIASPNWNFAQRTVWTADSRTWTSPLPNNSQNSAPLTDVSWIYTL
                     SGTGAKYTLTFDYYGPQTGYLYFPYKLAKTSDKVGLQYKLNQADPVAIQFSEAAATAS
                     APAETDGRQESAETTTANEKVNPMPSVNTINVAKVTLSNLKFGSNTIEFSVPMDQDNM
                     NKVAPMIGNIYITSSNDEANKKQIYDSIFGNTSSQTASQTSVSVDLLKGYSLATSWST
                     YIRQFTGLTGNGVQTSDFVYLIGLIGGSQNRTVASGPMNIKNIPNMNGATRTFTIYAN
                     APVNGNYHISGAYLQGANQARSLKFSTGTSGSNNEVTVTGLKQKNWTTLGHFDTKMTS
                     TTVSGTGTPMKRTLTLNQGLNKIVVSGVNNGDTPFIGNLTFTLESNQTISEQVEPSSA
                     TAEKNI"
     misc_feature    252085..253362
                     /locus_tag="MGF_1500"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            253708..255777
                     /locus_tag="MGF_1517"
                     /db_xref="GeneID:12396556"
     CDS             253708..255777
                     /locus_tag="MGF_1517"
                     /note="MGF_1517"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880490.1"
                     /db_xref="GI:385326053"
                     /db_xref="GeneID:12396556"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPTPNPEP
                     NPMPNPGGGVGMSDGNTNPGNGGGMMGDNPNPGNTTPKQQLAAARKTLTDLLGTENTN
                     VALYADYAKIQSTLSTAYMTAKTASENTSATLDNLRSASTTLQAAIDKAASDKRAFDS
                     ANQSLVAAYNNLKTTLQSKTTSLEGLSENKYSGIKNHLSKLFDTGSAITARTLDPTSG
                     ERPTLLEKVNEANNGIKMAISSESLNKWKTNADKFNDFEKNPLSKEKLESTNDTAHNQ
                     EQPANWSFAAYSVDLTSNSQNLPNWNFAQRKVWTSEGQEGGRTVLVSSPVSSTDVSWI
                     YSLAGEGTKYTLSFEYYGPDTAFLYFPYKLVKQADSNSVALQYSLNKASPKLINFQPV
                     RTEPANADSTTNETTTTGSSESRSSSEVLVADEAATSNNEMNPTPTVDSINIAKVTLT
                     GLAFGQNTIEFSVPTDQTNKVAPMIGNMFISSNSESQEKIYNQIFGNTSNLSTDSRSV
                     TVDLLKGYSLASGWSTYVGEFKRLTGANQTASDSQTSAPSYLVGFIAGHGQRTVDNVS
                     NIIRNPNIAGQKRTLAIYVNAPSDGQYGISGTYISNTSNRSLKFQTESDDANSVTITV
                     KAKTAWTELQTFNTSDMMVVQNNQTRTLHLKQGLNKIVISGSNDTPFIGNLTFTLNNT
                     PSSNSES"
     misc_feature    254410..255750
                     /locus_tag="MGF_1517"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            256126..258078
                     /locus_tag="MGF_1528"
                     /db_xref="GeneID:12396557"
     CDS             256126..258078
                     /locus_tag="MGF_1528"
                     /note="MGF_1528"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880491.1"
                     /db_xref="GI:385326054"
                     /db_xref="GeneID:12396557"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTTPTPNPTPNPNPPSGGM
                     NGGDTNPGDGQGMMNAASQELEAARMGLTTVFDSKAKNLGLYVDYKKTQQNLTKAYDA
                     AKTVLDNSSSTTQNLNEAKTRLETAIRTAATSKQTFDEQHAELVKVYKELKTTLSNET
                     ATLAPYEEAQYAGIKMHLSGLYDAGKAITTKTLEPVEGDPLTADVVMMANTKIVEAIK
                     DEVLNPQKENATKLADSFVKQVLVKEKITGVEEAHNKAQPANYSFVGYSVDITGTTTG
                     QTSIPNWDYAQRTIFTNGDEPRSISNTPADGQTMAQPLSNVSWIYSLAGTGAKYTLEF
                     TYYGPSTGYLYFPYKLVNTSDQMKLGLEYKLNDATEPSTITFGSEQTMNGKTPTVNDI
                     NVAKVTLANLKFGSNKIEFSVPAEKVSPMIGNMYLSSSPNNWNKIYDDIFGNSVTTEN
                     NRTIISVDALNGYSLASDWSTYIAEYSGAGLTLNDQAKPNEKYYLIGYVGGTGARNDM
                     MVPKNNVQKFPLASNTTNRNYVFYVNAPKAGAYYIKGVFASGDPRNLKFSAGDMSSNN
                     SVTIEQLSTDNLTTLRTFDTSATTAPTQVTTVANNRKTLTLVEGLNKIVVSGATANIG
                     SAPNFGYLEFILNETQPETTNDSNPS"
     misc_feature    256765..258039
                     /locus_tag="MGF_1528"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            258415..260535
                     /locus_tag="MGF_1542"
                     /db_xref="GeneID:12396558"
     CDS             258415..260535
                     /locus_tag="MGF_1542"
                     /note="MGF_1542"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880492.1"
                     /db_xref="GI:385326055"
                     /db_xref="GeneID:12396558"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCNSATTPTPTPNPTPNPEP
                     KPDPIPNPPSRGMNGGDTNPGDGQGMMNATNQELVNAKKALSDLIGGESKTVELYADY
                     AKIKADLTSAYTVAKTTSDSSTSTLDQVKTATSKLQTAIDKAASDKQKFEQDHKDLLM
                     PYSELKTTLSQKNATVVLLNQPKYSAILNKINSIYAQGEEVVIRTLNPVSGAIPTAAS
                     ITKVNDEINKAISENQLKPKKDNADAFANYQFFKLDKAKITGTSTNNTAQPQNYSFVG
                     YSVGVTGMQSGQTTIPNWNFAQRIVWSSGAPRAPLASQTETPPMSAPQGTEPAQQQGD
                     SSSKQASETQEVSPTPAAEGQAQQADTEQPATSQGTPLTDVSWIYSLSGTDVKYTFSF
                     NYFGPSMAYLYFPYKLVKSGDSVGLQYKLNNNNPVALNFGAEANANGPAASVDNINVA
                     KVNLANLNFGENKIEFSVPMNKVAPMIGNMYITSDVANQGAVYNQIFGNTNSSSDAAA
                     TSVTVDMLKGYSLASDWSTVISQYAGNDLTVDNMQKPNEKFYLVGYVGGKSPRTYRES
                     DVTMNVQKSPAVSDTNKRDYIFYVNAPKDGAYSIRGVYISGTQNTEMANSWLQFKTGD
                     ETNVLQVETPGNNNTEKAASGNWTTKLATFDTARENTKLNPKDKKTLNLKAGLNKIIV
                     NGKDGTGDAPNFGNITFTLMNPSM"
     misc_feature    259093..260523
                     /locus_tag="MGF_1542"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            260945..262603
                     /locus_tag="MGF_1558"
                     /db_xref="GeneID:12396559"
     CDS             260945..262603
                     /locus_tag="MGF_1558"
                     /note="MGF_1558"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type transport system ATP-binding protein"
                     /protein_id="YP_005880493.1"
                     /db_xref="GI:385326056"
                     /db_xref="GeneID:12396559"
                     /translation="MDTQEYALRMVDIHKSFNNGQIKANSGINLSVKRNEIHAIIGEN
                     GAGKSTLMSILFGLYKQDKGQIYVWGKEVNFKSSKDASKAKIGMVHQHFKLIENFKVI
                     DNIILGSETTKAGIIHYKKSFNKLKKIIDEYNFKIDLNAKVSSLTVGEQQKVEILKVL
                     YRDADLLIFDEPTAVLSDNEIESFLEILREFKAKNKTILIISHKLHEIKAIADNATII
                     RKGEYVDSVDVKRTSIEEMAELMVGRTIIPSINDSPVTSDEVVLSVRDLNLDTKTAEE
                     KYDELLNKASSVTKTTFTKGWQKAKQTWEKLSSSNRDKSKINFEIKKGEIFAVAGVEG
                     NGQSKLIEIISGLKKSEPNKIFFRDNNKLVDISKLSIKKRSRLGISFVPEDRHKHGLT
                     LDENVRLNSVNNLIDKKPFSDKGFIVPFEIAKYAQDIIDKFDVRGTANGTALSRSLSG
                     GNQQKLIIGREMSKKHELLILAQPTRGLDVGAIEYIHGQIIEAKKQGKAVLLVSYELD
                     EIMALADTIAVISRNNFIGIGSKEEMTRSKIGQLLAGEAMNESI"
     misc_feature    260957..262579
                     /locus_tag="MGF_1558"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    260966..261622
                     /locus_tag="MGF_1558"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    261068..261091
                     /locus_tag="MGF_1558"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(261077..261082,261086..261094,261215..261217,
                     261452..261457,261551..261553)
                     /locus_tag="MGF_1558"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    261206..261217
                     /locus_tag="MGF_1558"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    261380..261409
                     /locus_tag="MGF_1558"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    261440..261457
                     /locus_tag="MGF_1558"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    261464..261475
                     /locus_tag="MGF_1558"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    261539..261559
                     /locus_tag="MGF_1558"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    261893..262510
                     /locus_tag="MGF_1558"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            262590..264239
                     /locus_tag="MGF_1567"
                     /db_xref="GeneID:12396560"
     CDS             262590..264239
                     /locus_tag="MGF_1567"
                     /note="MGF_1567"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="YP_005880494.1"
                     /db_xref="GI:385326057"
                     /db_xref="GeneID:12396560"
                     /translation="MNQFKKYPNFLIGFDRFFYRKEHKSTRRRILSIIVLILIALLVI
                     YGILVATNVNRYAFLSLFTRGLRDQKQQQDFITNIGIFTLAGLSFGFAMQVKIFNIGI
                     SGQMLAGASFAFIITHYLAKVGFAPAVGAQLITIILSMFVAAFVSVLTGLFKIYLKIN
                     EVVSAILLNWIILLIVGTIINNHFIDSTQRLNGNFLSVKFPDQYSFYVVNGPTFFTSN
                     TGWMWTIAVTAVSVVIVWVLLRFTVFGHKLKTTGLSSSSAEYFGYNKNLLQLSSFAIS
                     GALAGILGVVVYTGQASQAIDFSSVGRFGLSSVPIEGFNGIAISLIALNNPWGIVIVS
                     MLFSLISVGQGPANLPTPQTLSLTLGVLMYIISIYGLMNYLKPWRWIIIKIYGDKNIT
                     EYQNLENNMAALSEKHLFKVKKLQKDLNEQLNKQYGSKLKVALMVLINPIKILFLKEY
                     KEQINTYKNEYVQERVSIVNEFYHSCVFNSILATEKVIQDCESSKNQKLLHKLSKWNK
                     EERRIQKLAATLEDEMKMQVNKHIKTINEKISNLNINKEAR"
     misc_feature    262830..263690
                     /locus_tag="MGF_1567"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    263355..263411
                     /locus_tag="MGF_1567"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     misc_feature    263931..>264236
                     /locus_tag="MGF_1567"
                     /note="Spindle pole body component BBP1, C-terminal;
                     Region: BBP1_C; pfam15272"
                     /db_xref="CDD:259405"
     gene            264239..265171
                     /locus_tag="MGF_1577"
                     /db_xref="GeneID:12396561"
     CDS             264239..265171
                     /locus_tag="MGF_1577"
                     /note="MGF_1577"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC transporter permease"
                     /protein_id="YP_005880495.1"
                     /db_xref="GI:385326058"
                     /db_xref="GeneID:12396561"
                     /translation="MFSPTQLDQWLILAPALILGVFGGYLSERAGIVNIAINGTMTFG
                     ATFFVLFSNIFFRSMGGMLTTTYNWTFLASILLSALLSVPVGILFGVATIKLKADHVI
                     AGTGINLLATGIGQILSDRATTLFGRPSLDNVYNRTLRPNSVSTEAIIIFVLFIVFFI
                     ILYVVMNFSKIGLRYRAVGENPNAVDSQGINVTKYQWIGIILASVVAGSGGALFGYYQ
                     SGRSFAGDVDGVGFIALAILIVSGWKLLPITIIGLVFSSLLVYSTSTTSVNQSQIFLI
                     RTIPYSLTLATMLLLGKFSIGPKNVGNHFDKGLR"
     misc_feature    264287..265093
                     /locus_tag="MGF_1577"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    264785..264841
                     /locus_tag="MGF_1577"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            265251..265961
                     /gene="deoD"
                     /locus_tag="MGF_1584"
                     /db_xref="GeneID:12396562"
     CDS             265251..265961
                     /gene="deoD"
                     /locus_tag="MGF_1584"
                     /EC_number="2.4.2.1"
                     /note="MGF_1584"
                     /codon_start=1
                     /transl_table=4
                     /product="purine nucleoside phosphorylase"
                     /protein_id="YP_005880496.1"
                     /db_xref="GI:385326059"
                     /db_xref="GeneID:12396562"
                     /translation="MTPHIKAKKEEIAKTVIMPGDPLRAKWIAETFLEDYKLVNEVRN
                     MFAYTGKYKNKLVTVMGHGMGNPSIGIYTHELYNFYDVENIIRVGSCGALVKDVNLGD
                     VILESKAYSESPYAMLIGVDVVDKTNYPSAKLLELSRKTAHELKIKYHEGLVICEDAF
                     YQTLYTPKQANEKWNAIAVEMEGFALNANAQKAKKHAMTILTVSDSLVTHESMSTEKR
                     QTTFKNMMELALNVANKL"
     misc_feature    265251..265958
                     /gene="deoD"
                     /locus_tag="MGF_1584"
                     /note="purine nucleoside phosphorylase; Reviewed; Region:
                     deoD; PRK05819"
                     /db_xref="CDD:180275"
     gene            265967..266638
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /db_xref="GeneID:12396563"
     CDS             265967..266638
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /EC_number="4.1.2.4"
                     /note="MGF_1585"
                     /codon_start=1
                     /transl_table=4
                     /product="Deoxyribose-phosphate aldolase"
                     /protein_id="YP_005880497.1"
                     /db_xref="GI:385326060"
                     /db_xref="GeneID:12396563"
                     /translation="MSILNFNKLIDHTNLKANATYEEIERLCHEAIEYGFFSVCVNPA
                     YIRTAKKILLKSPVKVCTVVGFPLGQTFSEQKVYEAKTSIKMGADEIDMVINIPELIN
                     GCACVIDEIRQVKKVCGEKILKVIVETALLNEEQIRKATLACIDGGADFIKTSTGFST
                     RGASLNDIKIMQQASQNKILIKASGGISTARELIEFVKVGADRIGTSRSVKLMQELKT
                     MDLAK"
     misc_feature    265985..266587
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /note="2-deoxyribose-5-phosphate aldolase (DERA) of the
                     DeoC family; Region: DeoC; cd00959"
                     /db_xref="CDD:188646"
     misc_feature    order(266009..266011,266015..266017,266021..266023,
                     266093..266101,266162..266164,266186..266188,
                     266201..266203,266216..266227,266252..266254,
                     266258..266260,266312..266317,266357..266359)
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188646"
     misc_feature    order(266423..266425,266432..266434,266516..266524,
                     266579..266587)
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /note="active site"
                     /db_xref="CDD:188646"
     misc_feature    266423..266425
                     /gene="deoC_2"
                     /locus_tag="MGF_1585"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188646"
     gene            266649..267908
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /db_xref="GeneID:12396564"
     CDS             266649..267908
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /EC_number="2.4.2.4"
                     /note="MGF_1587"
                     /codon_start=1
                     /transl_table=4
                     /product="thymidine phosphorylase"
                     /protein_id="YP_005880498.1"
                     /db_xref="GI:385326061"
                     /db_xref="GeneID:12396564"
                     /translation="MNIIDIIEKKKTKQILTKEEIGFFIDGCVKKTIPDYQISALLMA
                     IWFNGLNDDELFYLTDFMIKSGKTLNFESDQKKLIDKHSTGGVGDKVSIALAPILACF
                     NFKVAKMSGRGLAHTGGTIDKLEAIGVDCFISLDQAKQILKTNDMFIIAQTNDLVLAD
                     KILYALRDVTATTDCLDLIASSIISKKFAINSDYIFIDIKYGLGAFCKTIDEANELKK
                     RMLNLAKKFNRHLKCELNDMNEVLGNSIGNAIEIKEAIAYLKNQLSQNNSFKILMDNL
                     VAEILVETKQFTTKKEALISLDQLLKTTKPFDKFISWIKSQIGNWQEIINDSYFQPKY
                     EYQLKAKKAGKISYSSPVDLAMVSVGLGSGRMIKDQPIDFQAGIYLHKKNHDQVSLDE
                     PIMSLYSSKPIDQVIIDKADKTIRYET"
     misc_feature    266649..267899
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /note="thymidine phosphorylase; Reviewed; Region: deoA;
                     PRK05820"
                     /db_xref="CDD:180276"
     misc_feature    266652..266849
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /note="Glycosyl transferase family, helical bundle domain;
                     Region: Glycos_trans_3N; pfam02885"
                     /db_xref="CDD:251593"
     misc_feature    266880..267440
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /note="Glycosyl transferase family, a/b domain; Region:
                     Glycos_transf_3; pfam00591"
                     /db_xref="CDD:249986"
     misc_feature    267681..267899
                     /gene="deoA"
                     /locus_tag="MGF_1587"
                     /note="Pyrimidine nucleoside phosphorylase C-terminal
                     domain; Region: PYNP_C; pfam07831"
                     /db_xref="CDD:116444"
     gene            267871..268302
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /db_xref="GeneID:12396565"
     CDS             267871..268302
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /EC_number="3.5.4.5"
                     /note="MGF_1597"
                     /codon_start=1
                     /transl_table=4
                     /product="Cytidine deaminase"
                     /protein_id="YP_005880499.1"
                     /db_xref="GI:385326062"
                     /db_xref="GeneID:12396565"
                     /translation="MIKQIKQLDMKHNELLRLLDKAYCVYSNFHVACILVDDQNKEYQ
                     GVNVEFASYPITLCAERNAIGTMITSSNSDHLPVIKQIHLMSDSNDSNASPCGMCRQA
                     LWEFSDDSTLITIYYKNQTKKTYQFKQLLPLGFNHKAMTAK"
     misc_feature    267895..268275
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /note="Cytidine deaminase [Nucleotide transport and
                     metabolism]; Region: Cdd; COG0295"
                     /db_xref="CDD:223372"
     misc_feature    267910..268254
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /note="Cytidine deaminase zinc-binding domain. These
                     enzymes are Zn dependent. The zinc ion in the active site
                     plays a central role in the proposed catalytic mechanism,
                     activating a water molecule to form a hydroxide ion that
                     performs a nucleophilic attack on...; Region:
                     cytidine_deaminase; cd01283"
                     /db_xref="CDD:238610"
     misc_feature    order(267955..267957,267961..267963,268009..268011,
                     268015..268017,268042..268050,268156..268158,
                     268165..268167)
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /note="active site"
                     /db_xref="CDD:238610"
     misc_feature    order(268042..268050,268153..268158,268165..268167)
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238610"
     misc_feature    order(268042..268044,268048..268050,268156..268158,
                     268165..268167)
                     /gene="cdd"
                     /locus_tag="MGF_1597"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:238610"
     gene            268304..269953
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /db_xref="GeneID:12396566"
     CDS             268304..269953
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /EC_number="5.4.2.8"
                     /EC_number="5.4.2.2"
                     /note="MGF_1601"
                     /codon_start=1
                     /transl_table=4
                     /product="phosphomannomutase"
                     /protein_id="YP_005880500.1"
                     /db_xref="GI:385326063"
                     /db_xref="GeneID:12396566"
                     /translation="MKELTTMNNTVKYWLVHPKVSKDLKAQIKAMSEQELAYAFNEKP
                     LGFGTAGIRQKMGPGYRYLNDFTYAQMAFGYGRFLIDKFGFSPRCVIAHDNRKNGVHF
                     AKIITDVLTSMGIEVYLFDNNKISSTPILSYAIPRYNADGGINVTASHNPKTDNGFKT
                     YNEKGAQLLNQDAQKIIDFMPKSCEILNLEYQPNDRLVKFIPDEIYDRYFADIYRDLY
                     TTDHKEVKDFKVIFTGQHGAASYWLPEMLRRFNYNVIPVKEQCKYDENFTYTKSPNPE
                     ARESWDLALKYAQHYGADIMLATDPDADRLAVAVKHNNEFRYFNGNEMGIIFAYYILK
                     YKQLTKRPYIVSSYVSTNLIDRIIAKYNGVVYRVGTGFKWIGNKAIDHKDQEDFILGF
                     EEAIGALPTTIGSDKDSFQTAALALEIYNECLKRKITMVDFLEREIYPQFGFIHNDTI
                     TTLINDLDWKKKANDWMERLKRYDQPYINDRKIVSIKWNQAGDCLDWILEDDSWIRFR
                     LSGTEPKFKFYYNLYGNSLKQLKEEANQITKTLKRYISLIK"
     misc_feature    268415..269947
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /note="Phosphomannomutase [Carbohydrate transport and
                     metabolism]; Region: {ManB}; COG1109"
                     /db_xref="CDD:224034"
     misc_feature    268433..269920
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /note="This CD includes PGM2 (phosphoglucomutase 2) and
                     PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2
                     is thought to be a phosphopentomutase that catalyzes the
                     conversion of the nucleoside breakdown products,
                     ribose-1-phosphate and...; Region: PGM2; cd05799"
                     /db_xref="CDD:100092"
     misc_feature    order(268445..268447,268451..268453,268460..268462,
                     268748..268756,268778..268780,269201..269203,
                     269207..269209,269213..269218,269348..269350,
                     269411..269419,269480..269482,269486..269488,
                     269492..269494,269825..269827,269831..269839,
                     269852..269854)
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /note="active site"
                     /db_xref="CDD:100092"
     misc_feature    order(268451..268453,268748..268750,269216..269218,
                     269348..269350,269411..269413,269417..269419,
                     269480..269482,269486..269488,269492..269494,
                     269825..269827,269831..269839,269852..269854)
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100092"
     misc_feature    order(268748..268750,269201..269203,269207..269209,
                     269213..269215)
                     /gene="cpsG"
                     /locus_tag="MGF_1601"
                     /gene_synonym="manB"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100092"
     gene            269974..270732
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /db_xref="GeneID:12396567"
     CDS             269974..270732
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /EC_number="5.3.1.1"
                     /note="MGF_1611"
                     /codon_start=1
                     /transl_table=4
                     /product="triosephosphate isomerase"
                     /protein_id="YP_005880501.1"
                     /db_xref="GI:385326064"
                     /db_xref="GeneID:12396567"
                     /translation="MNSMKRYIFGNWKTYKTTQEVKEFFSVLNQTKLTKNPDVVFGVA
                     PVFVHLGLANQLKRNECLVLAQDANYVMNKANTGTVSYEQLKDIGVNYVIIGHSERRK
                     LFHESDELINQKVKTLLENKMRPILCIGETLEEYEANKTKAVLKDQLEKDLKGIDSSL
                     LKDLIIAYEPVWAIGTGKTASSQTAQDAIAYIRTVLGLLSSKTIANELPILYGGSVTP
                     DNVSELLAQKDINGALVGGASLDPHKFIQLIEAK"
     misc_feature    269989..270723
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    order(270004..270006,270010..270012,270262..270264,
                     270478..270480,270496..270498,270616..270618,
                     270673..270675,270679..270684)
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    order(270004..270006,270013..270015,270112..270120,
                     270124..270126,270133..270135,270169..270171,
                     270223..270225,270232..270237,270268..270273)
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    order(270010..270012,270262..270264,270478..270480)
                     /gene="tpiA"
                     /locus_tag="MGF_1611"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            270736..272247
                     /gene="gpmI"
                     /locus_tag="MGF_1617"
                     /db_xref="GeneID:12396568"
     CDS             270736..272247
                     /gene="gpmI"
                     /locus_tag="MGF_1617"
                     /EC_number="5.4.2.1"
                     /note="MGF_1617"
                     /codon_start=1
                     /transl_table=4
                     /product="Phosphoglyceromutase"
                     /protein_id="YP_005880502.1"
                     /db_xref="GI:385326065"
                     /db_xref="GeneID:12396568"
                     /translation="MKKALLMILDGYGISSTTHGNAVKNAKTPHLDNLMNNNPTIMLQ
                     ASGEAVGLPKNQIGNSEVGHLNIGAGRIIYTGLSLINKEIENKKFFTNQALLNAIDHA
                     KKNNSKLHILGLVSNGGVHSHINHIYAIMELANQHNVPAILHIFGDGRDVPPTQLLAD
                     LDQLIKKAETTKTKIGTISGRFYAMDRDQRWDRIDLAYNNLLSNTGKSFADLKTYVKD
                     SYQQNITDEFIVPAYNNNYKSDEITIQDNDSVVFANFRPDRARQLSHYVFGSNYYDHH
                     PQLRRKNLYFVIMMQYEGINPSAICYPPKIEKNTLGEVLKNANKKQLRIAETEKYAHV
                     TFFFDGGVEVEYQNEDKVLVPSRKDVKTYDLAPEMSAAAIVDQLLKVYTKYDLTVLNF
                     ANPDMVGHTGNYEATLKGLEALDHEIGRLLADAKKNNITVFFTADHGNAEEMIDENNQ
                     KVTKHTTNVVPFSITDPNVKFTKKEGILANVAPTILKYLEIQIPEEMDQEPLI"
     misc_feature    270736..272244
                     /gene="gpmI"
                     /locus_tag="MGF_1617"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            272295..273134
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /db_xref="GeneID:12396569"
     CDS             272295..273134
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /EC_number="3.6.3.-"
                     /note="MGF_1624"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type cobalt transport ATP-binding protein"
                     /protein_id="YP_005880503.1"
                     /db_xref="GI:385326066"
                     /db_xref="GeneID:12396569"
                     /translation="MDNKNSVIKFENVSFSYNSKKQVLKNVSYEIYEKEYVCIVGHNG
                     SGKSTMSKLLTGILKPLAGTIYLFGYAISRDNIKFLRDNVGIIFQNPDNQFIGITAED
                     DIAFGLENRKIPRGEIKRIIDSVADKVGIKDILKFEPHKLSGGQKQRVAIASVLAINP
                     SIILFDESTSMLDPKGKKDIKSFMLQLRNQGKTVISITHDMEEVVNCDRVLVMDHGNL
                     IKQGRPDEIFKDKQFLRDINLDVPFSLDLAMQLNELDEKINSTLRYNELIDNICSRVD
                     QKD"
     misc_feature    272295..273113
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="cobalt transporter ATP-binding subunit;
                     Provisional; Region: cbiO; PRK13632"
                     /db_xref="CDD:237452"
     misc_feature    272319..272942
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    272415..272438
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(272424..272429,272433..272441,272559..272561,
                     272790..272795,272889..272891)
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    272550..272561
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    272718..272747
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    272778..272795
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    272802..272813
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    272877..272897
                     /gene="cbiO_2"
                     /locus_tag="MGF_1624"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     gene            273107..274063
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /db_xref="GeneID:12396570"
     CDS             273107..274063
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /EC_number="3.6.3.-"
                     /note="MGF_1629"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type cobalt transport ATP-binding protein"
                     /protein_id="YP_005880504.1"
                     /db_xref="GI:385326067"
                     /db_xref="GeneID:12396570"
                     /translation="MFKSWSKRLKYAPTPLVGDEVLRAQGLKCVFDEKTPEEFWALNG
                     IDFTFEKNKIYCIIGNSGSGKSTLVTHFNGLLTSKYGTLSIRDFKNNHDIVISPNTKK
                     IKNFKRLRKIISMVFQFPEYQLFKDTIQKDIMFGPVALGVHKEEAAKLAKFYLNRMGL
                     DSSYLDVSPFELSGGQKRRVAIAGILAIQSEIIIFDEPTAGLDPKGESEMVELILESK
                     KENKTVIVITHQMEKVLEIADEVILLDKGKILTSGTPYQIFTDPEIIQTTSIALPHVV
                     QVINDLSLRNPIFKKLYDYEPRTVKDLAKAINEVIKNYEKRN"
     misc_feature    273107..274051
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="cobalt transporter ATP-binding subunit;
                     Provisional; Region: cbiO; PRK13631"
                     /db_xref="CDD:237451"
     misc_feature    273224..273850
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="First domain of the ATP-binding cassette component
                     of cobalt transport system; Region:
                     ABC_cobalt_CbiO_domain1; cd03225"
                     /db_xref="CDD:213192"
     misc_feature    273281..273304
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    order(273290..273295,273299..273307,273458..273460,
                     273692..273697,273791..273793)
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213192"
     misc_feature    273449..273460
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213192"
     misc_feature    273620..273649
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213192"
     misc_feature    273680..273697
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="Walker B; other site"
                     /db_xref="CDD:213192"
     misc_feature    273704..273715
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="D-loop; other site"
                     /db_xref="CDD:213192"
     misc_feature    273779..273799
                     /gene="cbiO_1"
                     /locus_tag="MGF_1629"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213192"
     gene            274047..275216
                     /gene="cbiQ"
                     /locus_tag="MGF_1637"
                     /db_xref="GeneID:12396571"
     CDS             274047..275216
                     /gene="cbiQ"
                     /locus_tag="MGF_1637"
                     /note="MGF_1637"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type cobalt transport permease protein"
                     /protein_id="YP_005880505.1"
                     /db_xref="GI:385326068"
                     /db_xref="GeneID:12396571"
                     /translation="MKNAINGYILSNSVVHKTNPSIKLIIFIAFVVIIFLPTGLVFQL
                     IVLAIISLIFMISKLPFRIYWSTLKTIIIMFLFLFLINWFTYRNPGFLNISVWANNNH
                     SYILIGDYNDYSVANLYDYNFFKTESPMIMNTKTKMFITFDDLLSLVHQKRADLTPIQ
                     LQEYYRIAVPKVAGAELKQFEFNPNSLVLKPVLMFNWYALSFKTLFITLSIVLKIFMM
                     ILLATILTSSSTSIELTFGIEQLLSPLKLLKVPVNSLAMTISISIRFVPSLLLESQRI
                     LNAQASRGIDFKNGNTIERMRSLVSLIIPMVSIAFRNAGELANAMDARSYNPRFARTR
                     YRIFKVHALDLVVYTFLMVLLGFFIYVAASRVLFGVFGSPEWMTIGLGQNVGQVK"
     misc_feature    <274617..275126
                     /gene="cbiQ"
                     /locus_tag="MGF_1637"
                     /note="ABC-type cobalt transport system, permease
                     component CbiQ and related transporters [Inorganic ion
                     transport and metabolism]; Region: CbiQ; COG0619"
                     /db_xref="CDD:223692"
     gene            275149..275940
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /db_xref="GeneID:12396572"
     CDS             275149..275940
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /EC_number="5.4.99.12"
                     /note="MGF_1644"
                     /codon_start=1
                     /transl_table=4
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="YP_005880506.1"
                     /db_xref="GI:385326069"
                     /db_xref="GeneID:12396572"
                     /translation="MVYLVHQNEWRSVWVKTLAKLNKNVLINISYHGTKFHGYAVQND
                     YETVQSKLQDALAWIYESKIYVNASGRTDKGVHAINQYISFYIDDRISLEKLREILNR
                     YGQNKWYIKWIKEVDRNFHARFSAKAKTYLYLIDYCANNPLFYDHAWIVNFQLDFNLI
                     EKAIPILEGTHNFWSFSTADKDKGLRTINKINLKQEDNKVYIYITGDGFLRSMVRMIV
                     GALYNIGIKKYDLNHLKWLLDNPKKGRAITKAPASGLYLYEVYYE"
     misc_feature    275215..275934
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /note="tRNA pseudouridine synthase A; Validated; Region:
                     truA; PRK00021"
                     /db_xref="CDD:234577"
     misc_feature    275227..275934
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /note="Eukaryotic and bacterial pseudouridine synthases
                     similar to E.  coli TruA; Region: PseudoU_synth_EcTruA;
                     cd02570"
                     /db_xref="CDD:211337"
     misc_feature    order(275236..275238,275449..275451,275458..275481)
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /note="dimerization interface 3.5A [polypeptide binding];
                     other site"
                     /db_xref="CDD:211337"
     misc_feature    order(275356..275367,275791..275793)
                     /gene="truA"
                     /locus_tag="MGF_1644"
                     /note="active site"
                     /db_xref="CDD:211337"
     gene            276059..277081
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /db_xref="GeneID:12396573"
     CDS             276059..277081
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /EC_number="2.7.6.1"
                     /note="MGF_1651"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribose-phosphate pyrophosphokinase"
                     /protein_id="YP_005880507.1"
                     /db_xref="GI:385326070"
                     /db_xref="GeneID:12396573"
                     /translation="MNVKSNHIIFGLSAAKKLTDSICRRLSMKPGEIVIQKFADDEIF
                     VRPDCTLRNKDVVFIQSTNSPVNDNLMELLIAIDSAKRASAKSITALIPYYGYARQDR
                     KSAGREPITSKLVADLLTKAGATRVTLTDIHSDQTQGFFDIPVDTLKASFVLLSHVLV
                     DNKIDDLVVVSPDYGGVKRARKIAESINVPLAIIDKRRPKPNVAESINILGEVKNKCC
                     ILVDDMIDTGGTIISAAKLLKKQKAKTVLVMATHGLFNKNAIELFDECYKKKEINKVY
                     ITDTIDQTEKNLEKKPQFKVVKLDHFYSLVLDKYINGGSISDVYTIYQEWVKSPNLKK
                     ILKEIE"
     misc_feature    276068..277051
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /note="ribose-phosphate pyrophosphokinase; Provisional;
                     Region: PRK00553"
                     /db_xref="CDD:179062"
     misc_feature    276080..276427
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /note="N-terminal domain of ribose phosphate
                     pyrophosphokinase; Region: Pribosyltran_N; pfam13793"
                     /db_xref="CDD:258077"
     misc_feature    276518..276898
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(276575..276577,276581..276583,276722..276730,
                     276734..276748,276818..276820)
                     /gene="prsA"
                     /locus_tag="MGF_1651"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            277033..277593
                     /locus_tag="MGF_1657"
                     /db_xref="GeneID:12396574"
     CDS             277033..277593
                     /locus_tag="MGF_1657"
                     /note="MGF_1657"
                     /codon_start=1
                     /transl_table=4
                     /product="small primase-like protein"
                     /protein_id="YP_005880508.1"
                     /db_xref="GI:385326071"
                     /db_xref="GeneID:12396574"
                     /translation="MSKITKPKENSKRNRINEIIVVEGKTDTVKLKSLFDCETIETNG
                     SEISDQTISLIKELSLTRGVILFLDPDYQGKKIRAKLIKELKEYREAFIDLSELKDSK
                     KKGIAEASNEAVLSAFNNLVSSEHDSYQSLTWKEYLALNLNTKNKRIELCKKLNIPYG
                     NNKSLFRYLNLLKKNFDELKKLISEI"
     misc_feature    277075..277581
                     /locus_tag="MGF_1657"
                     /note="ribonuclease M5; Region: 5S_RNA_mat_M5; TIGR00334"
                     /db_xref="CDD:232924"
     misc_feature    277078..277311
                     /locus_tag="MGF_1657"
                     /note="TOPRIM_ RNase M5_like: The topoisomerase-primase
                     (TOPRIM) nucleotidyl transferase/hydrolase domain found in
                     Ribonuclease M5: (RNase M5) and other small primase-like
                     proteins from bacteria and archaea.  RNase M5 catalyzes
                     the maturation of 5S rRNA in low...; Region:
                     TOPRIM_RNase_M5_like; cd01027"
                     /db_xref="CDD:173777"
     misc_feature    order(277099..277104,277111..277113,277237..277239,
                     277243..277245,277249..277251)
                     /locus_tag="MGF_1657"
                     /note="putative active site [active]"
                     /db_xref="CDD:173777"
     misc_feature    order(277099..277101,277237..277239)
                     /locus_tag="MGF_1657"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173777"
     misc_feature    277339..277584
                     /locus_tag="MGF_1657"
                     /note="Domain of unknown function (DUF4093); Region:
                     DUF4093; pfam13331"
                     /db_xref="CDD:257661"
     gene            complement(277577..278782)
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /db_xref="GeneID:12396575"
     CDS             complement(277577..278782)
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /note="MGF_1666"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA polymerase IV"
                     /protein_id="YP_005880509.1"
                     /db_xref="GI:385326072"
                     /db_xref="GeneID:12396575"
                     /translation="MFLMDRKTIFHIDFDAFFASVEENFNPEYNNKPLVVGSKSNGSI
                     VSSANYIARKFGVRSAMPIFQAKKLCPSLIIAEVDYPKYERVSAYVFSYLRDFVSNKM
                     EVASIDECYMDVTDILEKNSEISASDLAKKIQKQIYELTQLTVSIGISSNLFLAKMAS
                     DQNKPNGVYEIWPDEIEEKLWPLEIKKMYLIGSKKIPLLNQLNIKNIGNFAQFENKEL
                     LIDIFKNMYWDHYNHAHGKGSDFVDYERNSRKSISVSKNIRHKVSDYESLLKLFNDLF
                     DDVYSRLKNHNLLAKNISVSIRTEKVRSLSFSFKQYSDKKTLFYNKAIDLFERLHNNQ
                     LVANISISFGNITNKYKFIPNINIYEELSQEQKDTMLLKKIVNQINKEYNKELVNIAD
                     DFDYFKFQK"
     misc_feature    complement(277793..278758)
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /note="Nucleotidyltransferase/DNA polymerase involved in
                     DNA repair [DNA replication, recombination, and repair];
                     Region: DinP; COG0389"
                     /db_xref="CDD:223466"
     misc_feature    complement(277745..278755)
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /note="DNA Polymerase IV/Kappa; Region: PolY_Pol_IV_kappa;
                     cd03586"
                     /db_xref="CDD:176459"
     misc_feature    complement(order(278291..278293,278459..278461,
                     278624..278626,278633..278635,278642..278647,
                     278729..278737,278741..278746))
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /note="active site"
                     /db_xref="CDD:176459"
     misc_feature    complement(order(277748..277750,277757..277759,
                     277769..277774,277859..277861,277865..277876,
                     277937..277939,278012..278035,278105..278110,
                     278198..278218,278312..278314,278456..278461,
                     278465..278467,278597..278599,278669..278671))
                     /gene="dinB"
                     /locus_tag="MGF_1666"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176459"
     gene            278888..279886
                     /locus_tag="MGF_1667"
                     /db_xref="GeneID:12396576"
     CDS             278888..279886
                     /locus_tag="MGF_1667"
                     /note="MGF_1667"
                     /codon_start=1
                     /transl_table=4
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_005880510.1"
                     /db_xref="GI:385326073"
                     /db_xref="GeneID:12396576"
                     /translation="MNETNSRSSEFYHVKNPLISILIPIYNNAKNIEITVSSALFQSY
                     KNVEIICIDDCSSDNSYQVLKRFETLEQNIRIYRNPIQRGKGFVYDQLIKYASGHFFM
                     FLETPNTLNQDAIKNMVSVVEQFTEIVIGRNMVGNTANPMKGMYDIPTNDKKISDRNS
                     IDYIFGNSFYTQGMLIKKSFFEALDMRYGRNPYIPDFYIKYDMLANCDFFRVVWKPTI
                     NFIESDNYYDFERFKFLEAKYRYILHQFPRMVEWFSNYVPIKDRLNDFKSSIITNIID
                     QVRIEYRSSVPSLREKFEQNIIIPLRNQYMASNYIFKVPNNLREKLKSGENKRLFR"
     misc_feature    278933..279664
                     /locus_tag="MGF_1667"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    278948..>279277
                     /locus_tag="MGF_1667"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(278957..278959,278963..278965,279041..279043,
                     279200..279202,279206..279208)
                     /locus_tag="MGF_1667"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            279905..281836
                     /gene="tktA_2"
                     /locus_tag="MGF_1673"
                     /db_xref="GeneID:12396577"
     CDS             279905..281836
                     /gene="tktA_2"
                     /locus_tag="MGF_1673"
                     /EC_number="2.2.1.1"
                     /note="MGF_1673"
                     /codon_start=1
                     /transl_table=4
                     /product="transketolase"
                     /protein_id="YP_005880511.1"
                     /db_xref="GI:385326074"
                     /db_xref="GeneID:12396577"
                     /translation="MVIKLIYQNKPFPKNSNSIVNNFRFLMFDTVNNNFVGSAAYGFG
                     AASYLYVLFRNYFVMDLDNLDANYNDKLVVSKQLGGSNIRACFYLLKHPDIKIEDLMS
                     FSHEKQIRNLYDFSTYQPGYNLAYAVGLAIDAKLVNQKSHDTITNKIYCIVSAADLNS
                     SYGLAALKTAANQELNNLIIIYDNNHFEERGENQDYLVTDFSSLVKDMGFKYINVFNG
                     NNIEKLDAGFHYAVNSKKPAFIDINTIVGHGYDSAGTKEVIKSSLTQDQLDQLTKRFE
                     YTGEEFMVLYETANDLYPNIKERVNKLKGLIADQVDQLKQNNLVIPNYLSAFKDWALS
                     EDQIDANQSLAKLKADLIRCQPNSVLLNVSDHDDEFEREVEAIDPSRIVLLGNWIELA
                     IIIANAISDNKIHLPVINLDINLIDKTIQNLKLEEKKDQILYLVDNCKELSRKYVNKV
                     IDLISREKDGIVLQPGTNEELKYSLCNFKAKNKDKTYIILPSSDDLISIQADKINFGG
                     YELYGDSYATVNIVTAGSDLIKALDLRQQLLENKITARIVSVISLTDFDQINAVSKSV
                     LLKNLPSYFISRADKVAWGYVLSQNQPEVDHKSTENTTYIKKPRRAQKSNNKIKTLDN
                     KTKVDESNKQLNATKEDKQ"
     misc_feature    279965..280651
                     /gene="tktA_2"
                     /locus_tag="MGF_1673"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    order(280262..280264,280364..280375,280457..280459,
                     280463..280465)
                     /gene="tktA_2"
                     /locus_tag="MGF_1673"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            281942..282163
                     /locus_tag="MGF_1683"
                     /db_xref="GeneID:12396578"
     CDS             281942..282163
                     /locus_tag="MGF_1683"
                     /note="MGF_1683"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880512.1"
                     /db_xref="GI:385326075"
                     /db_xref="GeneID:12396578"
                     /translation="MVLGLALGLSIPLCLIVGAFVGYFVSMKVFKRQMRKNPPITEAQ
                     IRSLYAQMGRKPSEAQVKQMMRAYTKETK"
     misc_feature    281942..282157
                     /locus_tag="MGF_1683"
                     /note="hypothetical protein; Provisional; Region:
                     PRK00523"
                     /db_xref="CDD:179056"
     gene            282169..282729
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /db_xref="GeneID:12396579"
     CDS             282169..282729
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="MGF_1686"
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase EngB"
                     /protein_id="YP_005880513.1"
                     /db_xref="GI:385326076"
                     /db_xref="GeneID:12396579"
                     /translation="MNRFIKSATSLKDCINDSKKEVCLIGRSNVGKSTIINGLANAKI
                     AQTSKTPGRTVTMNFYEISNQRIVDLPGYGYARIKKSQKEEISLFLSDYLNHRKNLVG
                     IFLILDLGVITDQDIEIVRLLTTLDVEYYIVFNKIDKYPKSAYINNKEKILDALKVNE
                     DRILLISAKNKQNLNNLMLKIIDVIS"
     misc_feature    282169..282711
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="Predicted GTPase [General function prediction
                     only]; Region: COG0218"
                     /db_xref="CDD:223296"
     misc_feature    282229..282723
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="YihA (EngB) GTPase family; Region: YihA_EngB;
                     cd01876"
                     /db_xref="CDD:206665"
     misc_feature    282244..282267
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    order(282250..282270,282307..282315,282322..282330,
                     282373..282375,282574..282576,282580..282582,
                     282667..282672)
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    282319..282339
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    282328..282330
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    282373..282384
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    order(282382..282393,282412..282456,282463..282468)
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    282571..282582
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    282667..282675
                     /gene="engB"
                     /locus_tag="MGF_1686"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            282747..285329
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /db_xref="GeneID:12396580"
     CDS             282747..285329
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /EC_number="6.1.1.9"
                     /note="MGF_1689"
                     /codon_start=1
                     /transl_table=4
                     /product="valyl-tRNA synthetase"
                     /protein_id="YP_005880514.1"
                     /db_xref="GI:385326077"
                     /db_xref="GeneID:12396580"
                     /translation="MKRLKKIDLNQKYDHKTVSEGVVDFWLTTDYANQDSDFCDPNAK
                     PFSIIMPPPNLTGILHIGHAWNLSIQDLIVRYQKLVMGKINWIPGTDHAGIATQTKFE
                     SIQRTKKIDYKKDDRTMHFNNIYQWSQKSSQTIKNQAKSLGLALNWKKEKFTLSQESN
                     KYVLDVFVKLYQQGYIVKKYTLVNWDTKLNTAISNIEVINKETTQKLHYIKYYLKDSD
                     DYLVIATTRPETIYADVAVFVNPNDQRYLKYHNQMVINPLNNKLIPILVDEYIDMEFG
                     SAVMKCTPGHDHNDYALSKKYQLEELSCINFDGTLNELALEFSGLYLYEARELIVKKL
                     ISEDKYVKFEEITSNVGYSDRSNVIVQPLLSKQWFLITTKFVDEIKKLVNNEDQIKIY
                     PKRFLDTINNWLDHNQDWCISRQLVWGHQIPAWYHKDHPDEVIVSINSLGDDYYRDSD
                     VLDTWFSSALWPLICFDDGLDQKEFNANFPNSLLVTAYDIVFFWVLRMIFMSWLLKKS
                     IPFHDLLLHGLILDEHNRKMSKSLNNGVDPIQIIDQYGADALRLFLTSNTSPGEDVSY
                     NVEKINAAASFLNKLWNLARYLKLIDQSKLTDQPLDSLDHWIIHRFNEVNAGIQDKLK
                     EYRFALSNKQLSDFIWDDFANVYIELNKKAQWSKAKFELANDIFRKFLIMLHPSVPFI
                     TEQIYNTFEFSDSKPSIILEKWPGLIKIENALDHFDQIFNLIIKIRNFKQSFDLKNKD
                     TLDLLYKNEVSYIKDLTKYLKTENVNLIKISDQKLNDLFLIATEDNEFYVVYTQDKTK
                     IVDKLVVEIAKLEKEVERSSNIVNNENFKKKAPKEKYEAELKKLSNYQEELKLKQDKL
                     NSLK"
     misc_feature    282762..285326
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="valyl-tRNA synthetase; Reviewed; Region: valS;
                     PRK05729"
                     /db_xref="CDD:235582"
     misc_feature    282876..284444
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    order(282924..282935,284331..284342)
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    order(282924..282926,282933..282935,284334..284336)
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    282924..282935
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    283371..283751
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    284331..284342
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    284442..284816
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="Anticodon-binding domain of valyl tRNA synthetases;
                     Region: Anticodon_Ia_Val; cd07962"
                     /db_xref="CDD:153416"
     misc_feature    order(284445..284447,284451..284456,284463..284465,
                     284469..284474,284481..284486,284493..284498,
                     284502..284507,284634..284636,284643..284645,
                     284664..284666,284688..284693,284700..284702)
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153416"
     misc_feature    order(284484..284486,284493..284498,284502..284507,
                     284676..284678,284688..284693,284700..284702)
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153416"
     misc_feature    285129..285326
                     /gene="valS"
                     /locus_tag="MGF_1689"
                     /note="Valyl tRNA synthetase tRNA binding arm; Region:
                     Val_tRNA-synt_C; pfam10458"
                     /db_xref="CDD:151031"
     gene            285346..286473
                     /locus_tag="MGF_1702"
                     /db_xref="GeneID:12396581"
     CDS             285346..286473
                     /locus_tag="MGF_1702"
                     /note="MGF_1702"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880515.1"
                     /db_xref="GI:385326078"
                     /db_xref="GeneID:12396581"
                     /translation="MDMEQTSKESIKQNYGLALLFCLISIWLLGYVFIRQQLILVLVL
                     SAVFCGIHLFLFSYKISIPIILVFSLFVVYYFVYGYFQLEGISFKNLLDKIPKQYDLR
                     MVIIDYLNTNPNKQSRGLLLLTLFNIKNNDNRLLYNHILNLSIAHLLVISGLHLSLIN
                     LLILRIFKNYKITGNFVSFSCLLFYSYLLNFSYGVLRVLLCLVLNLIFKRFFKNKNYK
                     LISIASSGIILLFLNPYAFNNYSYILSYLSILVIYAIFQIKKLNNFVKFILASVVINF
                     VLSGLIINGYGRINLLTIFWSIILSPIIIGMYFINLFLFPFSVLWPFLALIHEGFIRV
                     IKVFQINVFLINFKQLATWIPYYYLLIYYLFISYMWIKRFN"
     misc_feature    285778..286257
                     /locus_tag="MGF_1702"
                     /note="Competence protein; Region: Competence; cl00471"
                     /db_xref="CDD:260446"
     gene            286473..287390
                     /locus_tag="MGF_1705"
                     /db_xref="GeneID:12396582"
     CDS             286473..287390
                     /locus_tag="MGF_1705"
                     /note="MGF_1705"
                     /codon_start=1
                     /transl_table=4
                     /product="putative DNA polymerase III delta subunit"
                     /protein_id="YP_005880516.1"
                     /db_xref="GI:385326079"
                     /db_xref="GeneID:12396582"
                     /translation="MNYLIICDDFYLSQDYLTQKLNPENVVWVNYNENTNLAPYLSSG
                     LFDTNSNKDLVIINPSFLYKEFNLNESKIIINNINNSSKNIYLLVNKNYDSKKEKFLK
                     IAGKNEIKSLDKNNDYKIGFIKKQLDNLFTDYPNWLIYLINDKSNSDARLIANEIQKL
                     QYVDKETLYDSELIEKIIIDHSDKKIYNLAKEIINNKVEEILVIYEDLIENKRQPTEI
                     ISMLITMLSKIYLMLLGKSMKLSDEEIAKKMGVNLYWVKYTYRDLYVKSAAVIKNFIV
                     NLLELDINNKRNLSDSYQTLKFFIIKGVN"
     misc_feature    286479..287378
                     /locus_tag="MGF_1705"
                     /note="DNA polymerase III, delta subunit [DNA replication,
                     recombination, and repair]; Region: HolA; COG1466"
                     /db_xref="CDD:224383"
     gene            287380..288747
                     /locus_tag="MGF_1709"
                     /db_xref="GeneID:12396583"
     CDS             287380..288747
                     /locus_tag="MGF_1709"
                     /note="MGF_1709"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880517.1"
                     /db_xref="GI:385326080"
                     /db_xref="GeneID:12396583"
                     /translation="MLINMSIDLNTTLDNIKYKLNTIFNSEKFAHELKNKAFRDVLFK
                     QIAAYKYLATKAENSSQNLEYVDVALERLNHHSSDKRTADELATYTEIDDAMDDIRYL
                     DIFILNTFNLSFDEIVKDDKTPDKNTDSKSSVENKVEAATPTVSDIEEDEIKPNRSIP
                     FNGGINSPINLKDNLEKIFTTIGQPDYRQFASIVVKSELDIGKIFLYKEKLKLMPLLN
                     YFAFVISLLFALLGASLMIWYFVLFQRQAIPTFVSQFDKNSYPIFATPNFISAAVLIA
                     VSVVTSISYINSATGKTPPKRAQNAVALISTYMNKEVKVPQINDNLKYSFKIRPLVLF
                     ILFLLVYSFSPFLTPFAGGSLLQGIISLYSVPARIDFVTNATITPEIVSKITEVIWIS
                     LMTLPLAILFLIVVSFFFKPKIDNERLEETINKYAEEIKKATGEITSLFDRGSTTDTS
                     KSGVF"
     gene            288750..289652
                     /locus_tag="MGF_1718"
                     /db_xref="GeneID:12396584"
     CDS             288750..289652
                     /locus_tag="MGF_1718"
                     /note="MGF_1718"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880518.1"
                     /db_xref="GI:385326081"
                     /db_xref="GeneID:12396584"
                     /translation="MQKLRLQKQLGVAKKSIDRSAIIKFFLPFWPLKLRYNIYLISFL
                     ALFIALKIVLGIFVVRIGPTISLGISWVGLALIGWIFGPVVAIPIGFLTDTLSFFLGG
                     GGVWYWLYAVQEPMIIFTAALFGSIYRIRKNYASNFWDFVFQQILIVGFCISGFIFLS
                     LYNNADTDRFLVRNNSFGTTLSMIFMALFFVFAELISWLLYLKHRKTKESIKLFLYVS
                     TMMITLSILYSLVLGTISINEFLINVVHQKPKTRDFILSAYLIPRVIKETLRLPILII
                     CAIALIKISEPYLQNFFNLSRLRW"
     misc_feature    288870..289322
                     /locus_tag="MGF_1718"
                     /note="Protein of unknown function (DUF3816); Region:
                     DUF3816; pfam12822"
                     /db_xref="CDD:257324"
     gene            289761..290582
                     /locus_tag="MGF_1725"
                     /db_xref="GeneID:12396585"
     CDS             289761..290582
                     /locus_tag="MGF_1725"
                     /note="MGF_1725"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880519.1"
                     /db_xref="GI:385326082"
                     /db_xref="GeneID:12396585"
                     /translation="MFKNKKHKILAASFLLSGVTVVSMVASSCSSAANNPVVEGLFKT
                     KQHPENFSNSSAGSFNAVLQNSLETDQGFNDFARFLIANSLADWYTNNASNSIVQKYR
                     GWERDAETKLESETTSLRNQFRRNFEIRRQTDLFDPNGGTADSYKRRQVLTNVFTDFS
                     SMVFQNNYLGYFDDKNKKVDNPLIDVISKPENWKNFKFYSDGYTDSKSTQNDNQMFAD
                     FQAYVFNQWVKRENPNLVSRIVFTNENINGGLDQIFDKKSFNFSASRKRSSYCGL"
     gene            290634..291176
                     /locus_tag="MGF_1732"
                     /db_xref="GeneID:12396586"
     CDS             290634..291176
                     /locus_tag="MGF_1732"
                     /EC_number="1.2.1.12"
                     /note="MGF_1732"
                     /codon_start=1
                     /transl_table=4
                     /product="glyceraldehyde 3-P dehydrogenase domain protein"
                     /protein_id="YP_005880520.1"
                     /db_xref="GI:385326083"
                     /db_xref="GeneID:12396586"
                     /translation="MYYKPLAPVVKVLVEEFGLKSGYMTTVNSYTADQKLQDAPHKDL
                     RRARAAENIVSTSTGAAKAIGLVVPQASNVLDGIAIRVPTLTGSLIDLSVRLEKSPSV
                     EELNASFKKAANESFKFETDEIVSSDIVNSHYGSVFDSKLTNFVESKDGRLYKLFAWY
                     DNEMSYVSQLVRVLEYFVSL"
     misc_feature    290649..291113
                     /locus_tag="MGF_1732"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:251539"
     gene            291362..294178
                     /locus_tag="MGF_1736"
                     /db_xref="GeneID:12396587"
     CDS             291362..294178
                     /locus_tag="MGF_1736"
                     /note="MGF_1736"
                     /codon_start=1
                     /transl_table=4
                     /product="sialidase"
                     /protein_id="YP_005880521.1"
                     /db_xref="GI:385326084"
                     /db_xref="GeneID:12396587"
                     /translation="MKKTKAQKDQQKKSQFKKRFWFTFTFLIGSITIISSFLIPLSLK
                     WIWAPLNIEEDLEINIKDDLNGSRFISEINSDNLPEFVNAFFNNKQYSIDDLNLKLAG
                     VNYITGWVYVQASVKPNVKVAKKYQDAVKLFKLEFKNSQVKLFDPNVTTFLIKPENNT
                     KEFTSEFQTREDLESFLNNADNISLSELQDKLNLTFFDKNNVPLNLYTGAVVTLSNPV
                     KFTIASYVMDYKITWQIPAANDVFYGNLYPFSLNGKLNLWLKKINSISSLYSDVDDID
                     FKKLQSKEIFRNLEEVQNFSTSIETLDQFYNAPDDLVVKGQDFKLGYYVNKTAQTFDN
                     VESFLDNSNLISSGYLTRMTYDDKHKVVISKPNLDTFTKASSETQRKYLQSFKQNKAP
                     VKVTIANTVDRTVEVFYTDFSFNKSPLVNGKYLFFNMSPPGDKFVYYTKDVNTWRIPG
                     VVKTHDNKLIFNADKRVNNKDDRGHLEQDIRVSEDGGKTWSNPQTIVRISAKNTKDGA
                     NKGQVIDGTMLEVFDKSINKHKLLYVFGVSSYLHTVHDEWTIRGDGNTSGLVNNNKWM
                     LFIDKENLNQKFVAKPITVDGDSNWFKVFKVKNSSRVQWKDIDDTTQLDEANIIIDNS
                     LKNGTITGNVYDKVPSNIFSTFGEPGRNSRSSEISGYISKYSIWDQRWPNYFVFNRMQ
                     KNAYFANSRYYFDNILWTFQVESIDGGKTWTNLRNVSPFLNRKDQRWYINGVGNGIQL
                     NHQRNSNGDVIAVFPFYFANKRKLERSKLMATKDGGKTWYELADYPFKLLPPGASESS
                     ISEDSKGNLWWLARRSDGRVFTLIKSEDGGKNWKVIFNAKRGIFTGQFIGSTIFNIKA
                     LGEKLIFSASDNRGGKIYLVDINNPRTLEPIYTINRGSYGYSTTVTFNENDNYFDVLT
                     FYEVNSPQKGRDINLKRLRVFVVS"
     misc_feature    <293426..294142
                     /locus_tag="MGF_1736"
                     /note="Sialidases or neuraminidases function to bind and
                     hydrolyze terminal sialic acid residues from various
                     glycoconjugates as well as playing roles in pathogenesis,
                     bacterial nutrition and cellular interactions. They have a
                     six-bladed, beta-propeller fold...; Region: Sialidase;
                     cd00260"
                     /db_xref="CDD:238162"
     misc_feature    order(293675..293683,293690..293698)
                     /locus_tag="MGF_1736"
                     /note="Asp-box motif; other site"
                     /db_xref="CDD:238162"
     misc_feature    order(293747..293749,293795..293797,294050..294052,
                     294110..294112)
                     /locus_tag="MGF_1736"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238162"
     gene            294199..294456
                     /locus_tag="MGF_1749"
                     /db_xref="GeneID:12396588"
     CDS             294199..294456
                     /locus_tag="MGF_1749"
                     /note="MGF_1749"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880522.1"
                     /db_xref="GI:385326085"
                     /db_xref="GeneID:12396588"
                     /translation="MFTLLGASLMIWYFVLFQRQAIPTFVSQFDKNSYPIFVTPNFIL
                     AAVLIAASVVTSISYINSATGEITSLFDRASTTDTSKSGVF"
     misc_feature    294344..295362
                     /note="MGF_1750f; Potential conserved hypothetical
                     membrane protein gene region"
     gene            294344..294556
                     /locus_tag="MGF_1750"
                     /db_xref="GeneID:12396589"
     CDS             294344..294556
                     /locus_tag="MGF_1750"
                     /note="MGF_1750"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880523.1"
                     /db_xref="GI:385326086"
                     /db_xref="GeneID:12396589"
                     /translation="MLRVWWLQSHTLIQQQVKSLLYLIAQAQQIHLNQEYSRFAKIKI
                     TKTTRCRKEINWQISDHQVFFYRSDL"
     gene            294490..295362
                     /locus_tag="MGF_1754"
                     /db_xref="GeneID:12396590"
     CDS             294490..295362
                     /locus_tag="MGF_1754"
                     /note="MGF_1754"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880524.1"
                     /db_xref="GI:385326087"
                     /db_xref="GeneID:12396590"
                     /translation="MSQRNQLTDQRSSSFFLPFWPLKLRYNIYLISFLALFIALKIVL
                     GIFVVRIGPTISLGISWVGLALIGWIFGPVVAIPIGFLTDTLSFFLGGGGIWYWLYAV
                     QEPLIIFTAALFGSIYRIRKNYASNFWDFVFQQILIVGFCISGFIFLSLYNNADTDRF
                     LVRNNSFGTTLSMVFMALFFVFAELISWLLYLKHRKTKESIKLFLYVSTMMITLSILY
                     LLVLGTISINEFLINVVHQKPKTRDFILSAYLIPRVIKETLRLPILIICAIALIKISE
                     PYLQNFFNLSRLRW"
     misc_feature    294580..295032
                     /locus_tag="MGF_1754"
                     /note="Protein of unknown function (DUF3816); Region:
                     DUF3816; pfam12822"
                     /db_xref="CDD:257324"
     gene            295460..298912
                     /locus_tag="MGF_1760"
                     /db_xref="GeneID:12396591"
     CDS             295460..298912
                     /locus_tag="MGF_1760"
                     /note="MGF_1760"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880525.1"
                     /db_xref="GI:385326088"
                     /db_xref="GeneID:12396591"
                     /translation="MFKNKKHKILAASFLLSGVTVVSMLASSCSSAANNPVVEGLFKT
                     KQHPENFSNSSAGSFNAVLQNSLETDQGFNDFARFLIANSLADWYTNNASNSIVQKYR
                     GWERDAETKLESETTSLRNQFRRNFEIRRQTDLFDPNGGTADSYKRRQVLTNVFTDFS
                     SIVFQNNYLGYFDDKNKKVDNPLIDVISKPENWKNFKFYSDGYTDSKSTQNDNQMFAD
                     FQAYVFDQWVKRENPNLVSRIVFTNENINGGLDQIFDKKVLGDELKASYSFQAFTNPN
                     QVIDRTSPKLSTGFRQLVANDGLVNYYNPANFTVDFLNQFSSDSGGKLLMSASDMFNS
                     FDVAFSTAYVQQYQDLTNNVDKDNAIASVILDPNNIMKNFIFANQANANSAYSTTLDL
                     TSNDPQLKELSEKIKSSILVDKIADNSYYDIYKQYAEGKASLHEYIRPTSSDMNSNEI
                     QKQFILSRGKDGIHIMAIDGANYYLTGSSRNIEKQKEFLLFRNQLVNNPDFSRFFSEK
                     SYQFNVLDPVKKYYDKNNITLTIEFLLNAIDDQNSFLHKPGNEALLGSLTKASSILKD
                     LVKAKVDYDFALKVKNDAINAREKIIERAGTFDNLIKTDKTPAIGIAGKLPHPAAADG
                     SYVGIESYYKNLLVENKLLPENTLTTKDQGLSKLFDQVVNDTKAKYFQTAKTVAEGLL
                     LNGEPSYTYSQNVFVSSRYDPQYSLAANLAINTTIALPTSTNDFKRQFYLNDQRFTNF
                     YDPRTNQFKDFEGLKADQIKNVVNFYFIQSTWESQANKVKYGSWATKAEYDNVLNNYF
                     DNQRTISNLNDDARLNYLRYLNTFRYLIQDNLAEFKRILSTQITRGVSANVSWTLTNG
                     TKLDNNGNIASTQDKINFTNFVANPNYLQGSKFNLANLNKATDNNPNSQSNNLNYSTT
                     NNNQTVYGFNGLSIANANNNTNLNTEVRSVLFDNFEQSGQNGVLYAFGGSLEDVVNYV
                     NTLTTNRELDAFVELLRRAQVNINLFETDANGMALSAEQRRVNLISQLSDTKILPADV
                     YAKFVGYVGQNKVSSTDLTTQPDSFVPFTAAKSLLNWTTYIKQINFKEVANLGGASWL
                     TNPSNRLDLSVDELLSIVAKYAFDNSYQNNAELAIISQQSLIDVNDKRLYDALGLRWV
                     LRNS"
     misc_feature    297341..297664
                     /locus_tag="MGF_1760"
                     /note="Protein of unknown function (DUF3713); Region:
                     DUF3713; pfam12506"
                     /db_xref="CDD:152940"
     gene            298952..302527
                     /locus_tag="MGF_1775"
                     /db_xref="GeneID:12396592"
     CDS             298952..302527
                     /locus_tag="MGF_1775"
                     /note="MGF_1775"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880526.1"
                     /db_xref="GI:385326089"
                     /db_xref="GeneID:12396592"
                     /translation="MSQSKNKKYRIVKQVSFLSLISLAGVLVSSCGAAANANQLLMNK
                     FKTGFRTDGNNQNLGFIGNGNILGGQQDQARTVLATALKNNQGFQSLLSSLLSDSLAD
                     YYKNSKSSVLSNKYQNFSDDINDQLNTSIEDNKRIYGNNYMDLIQTQLFDSNGGTKES
                     YLQNQLNQKISNDFFDSLFKDSYLNYAPTMSTDADGFVVYSNLTKIPSRTILSDPANW
                     ANIRFTDGGFSATNNEQTNNEFLAQIQAFAFNQWVTDENPNLVSRIVFTSDTPKDGLN
                     SIFNDRTVSSTALVASYNFQAFKNPKDQPFDENKGMRAYNQFITRGLDSYVNSTTKGI
                     NIPNNLSSDSGGKLLMTASDMFNSFDVSFSAAYVQQYLKQTNNTNRDTVGVVQSDIDE
                     INLMNNFIRAKANGNTTNTYSQQITNNSLLKTGEANRTTDPYYNAYADLAAGTKDIHE
                     IFEWNGMKTVDSSKSDNSSTNVMSKNTNASKFLFSRGRDGIHVMAIDGGDYYLNQSGM
                     TRNITKQKEFLAYRSLLRSSINLSENERYDFDLSTQIKNHFNKNQTLNLYLALSKMYE
                     EAVAKSTDKNNIFNIEDNANFSFRTSFKKVYDLVNNLVKAEVAYQNALNLDAQVKNIR
                     TKIYDRAKGFEDNERTNQTANNGIAARLPYVRAVDGSFNGLEQYYLSLYGLQPTTSSK
                     GTVAEISKNLADKKTARDAEIDNLLTKLKVQTTLLNNESQNTFVEVKSDDQTLNQWSG
                     LYLAVNLAVGSIISTSTLTNEIRIDYIRSNPNFREFFNVANNQVFSFQGINQQLLVDV
                     IRNVFKLSAFNGLSDKTSYGIYTNFSSLNQIIDKVWDEQLANAQQGSDLRFSYYRFLY
                     TFQWLLRNNLQNFKNLAMLNMRPGDVAFATWSLPINFNAEVAPASNNQPVDAQANNQS
                     FNPLITFDQNPNGILGSFQANWQNMVASEASKISAPNYWDNSSLTYNVSSSENTPTTP
                     QYGFAGLVFKNSSAPISNELKSALFSTYGSSGEQGAFYGFGSKVNLLTYVDNIKTERE
                     LDELARSITNETRVPNNTYFGNNSDNKPLTFDEKVVEIKKMIEMIPAQAFERYVGYIG
                     TTKSTNFELNHSLYLQGSLRRVAAYVKEVSYNDLTNLGAGWLTDTTKALGLSPSELLT
                     VVAMTANNSTVQIQAINELTANNKLTVFDQRLYNALGTIFGRKLS"
     misc_feature    300941..301264
                     /locus_tag="MGF_1775"
                     /note="Protein of unknown function (DUF3713); Region:
                     DUF3713; pfam12506"
                     /db_xref="CDD:152940"
     gene            302535..303311
                     /locus_tag="MGF_1789"
                     /db_xref="GeneID:12396593"
     CDS             302535..303311
                     /locus_tag="MGF_1789"
                     /note="MGF_1789"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880527.1"
                     /db_xref="GI:385326090"
                     /db_xref="GeneID:12396593"
                     /translation="MTDTKQKFCIRNWYHQTLTKSQRVFLVVLLFNAAGLGFVVYNFF
                     SSLQTNAFGSPFMNGFTTISSFTNQTSVLLFIFSFVFVFYPNNSLLKNERFLVFCMTY
                     TLFTFLTGGIFQNLVDQTANRTNFSRASLASGIFLQIVNPIVFIFCGYLRFVFNPIKK
                     IRRYSKFILPGMIYPIIYMIYVLTIPLVYKTPDNVVYSVYGNYTNVITNRTMAITIGV
                     LMTFLYFPGSFIFIIFFIRKFNNHYYRVAQIRVRLGLKSK"
     misc_feature    302922..303263
                     /locus_tag="MGF_1789"
                     /note="Protein of unknown function (DUF1600); Region:
                     DUF1600; pfam07667"
                     /db_xref="CDD:254343"
     gene            303318..304109
                     /locus_tag="MGF_1795"
                     /db_xref="GeneID:12396594"
     CDS             303318..304109
                     /locus_tag="MGF_1795"
                     /note="MGF_1795"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880528.1"
                     /db_xref="GI:385326091"
                     /db_xref="GeneID:12396594"
                     /translation="MNRLKLKKVSFKSWYKNQLTRSQKIFFFAFIVNAISILLVFQGL
                     FVLLFKGRDGFLSLDKFTNQTNILIFFFSLFYVFFPKHSFLKNDKFLIACITYIFITF
                     FVYNLVSIANAVAVIVAPKSILAWSYTRIGYGSKATAFLLFIDLFKHLFNPIVFIVCG
                     FFKFVYYPNLKLKKISSYLLPMIIYPAIYCVYVIVAPFIYKQENGMTYSVYNVATNTK
                     DYPQFAYPVLFFLLFVLIPVTTYLTWFGARKISEKYEQNQVVINP"
     misc_feature    303741..304070
                     /locus_tag="MGF_1795"
                     /note="Protein of unknown function (DUF1600); Region:
                     DUF1600; pfam07667"
                     /db_xref="CDD:254343"
     gene            304136..304942
                     /locus_tag="MGF_1802"
                     /db_xref="GeneID:12396595"
     CDS             304136..304942
                     /locus_tag="MGF_1802"
                     /note="MGF_1802"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880529.1"
                     /db_xref="GI:385326092"
                     /db_xref="GeneID:12396595"
                     /translation="MNQIDKKPKSFSFWFKYELTKAQKIFFFVFWLNLATVIFIVQEV
                     VAELLSNVNSVNNLNNFVDAYRTFDKFTNQSNFILLVFSFFYVFLPRHSFLKKDKFLV
                     ASIVYILFTFFGYNIILQFGRLGYRFITNPTKLARGLMVHLFNPVTFIIAGFLAFVYS
                     PARSIGKFHTYLIPGVIYPIIYGIYVISVPYLYKTVDGSIYSVYGGVTNVIENPKIAW
                     AAIIALLFGYFPLSYFIVWISYVKISKKYIDYPASLRKKSIKFIKFKMKQ"
     misc_feature    304535..304876
                     /locus_tag="MGF_1802"
                     /note="Protein of unknown function (DUF1600); Region:
                     DUF1600; pfam07667"
                     /db_xref="CDD:254343"
     gene            304960..306759
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /db_xref="GeneID:12396596"
     CDS             304960..306759
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="MGF_1805"
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein lepA"
                     /protein_id="YP_005880530.1"
                     /db_xref="GI:385326093"
                     /db_xref="GeneID:12396596"
                     /translation="MDKKNIRNFSIIAHIDHGKSTLSDRLIEITETVSKREMKNQLLD
                     SMELERERGITIKLNAVQLKFKRNNQDYTFHLIDTPGHVDFTYEVSRSLAACEAALLV
                     VDATQGVQAQTLSNVYLALENNLEIIPVINKVDLPSADVERVKREIETKIGIDCSDVP
                     LISAKTGLNIDQVLDAIIKKVPSPNNANDNDPLKALIFDSYYDPHKGVVCFIRIFDGK
                     LKVGDEILFMANNVKYVVTEVGIKNPNMQSRAYLEAGEVGYVTASIKTIRDVHVGDTI
                     TNANNPCDKPLAGYRKVSPMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYEYETSN
                     ALGFGVRCGFLGLLHMDVIRERIVREYNIPLILLAPSVMYKCYLTDGQELKVDNPANM
                     PERNRIKSMLEPYVKLSISTPDEFIGPIMELCQNFRGEYMELSEIDSSRKVLVYEIPL
                     AEIIYSFFDKLKSVTKGYASLDYELIGYRDSNLVKVDILLNGQKVDALSFISHTQFVY
                     QKAKKIVEKLKTLIPRHLFEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDVSRKKK
                     LLEQQKEGKKRLKAIGSVQIPQETFSKLLQDDE"
     misc_feature    304960..306756
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="GTP-binding protein LepA; Provisional; Region:
                     PRK05433"
                     /db_xref="CDD:235462"
     misc_feature    304978..305511
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="LepA also known as Elongation Factor 4 (EF4);
                     Region: LepA; cd01890"
                     /db_xref="CDD:206677"
     misc_feature    304996..305019
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="G1 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    order(304999..305001,305005..305007,305017..305022,
                     305029..305031,305038..305043,305134..305139,
                     305203..305208,305275..305280,305386..305388,
                     305398..305400)
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206677"
     misc_feature    order(305005..305022,305353..305358,305362..305364,
                     305446..305454)
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206677"
     misc_feature    305101..305136
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206677"
     misc_feature    305122..305124
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="G2 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    305191..305202
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="G3 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    305197..305253
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206677"
     misc_feature    305353..305364
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="G4 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    305446..305454
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="G5 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    305536..305793
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="lepA_II: This subfamily represents the domain II of
                     LepA, a GTP-binding protein localized in the cytoplasmic
                     membrane. The N-terminal domain of LepA shares regions of
                     homology to translation factors. In terms of interaction
                     with the ribosome, EF-G, EF-Tu...; Region: lepA_II;
                     cd03699"
                     /db_xref="CDD:239670"
     misc_feature    305842..306060
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    306166..306405
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="lepA_C: This family represents the C-terminal
                     region of LepA, a GTP-binding protein localized in the
                     cytoplasmic membrane.   LepA is ubiquitous in Bacteria and
                     Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is
                     missing from Archaea. LepA exhibits...; Region: lepA_C;
                     cd03709"
                     /db_xref="CDD:239680"
     misc_feature    306427..306747
                     /gene="lepA"
                     /locus_tag="MGF_1805"
                     /note="GTP-binding protein LepA C-terminus; Region:
                     LepA_C; pfam06421"
                     /db_xref="CDD:203441"
     repeat_region   305536..356917
                     /note="F strain 25k tandem repeat, containing TTAAAAGCA
                     sequences at repeat junctions"
                     /rpt_unit_range=305536..331222
     gene            306752..308194
                     /locus_tag="MGF_1816"
                     /db_xref="GeneID:12396597"
     CDS             306752..308194
                     /locus_tag="MGF_1816"
                     /note="MGF_1816"
                     /codon_start=1
                     /transl_table=4
                     /product="putative permease"
                     /protein_id="YP_005880531.1"
                     /db_xref="GI:385326094"
                     /db_xref="GeneID:12396597"
                     /translation="MNNQFDWLLVQLSNQASIVLSERYKISLIINVVLFLFALIISII
                     FFWRIKFENKGYKKLFVFYSIFWLPIFLVRSYRGTLHNDLALDRNLLFLPLSLYGFVG
                     IFFRPLFDYLGIRFKSRKKVVFAALLLQLATFIPIIIKPSFATNFIQTIGVGIAASCI
                     GSFSLWFNEQHAKEKPFLAISILSIPPLIADFVASPVQSLVRTLAITTQRTADVNITK
                     YLWLIGLIVILINIVFWWFLRENPQFVGLKKHDPKDIIDGSPNKIYCFIVVILFAGIV
                     IFTKFATADGIAQITLQQLVGNSNSAPYEGYLSSVFSAAQLLGGVLMGVVGVKYFDKW
                     MVALIGSIFFVLYNTSMILLINSTSVPTLTKGGIYLGIQAISGFGYGILYNLLIAHAL
                     SYGFKNNKITPIGINQTTASIAITSANFFTTFIRDKISSDFVKANTVISYILIGTVLA
                     GLSLYFFNSWIDHDKKLKPIFWIKSFKSCI"
     misc_feature    306926..308122
                     /locus_tag="MGF_1816"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(306959..306961,306968..306976,306980..306985,
                     307034..307036,307043..307048,307055..307057,
                     307067..307072,307076..307081,307220..307225,
                     307232..307234,307241..307246,307253..307255,
                     307289..307294,307301..307306,307322..307324,
                     307583..307585,307592..307597,307604..307609,
                     307616..307618,307658..307660,307676..307678,
                     307688..307690,307697..307699,307709..307711,
                     307880..307882,307889..307894,307901..307903,
                     307913..307918,307925..307927,307958..307963,
                     307970..307975,307982..307987,307994..307996)
                     /locus_tag="MGF_1816"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            308262..314198
                     /locus_tag="MGF_1830"
                     /db_xref="GeneID:12396598"
     CDS             308262..314198
                     /locus_tag="MGF_1830"
                     /note="MGF_1830"
                     /codon_start=1
                     /transl_table=4
                     /product="putative cytadherence-associated protein"
                     /protein_id="YP_005880532.1"
                     /db_xref="GI:385326095"
                     /db_xref="GeneID:12396598"
                     /translation="MPKMIKGTEFIVAKKTKNKKKNHFEDIQTTNDINEEESEAIFGN
                     LYDGADEVLPASLAYENGQLPEDGSIQVAFDADDNAYYISYDHENEIFIEPYEKYELD
                     ASALYDAEGNPFDFFANYHVEGAEAAQEEESGEYWEQFVGVEGYGYYDENEEWVWTGY
                     FDEDNKFIPNEEEEPAEVEALEEKSEAAEEVVEQEPQEEVQAEEVEEQPESKQEGSGE
                     YWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEDAAVAGDEQVEEYSAQEE
                     QAQEEYKQQPEQEVSGEYWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEY
                     GQPVNEEEYAESVSEEQVPVSEEQVVEEPAEVEEVVEEPAVEQVPEEAQPEQVQEEVQ
                     AYEHVEEQQPEEAYVEKQPQEEMVVVPEKAEEYVQEQPEEATADAIDEYYDEITHVED
                     EVVEEEQIQTDNFVSSDEINWSNYVGNEDYGYYDENNEWVWKGYFNEYGMFIPQQEDY
                     TDSIPVDEQPVEQTADLAEQAEEEVVEEPTASDEIVQVEEEEVESEPVVPTVTDDLVA
                     LEQPFEFDTQQFVGNIDFGYYDESSEWIWTGHFDKDGKFFDFDGNLVYSPQEGVKPVE
                     VPKPTDLTDQIPQNALVVAEPDVFSEDIIQQVDENQFDVGEELVVRGLLNPTSRPIQP
                     QELNIKPVFEEEKLNLPVLANEVSLQPEEPKVDYSKRSDSDQLVTQTPVVLEDAVADD
                     LISVDTKGFVPELSQPTFAPKAVSQDQFKLVQPVVSQPKFDQITHLADEIKMDVNVTS
                     SDVDVQPIQINPSLEVASEPSKLDIFVKKPAVELKKIEFIEPVSEKIDLQIFEQQEIV
                     TKPVSTIQKPTYTDETVSVSVNAIDETTSETDTIVQVTPTTSEASDFDINKILNTKPV
                     ETITVELPKDEPKLVTGVHVSLVDVEAKPVEEIVEFDSPKPSVSEVVVEKEDKVTLVE
                     EEPFFNKFIGNEQYGYYNNKNVWIWTGYFDDQNNFVSDKDSKTQKVDQLIEEFNKQEA
                     IKKTEEVEAKKASEPFYNKYIGNKQFGYYNDKNVWIWNGYFDENDQFVPDQSSTKRSE
                     KLIEDELQKQRIHELELELAQAQQAILESTKLKDQEVAKIKEEVLKVQQEAIKAKEVA
                     TLRNFVPKGSPLLNPAKEVENSMIVYQEDKLEVNDLRNELSKLKTQREEFDNFSKIRD
                     LDVINLYNASTSHRGMDYVFSGFEKKEEQFVKKPLHFLEEVKADPVQVAKEETISNLD
                     QLLKQDPHLLLAKKTDKSVNPQASLTVLADQKEVELTQQAVRKQAEAIEAERVDVIKP
                     LEQVQLNQSRSLLDDLTPKFEVKPSLIKDDVIQPKYNDDLEPIEQLQFKQERSLLDDY
                     MPKFDDQGLFSKVEFKLPTVNKEYRPKVEPIDVIKPLEPVRINKERSLLDDYLPPKLN
                     AQPTFEKTELDLGLEKPLANGELYEELKAEFSTTITPADSKDMIDQLLEETNDLITSS
                     TQTRSTKIHSFSKSPLKTEPEPILDTKFDDKFIELDENQGFDQLIVESDDELLTDVVQ
                     EQVSVNQIAVTNEEYKKDMAELKQFLEKRSEELFKQYFSKFEELTKLQMESFNQIKNE
                     LRSEMNEIRDEVRSNKLALTSEITEEIYPSAPKVSRKQRGVHGFSEPTSEFDFDNSLS
                     LVNENNYDLYELLDRIINYEDVPLTSSNLFKAEEYQAKVKQSVYNIKLILKNSEAEAT
                     KNYNYILSTLKNEITLLQKDLPIISSQLNKLQHDLRAKQLNRGDYKFVQEQIQELRAE
                     HANKTRAISFYNKKVSDLKSIYAQQIRKIKSDYKKISDLANKRKVSSDYIDQALQSFE
                     TARVSQPNIKRNYEQLYRNQLQQNVNANYGNFRRYDPLIENPGYEYFSNHQPREFFSE
                     LESIDNDIFSSNDLIYSNRNTYLDENFRINDYELTSNFNDIDAIYGMDKLRLPPFEPS
                     NLVNDMEFNSSFDIDFDTDF"
     misc_feature    308334..308615
                     /locus_tag="MGF_1830"
                     /note="cytadherence high molecular weight protein 1
                     N-terminal region; Region: termin_org_HMW1; TIGR03836"
                     /db_xref="CDD:163548"
     misc_feature    308682..308765
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    308931..309014
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    309156..309239
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    309405..>310724
                     /locus_tag="MGF_1830"
                     /note="terminal organelle assembly protein TopJ; Region:
                     termin_org_DnaJ; TIGR03835"
                     /db_xref="CDD:234368"
     misc_feature    309684..309767
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    309996..310079
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    311202..311285
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    311412..311495
                     /locus_tag="MGF_1830"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     gene            314245..315231
                     /locus_tag="MGF_1865"
                     /db_xref="GeneID:12396599"
     CDS             314245..315231
                     /locus_tag="MGF_1865"
                     /note="MGF_1865"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880533.1"
                     /db_xref="GI:385326096"
                     /db_xref="GeneID:12396599"
                     /translation="MNNEQTKTLDLGINANHNSYGSINAPSRAAQIQEKEYSGVFNPG
                     SLEVTNLKEESAQSLNNLERSIPWFYKREIFYNTLDLIFGLLVILGFGTGLILLCLYI
                     YFNNKSWHIVWAALPFGILALFIGYRTISSYANIKGGLKHEYIFSKAQIAVNIKRAYK
                     NLRLIPVNMNWLSAAIYLTITIAIIVTLVSAFAINLITIANLNQEFTREQINAAKTFG
                     YLYVLKANSELDKWPLYSIIVNGTIGIGTLILQIYLIINSSIRARAIENFYGKMPIEE
                     EDMHRAIVAANKRNFKIFLVYLVIIGLVVLLVKKIITGSLSAINKKKVISIK"
     gene            315231..316100
                     /locus_tag="MGF_1868"
                     /db_xref="GeneID:12396600"
     CDS             315231..316100
                     /locus_tag="MGF_1868"
                     /EC_number="3.6.1.-"
                     /note="MGF_1868"
                     /codon_start=1
                     /transl_table=4
                     /product="HAD superfamily hydrolase Cof"
                     /protein_id="YP_005880534.1"
                     /db_xref="GI:385326097"
                     /db_xref="GeneID:12396600"
                     /translation="MSDLDKNKQLKLIGIDLDGTLLSIRKKVTKKVIGSLLELRKKLP
                     NIVIAIITGRSYLSAKRVVNELQEAGVKINYLCSYNGSVLFKINEQSELIKLDEHSID
                     SLTTKAIFDYCTKNKIVFQGYLVTDEVNRSIVLSDNFSGRLIASFNKNKSFCSKDFVD
                     GRYYKINLISSNHKRLKRFNQFVSENYSDDLEIANIYPTFLEITTKNINKAFALASVC
                     DLENISLEQTAVIGDSLNDYSMFEIASYKFAMKRANKKLKDISTYIASSRRHNQFKEI
                     IQKTIAIVDDEKK"
     misc_feature    315264..>315500
                     /locus_tag="MGF_1868"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    315273..316031
                     /locus_tag="MGF_1868"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    order(315276..315284,315384..315389)
                     /locus_tag="MGF_1868"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    315276..315293
                     /locus_tag="MGF_1868"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    315384..315386
                     /locus_tag="MGF_1868"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <315720..315956
                     /locus_tag="MGF_1868"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    315738..315740
                     /locus_tag="MGF_1868"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <315855..315977
                     /locus_tag="MGF_1868"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(316479..317345)
                     /locus_tag="MGF_1879"
                     /db_xref="GeneID:12396601"
     CDS             complement(316479..317345)
                     /locus_tag="MGF_1879"
                     /EC_number="3.6.1.-"
                     /note="MGF_1879"
                     /codon_start=1
                     /transl_table=4
                     /product="HAD superfamily hydrolase Cof"
                     /protein_id="YP_005880535.1"
                     /db_xref="GI:385326098"
                     /db_xref="GeneID:12396601"
                     /translation="MKNKKLLIISDLDGTLLNDESKLSYQTIKVIKLLNKLGHHFCIA
                     TGRPSRASIDIYNELGLNTVMANLNGSYIWHPKDRFFKAINLSFSKDIVKNLLHKTSI
                     IKLVDNFIVENNEGTYIMNKPVSSREHDELLQCFHIDGKDNCTFGQDKILNLRQDPNA
                     ILLQVKNPHNIDEVVFQLKECFSTFVVRKWSLPVSGIIIEVNTVYANKGNALDYLSSY
                     YGIPKEFVVTFGDGENDIEMLQKSRFGYAMKNAISSAKLLARYITKYNNNDHGVGFEL
                     FHKIIKRSLKNS"
     misc_feature    complement(<317100..317327)
                     /locus_tag="MGF_1879"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(316518..317324)
                     /locus_tag="MGF_1879"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    complement(order(317208..317213,317307..317315))
                     /locus_tag="MGF_1879"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(317298..317315)
                     /locus_tag="MGF_1879"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(317211..317213)
                     /locus_tag="MGF_1879"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(316605..>316763)
                     /locus_tag="MGF_1879"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(317348..318400)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /db_xref="GeneID:12396602"
     CDS             complement(317348..318400)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /EC_number="6.1.1.2"
                     /note="MGF_1886; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_005880536.1"
                     /db_xref="GI:385326099"
                     /db_xref="GeneID:12396602"
                     /translation="MIKIISGIQSTGSLHIGNYLGSISKNINLQNKYQLNLFVANLHT
                     ITVDFDPTQARQNIIELVKIYLASGFDTNKNNIFLQSEINEHAALGHVLLCHTTMGEL
                     ERMTQYKDKKQKFVQSNQTIKIPTGLLTYPTLMAADILLYQSDYVCVGDDQKQHLELT
                     RDIAIRMNKRYGELFKVPEPIIAKVGSRIMDLNDPSKKMSKSSLSKKGIINLDDSREE
                     VLSKIKSAKTDNLNKVNFDYKTQPEISNLVSIYYGVINDHFNLGLKSAKFNKTLDEEV
                     VPIDIIKHFENKSYKDFKEELLELIWNILDNIQTNMKKITDEDVMRVLKSGKDKLLPI
                     AQKTLLKVYQKLGMVI"
     misc_feature    complement(317354..318391)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    complement(317489..318391)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(317792..317794,317798..317803,
                     317837..317839,317933..317935,317942..317947,
                     317951..317956,317960..317962,317987..317989,
                     317996..317998,318008..318010,318161..318163,
                     318272..318274,318287..318289,318338..318340,
                     318347..318352,318356..318358,318374..318388))
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    complement(318347..318358)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(317999..318004,318011..318016,
                     318020..318022,318092..318097,318101..318112,
                     318116..318121,318128..318136,318140..318145,
                     318263..318268,318275..318277))
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(317789..317803)
                     /gene="trpS"
                     /locus_tag="MGF_1886"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            318473..318952
                     /gene="spxA"
                     /locus_tag="MGF_1885"
                     /db_xref="GeneID:12396603"
     CDS             318473..318952
                     /gene="spxA"
                     /locus_tag="MGF_1885"
                     /note="MGF_1885"
                     /codon_start=1
                     /transl_table=4
                     /product="regulatory protein spx"
                     /protein_id="YP_005880537.1"
                     /db_xref="GI:385326100"
                     /db_xref="GeneID:12396603"
                     /translation="MTNNQNSQTNNIVLFITASCIGCTRVRRFFREYNIQHKEINFYK
                     TAIEEKYFNDILSLTENGVFDIISTRSKYLQNNKVNIDELTISQLITLVNEHPSILKR
                     PIILQYDKSGIPKRLMVGYNSTDIRVFLREVADVKAYYLDEYWFDDESSPSSRKEDE"
     misc_feature    318506..318865
                     /gene="spxA"
                     /locus_tag="MGF_1885"
                     /note="Arsenate Reductase (ArsC) family, Spx subfamily;
                     Spx is a unique RNA polymerase (RNAP)-binding protein
                     present in bacilli and some mollicutes. It inhibits
                     transcription by binding to the C-terminal domain of the
                     alpha subunit of RNAP, disrupting complex...; Region:
                     ArsC_Spx; cd03032"
                     /db_xref="CDD:239330"
     misc_feature    order(318530..318532,318674..318676,318776..318778,
                     318833..318835)
                     /gene="spxA"
                     /locus_tag="MGF_1885"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239330"
     misc_feature    order(318530..318532,318539..318541)
                     /gene="spxA"
                     /locus_tag="MGF_1885"
                     /note="thiol/disulfide switch; other site"
                     /db_xref="CDD:239330"
     gene            318909..319733
                     /gene="ppnK"
                     /locus_tag="MGF_1890"
                     /db_xref="GeneID:12396604"
     CDS             318909..319733
                     /gene="ppnK"
                     /locus_tag="MGF_1890"
                     /EC_number="2.7.1.23"
                     /note="MGF_1890"
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="YP_005880538.1"
                     /db_xref="GI:385326101"
                     /db_xref="GeneID:12396604"
                     /translation="MMMKVHQVQEKKMNKTYYLISSLAPKSESLKPLIKKELNKKLVE
                     VDDPTVADYLFINGGDGTFIKNAIKYDRAGLKIIGINGGSLGFYTTFNETNIDQIANN
                     LDQLKYTQLDFIKLQIDDQIYHALNEFNINSTTAYGYDIFIDNEFYQKFRGTGLLIST
                     TTGSTGINKSANGAILFPRIKAIQMVELHPLLHSSFTTIQSPIILPIDTKIRIEIKEN
                     YCDHDACPRIVADGAVIRQGLSSTTIEISATRSQADYVATTDLRSYMQRLQKTFIY"
     misc_feature    318951..319730
                     /gene="ppnK"
                     /locus_tag="MGF_1890"
                     /note="ATP-NAD kinase; Region: NAD_kinase; cl01255"
                     /db_xref="CDD:260858"
     gene            319816..320193
                     /gene="ptsG_2"
                     /locus_tag="MGF_1897"
                     /db_xref="GeneID:12396605"
     CDS             319816..320193
                     /gene="ptsG_2"
                     /locus_tag="MGF_1897"
                     /note="MGF_1897"
                     /codon_start=1
                     /transl_table=4
                     /product="putative PTS system glucose-specific enzyme IIB
                     PtsG"
                     /protein_id="YP_005880539.1"
                     /db_xref="GI:385326102"
                     /db_xref="GeneID:12396605"
                     /translation="MYFKMNKFTWIFLNIITFGILRLVATKKAKRISSQINQELIKSE
                     KLPFDLDQFINILGGLENIQTTQATLNMIKINVVDKTKVNQDQIKSRLKINGIMWASH
                     DLSLVCGDYASSLSEQIIQLKNR"
     misc_feature    319954..>320109
                     /gene="ptsG_2"
                     /locus_tag="MGF_1897"
                     /note="Phosphotransferase system IIB components
                     [Carbohydrate transport and metabolism]; Region: PtsG;
                     COG1264"
                     /db_xref="CDD:224184"
     gene            320291..322045
                     /locus_tag="MGF_1899"
                     /db_xref="GeneID:12396606"
     CDS             320291..322045
                     /locus_tag="MGF_1899"
                     /note="MGF_1899"
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="YP_005880540.1"
                     /db_xref="GI:385326103"
                     /db_xref="GeneID:12396606"
                     /translation="MPIIRMNKKNRSLKDAPKSKKIGFFSGITIAIGSSIGAGIFFKA
                     QAVLQNSHYSLAFAIFSWLFAAFSVTSMALALVEISSGRNDNLSIIGWCQTFNNHYVY
                     KTCKNFMVYIYVPLTYFFMPFFFLLSIQDGIRGFNENYHGLNTKADWAILMLISVGIS
                     AYFIVVSGISSSAANFQNLIISVVKFLPLLLAIILGFVIFNHNGSKPVNPKIGLGFQN
                     SATTDLATKYSFSNLSPGFGLFISVGGIYFAYDGFYYAAGIQTEMKKPQKTPLAILIG
                     LLFVTLVYLIMAIAMSLGSTDGSPFGFKEYFARNDLLPLYAAFQITIGVGILGIINGL
                     SLWANRFMEDLIKKFELPFSMKLINKISPNKVVVGMQYNLILAVPVVIIASLIGGLGY
                     IDNSYSDADYGTGVGRIYSFSDLMANWTSVIAFVYIVIAIMGGLANRKTNKIKVNKSK
                     IFVPSAVCAIFTMVVSVSLTFFQPIADALLLYNIPFNDQYKNVYISRVLLVLVLFVFL
                     FIMFIPILIEDQLMIKSYGSVSKGELAKLRIKAEVKKTSFKQELLDYIKTLKTKDLND
                     DLKAALKEVNVEVDELII"
     misc_feature    320354..321727
                     /locus_tag="MGF_1899"
                     /note="Amino acid permease; Region: AA_permease_2;
                     pfam13520"
                     /db_xref="CDD:257840"
     gene            complement(322100..322762)
                     /gene="mscL"
                     /locus_tag="MGF_1913"
                     /db_xref="GeneID:12396607"
     CDS             complement(322100..322762)
                     /gene="mscL"
                     /locus_tag="MGF_1913"
                     /note="MGF_1913"
                     /codon_start=1
                     /transl_table=4
                     /product="large-conductance mechanosensitive channel MscL"
                     /protein_id="YP_005880541.1"
                     /db_xref="GI:385326104"
                     /db_xref="GeneID:12396607"
                     /translation="MKDLFNKDKQVSLSKNAMKNATQVVKRGNIFMLAIGLLLGTSFN
                     AVIASLANDVIIAAIAKLYNVQDLQKWQVQGIFIGKFFAALLSFVIINVILVSALFVS
                     YYIIEVRKAIKAKQLLAEGVNPTTTKPIEINKDEKIIELLEYNNMLLQQQIEIFGKAH
                     NMKVEILSKKFSDSVISVPFDINKPEPQSVEAANLEKMLRPNAQNAVSTSNWSGTEGL
                     IG"
     misc_feature    complement(<322490..322684)
                     /gene="mscL"
                     /locus_tag="MGF_1913"
                     /note="Large-conductance mechanosensitive channel, MscL;
                     Region: MscL; cl00860"
                     /db_xref="CDD:260664"
     gene            complement(322816..324015)
                     /locus_tag="MGF_1918"
                     /db_xref="GeneID:12396608"
     CDS             complement(322816..324015)
                     /locus_tag="MGF_1918"
                     /note="MGF_1918"
                     /codon_start=1
                     /transl_table=4
                     /product="ion channel-like protein"
                     /protein_id="YP_005880542.1"
                     /db_xref="GI:385326105"
                     /db_xref="GeneID:12396608"
                     /translation="MNLGFSKFKIGRNKLMRILSIIVWSKSDIDEHLVQYEKRIKLFR
                     GIYALIIVFASLISFVTLVITPKTDNNNIFAQFAKVTLLLTFFVFITDWLAHAFTYKH
                     ATGLPQIKFVKAFLKYFFTFNSIVIIICVLSSGQAIKFFVTNLSATNELIFASFQSLA
                     LVKTIRLFMVLSLFKPFGAITSVFVTQKKLLASVFLIIIVLIILFAIIIWSQETVELL
                     RKRAAFLTQVSDNYLNFSQFAVFIHLNKLMQGSGQYEEAINKITDAQIQAAASALNSV
                     DASNFASLSSGYVQNFTEAFYFTTITLTTVGYGDFVPHAPISRVIVSFISLLAISIIA
                     IPSGIIAGSFLTEMQKSSERNKVKTKKNPDNKKDNFFMIPKKKQAETNIKKKPLDQCE
                     LIPIKQN"
     misc_feature    complement(322993..>323145)
                     /locus_tag="MGF_1918"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(324620..325783)
                     /locus_tag="MGF_1923"
                     /db_xref="GeneID:12396609"
     CDS             complement(324620..325783)
                     /locus_tag="MGF_1923"
                     /note="MGF_1923"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880543.1"
                     /db_xref="GI:385326106"
                     /db_xref="GeneID:12396609"
                     /translation="MNKQNILEKNKLNIKRISVTIVSFIVLLIAVLTFIFLKNISFKK
                     IFDILRDPSDTRQKVFIFLIFACMVYGFLWQFLTLYIIARRYKVKTRWYDWLIYALVS
                     TLINNVTPFAAGAEPYKVYWLVKNKVKLSDAITVVGATAIYWSIVQITVTWPSFIYIS
                     TNYNLLIESKSGIIAYWFSFFGMLVDFGIFTTFATAVFSVKFHLFVYKVVNKIRKLLK
                     LKDLTEDKRLEYVNQKKAFIKEFKHYWVVIFMFLFTASLVIFQYSSVYMSLVILDSKL
                     TDLYNFIKVFNFSNVAITANNFIPIPGGEGTIQVTLELYFQSLVNPSLLSREFIRYFD
                     SKAFNTDINNTIFLWRFALFYLPTMIGIIPSLYEIIVYFKSLHKPKNSTVIIT"
     misc_feature    complement(324683..325759)
                     /locus_tag="MGF_1923"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG0392"
                     /db_xref="CDD:223469"
     gene            325968..327749
                     /gene="dnaK"
                     /locus_tag="MGF_1924"
                     /db_xref="GeneID:12396610"
     CDS             325968..327749
                     /gene="dnaK"
                     /locus_tag="MGF_1924"
                     /note="MGF_1924"
                     /codon_start=1
                     /transl_table=4
                     /product="chaperone protein dnaK (Heat shock protein 70)"
                     /protein_id="YP_005880544.1"
                     /db_xref="GI:385326107"
                     /db_xref="GeneID:12396610"
                     /translation="MSNNNGLIIGIDLGTTNSCVSVMEGAQKVVIENPEGKRTTPSVV
                     SYKNGEIIVGDAAKRQMLTNPNTIVSIKRLMGTSKKVKINDKGVEKELTPEEVSASIL
                     SYLKDYAEKKTGQKISRAVITVPAYFNDAERQATKTAGKIAGLTVERIINEPTAAALA
                     YGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTFEVMATAGDNRLGGDDWDNKIIEWI
                     IAEIKKDHPSLDLKSDKMAMQRLKEAAERAKIELSAQLETLISLPFIAVTPEGPVNAE
                     LTLSRAKFEELTKDLLERTRNPIADVLKEAKVDPSQVDEILLVGGSTRMPAVQKLVES
                     MIPNKAPNRTINPDEVVAIGAAVQGGVLRGDVKDILLLDVTPLTLAIETLGGVATPII
                     KRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGGIQPAPKGKP
                     QIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAI
                     VKQRIEMRYEGEGIVNTINEILGSKEAEALPAQEKASLTKIVDGINGALKAEKWDELK
                     EQIDGFKKWRDDMSKKYGGGEAPAEPK"
     misc_feature    325983..327677
                     /gene="dnaK"
                     /locus_tag="MGF_1924"
                     /note="molecular chaperone DnaK; Provisional; Region:
                     dnaK; PRK00290"
                     /db_xref="CDD:234715"
     misc_feature    325983..327053
                     /gene="dnaK"
                     /locus_tag="MGF_1924"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    order(326001..326012,326016..326018,326022..326024,
                     326424..326426,326493..326504,326925..326927)
                     /gene="dnaK"
                     /locus_tag="MGF_1924"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            328032..330209
                     /locus_tag="MGF_1934"
                     /db_xref="GeneID:12396611"
     CDS             328032..330209
                     /locus_tag="MGF_1934"
                     /note="MGF_1934"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880545.1"
                     /db_xref="GI:385326108"
                     /db_xref="GeneID:12396611"
                     /translation="MAKKTTWLKLFCSLSGLSVISSSCFNPESFFSFKNESDTIKLSN
                     ITSNDLTVSDKLTHNNLLASNITSSNFSRYFELKLVQKADEQQDLDEQQDLNNLVDIK
                     VGGFSADDSNGILSFIVTLEKKNSNPVEFKQVSLEINGFLKKQEPVSQPKNDTDNVKK
                     PENSNNDESTDTTPPPTSDEPSTDQEKNPNSSDESSTDQSSSPTTVDETKKVDETKKP
                     EPSSSETKLRVFSDQEIYKKIYDRTFSLEFYTRYTRKNSSNSNIEQLYYLNNGTGWLL
                     DYQVSPQNPDLYRLFLATNLHVAQTLWNKNDFDRPVTDLKSAPETIGFSLGKSDQVEF
                     SAQNSSLNNSVVKYATLLDNTAFYNRVPNRANSWRVSSQRLTIPQTVFAAVDFVNDQE
                     TTQEFSSYWANQFKTQFVNNRLDDKNLLEHTYPKDAESRTKIADKYLEQGIGLYKDFA
                     VLSVVVNLSPKMLANETAQRYDGSRLLRKYVLEAIHELNESSRLAKLPGQLNLTNQDL
                     PYVDLDYPSIDQNQPNAYSFEEINKAYIAGYPGVEDSSNSSRVNFRWVQNNLNKDPNY
                     QLKPNINSGLVNKTQDITGLIQSYHNKYYHQYGITQEVLRSSLRSGSSGSVVYSKYGL
                     PFGIFWGGYNGGDPQQEENNRGLFDYLANDTKKSLNINVRYSNPNRASRFKINIEPYN
                     LIDGTNKQKYPNQTNSYREALAKYLVWSQNNNFSNSTYLFSHP"
     misc_feature    <328470..>328709
                     /locus_tag="MGF_1934"
                     /note="Ebola nucleoprotein; Region: Ebola_NP; pfam05505"
                     /db_xref="CDD:147601"
     misc_feature    328728..329924
                     /locus_tag="MGF_1934"
                     /note="Putative peptidase (DUF31); Region: DUF31;
                     pfam01732"
                     /db_xref="CDD:250823"
     gene            complement(330789..331205)
                     /locus_tag="MGF_1948"
                     /db_xref="GeneID:12396612"
     CDS             complement(330789..331205)
                     /locus_tag="MGF_1948"
                     /note="MGF_1948"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical domain protein"
                     /protein_id="YP_005880546.1"
                     /db_xref="GI:385326109"
                     /db_xref="GeneID:12396612"
                     /translation="MQTANYNKLREKMNLPLFKDYSKIFTEEDKAKLILQGLLGSIRG
                     DLIRDKAVIRGRVVTTGHSYNIGTDNVMKKHHLLYSENYYGSYNTPTISTRNVELSYG
                     LLATRMFKTVLGEKDSFKNTSFIKAGKTLQITEVTY"
     gene            331327..332445
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /db_xref="GeneID:12396613"
     CDS             331327..332445
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /note="MGF_1950; GTP-binding protein lepA fragment;
                     acetyl-CoA hydrolase/transferase, degenerate; this region
                     contains an N-terminal trucation resulting from tandem
                     duplication"
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein lepA domain protein"
                     /protein_id="YP_005880547.1"
                     /db_xref="GI:385326110"
                     /db_xref="GeneID:12396613"
                     /translation="MANNVKYVVTEVGIKNPNMQSRAYLEAGEVGYVTASIKTIRDVH
                     VGDTITNANNPCDKPLAGYRKVSPMVYAGLYPVDTADYQNLKVAMEKIVLTDAALEYE
                     YETSNALGFGVRCGFLGLLHMDVIRERIVREYNIPLILLAPSVMYKCYLTDGQELKVD
                     NPANMPERNRIKSMLEPYVKLSISTPDEFIGPIMELCQNFRGEYMELSEIDSSRKVLV
                     YEIPLAEIIYSFFDKLKSVTKGYASLDYELIGYRDSNLVKVDILLNGQKVDALSFISH
                     TQFVYQKAKKIVEKLKTLIPRHLFEIPIQAAVGSKIISRETIKAMRKNVLAKCYGGDV
                     SRKKKLLEQQKEGKKRLKAIGSVQIPQETFSKLLQDDE"
     misc_feature    <331327..331479
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /note="Translation_Factor_II_like: Elongation factor Tu
                     (EF-Tu) domain II-like proteins. Elongation factor Tu
                     consists of three structural domains, this family
                     represents the second domain. Domain II adopts a beta
                     barrel structure and is involved in binding to...; Region:
                     Translation_Factor_II_like; cl02787"
                     /db_xref="CDD:261449"
     misc_feature    331528..331746
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    331852..332091
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /note="lepA_C: This family represents the C-terminal
                     region of LepA, a GTP-binding protein localized in the
                     cytoplasmic membrane.   LepA is ubiquitous in Bacteria and
                     Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is
                     missing from Archaea. LepA exhibits...; Region: lepA_C;
                     cd03709"
                     /db_xref="CDD:239680"
     misc_feature    332113..332433
                     /gene="lepA"
                     /locus_tag="MGF_1950"
                     /note="GTP-binding protein LepA C-terminus; Region:
                     LepA_C; pfam06421"
                     /db_xref="CDD:203441"
     gene            332438..333880
                     /locus_tag="MGF_1957"
                     /db_xref="GeneID:12396614"
     CDS             332438..333880
                     /locus_tag="MGF_1957"
                     /note="MGF_1957"
                     /codon_start=1
                     /transl_table=4
                     /product="putative permease"
                     /protein_id="YP_005880548.1"
                     /db_xref="GI:385326111"
                     /db_xref="GeneID:12396614"
                     /translation="MNNQFDWLLVQLSNQASIVLSERYKISLIINVVLFLFALIISII
                     FFWRIKFENKGYKKLFVFYSIFWLPIFLVRSYRGTLHNDLALDRNLLFLPLSLYGFVG
                     IFFRPLFDYLGIRFKSRKKVVFAALLLQLATFIPIIIKPSFATNFIQTIGVGIAASCI
                     GSFSLWFNEQHAKEKPFLAISILSIPPLIADFVASPVQSLVRTLAITTQRTADVNITK
                     YLWLIGLIVILINIVFWWFLRENPQFVGLKKHDPKDIIDGSPNKIYCFIVVILFAGIV
                     IFTKFATADGIAQITLQQLVGNSNSAPYEGYLSSVFSAAQLLGGVLMGVVGVKYFDKW
                     MVALIGSIFFVLYNTSMILLINSTSVPTLTKGGIYLGIQAISGFGYGILYNLLIAHAL
                     SYGFKNNKITPIGINQTTASIAITSANFFTTFIRDKISSDFVKANTVISYILIGTVLA
                     GLSLYFFNSWIDHDKKLKPIFWIKSFKSCI"
     misc_feature    332612..333808
                     /locus_tag="MGF_1957"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(332645..332647,332654..332662,332666..332671,
                     332720..332722,332729..332734,332741..332743,
                     332753..332758,332762..332767,332906..332911,
                     332918..332920,332927..332932,332939..332941,
                     332975..332980,332987..332992,333008..333010,
                     333269..333271,333278..333283,333290..333295,
                     333302..333304,333344..333346,333362..333364,
                     333374..333376,333383..333385,333395..333397,
                     333566..333568,333575..333580,333587..333589,
                     333599..333604,333611..333613,333644..333649,
                     333656..333661,333668..333673,333680..333682)
                     /locus_tag="MGF_1957"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            333948..339884
                     /locus_tag="MGF_1971"
                     /db_xref="GeneID:12396615"
     CDS             333948..339884
                     /locus_tag="MGF_1971"
                     /note="MGF_1971"
                     /codon_start=1
                     /transl_table=4
                     /product="putative cytadherence-associated protein"
                     /protein_id="YP_005880549.1"
                     /db_xref="GI:385326112"
                     /db_xref="GeneID:12396615"
                     /translation="MPKMIKGTEFIVAKKTKNKKKNHFEDIQTTNDINEEESEAIFGN
                     LYDGADEVLPASLAYENGQLPEDGSIQVAFDADDNAYYISYDHENEIFIEPYEKYELD
                     ASALYDAEGNPFDFFANYHVEGAEAAQEEESGEYWEQFVGVEGYGYYDENEEWVWTGY
                     FDEDNKFIPNEEEEPAEVEALEEKSEAAEEVVEQEPQEEVQAEEVEEQPESKQEGSGE
                     YWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEDAAVAGDEQVEEYSAQEE
                     QAQEEYKQQPEQEVSGEYWEQFVGVEGYGYYDENNDWVWTGYFDENNNFVPDQYYDEY
                     GQPVNEEEYAESVSEEQVPVSEEQVVEEPAEVEEVVEEPAVEQVPEEAQPEQVQEEVQ
                     AYEHVEEQQPEEAYVEKQPQEEMVVVPEKAEEYVQEQPEEATADAIDEYYDEITHVED
                     EVVEEEQIQTDNFVSSDEINWSNYVGNEDYGYYDENNEWVWKGYFNEYGMFIPQQEDY
                     TDSIPVDEQPVEQTADLAEQAEEEVVEEPTASDEIVQVEEEEVESEPVVPTVTDDLVA
                     LEQPFEFDTQQFVGNIDFGYYDESSEWIWTGHFDKDGKFFDFDGNLVYSPQEGVKPVE
                     VPKPTDLTDQIPQNALVVAEPDVFSEDIIQQVDENQFDVGEELVVRGLLNPTSRPIQP
                     QELNIKPVFEEEKLNLPVLANEVSLQPEEPKVDYSKRSDSDQLVTQTPVVLEDAVADD
                     LISVDTKGFVPELSQPTFAPKAVSQDQFKLVQPVVSQPKFDQITHLADEIKMDVNVTS
                     SDVDVQPIQINPSLEVASEPSKLDIFVKKPAVELKKIEFIEPVSEKIDLQIFEQQEIV
                     TKPVSTIQKPTYTDETVSVSVNAIDETTSETDTIVQVTPTTSEASDFDINKILNTKPV
                     ETITVELPKDEPKLVTGVHVSLVDVEAKPVEEIVEFDSPKPSVSEVVVEKEDKVTLVE
                     EEPFFNKFIGNEQYGYYNNKNVWIWTGYFDDQNNFVSDKDSKTQKVDQLIEEFNKQEA
                     IKKTEEVEAKKASEPFYNKYIGNKQFGYYNDKNVWIWNGYFDENDQFVPDQSSTKRSE
                     KLIEDELQKQRIHELELELAQAQQAILESTKLKDQEVAKIKEEVLKVQQEAIKAKEVA
                     TLRNFVPKGSPLLNPAKEVENSMIVYQEDKLEVNDLRNELSKLKTQREEFDNFSKIRD
                     LDVINLYNASTSHRGMDYVFSGFEKKEEQFVKKPLHFLEEVKADPVQVAKEETISNLD
                     QLLKQDPHLLLAKKTDKSVNPQASLTVLADQKEVELTQQAVRKQAEAIEAERVDVIKP
                     LEQVQLNQSRSLLDDLTPKFEVKPSLIKDDVIQPKYNDDLEPIEQLQFKQERSLLDDY
                     MPKFDDQGLFSKVEFKLPTVNKEYRPKVEPIDVIKPLEPVRINKERSLLDDYLPPKLN
                     AQPTFEKTELDLGLEKPLANGELYEELKAEFSTTITPADSKDMIDQLLEETNDLITSS
                     TQTRSTKIHSFSKSPLKTEPEPILDTKFDDKFIELDENQGFDQLIVESDDELLTDVVQ
                     EQVSVNQIAVTNEEYKKDMAELKQFLEKRSEELFKQYFSKFEELTKLQMESFNQIKNE
                     LRSEMNEIRDEVRSNKLALTSEITEEIYPSAPKVSRKQRGVHGFSEPTSEFDFDNSLS
                     LVNENNYDLYELLDRIINYEDVPLTSSNLFKAEEYQAKVKQSVYNIKLILKNSEAEAT
                     KNYNYILSTLKNEITLLQKDLPIISSQLNKLQHDLRAKQLNRGDYKFVQEQIQELRAE
                     HANKTRAISFYNKKVSDLKSIYAQQIRKIKSDYKKISDLANKRKVSSDYIDQALQSFE
                     TARVSQPNIKRNYEQLYRNQLQQNVNANYGNFRRYDPLIENPGYEYFSNHQPREFFSE
                     LESIDNDIFSSNDLIYSNRNTYLDENFRINDYELTSNFNDIDAIYGMDKLRLPPFEPS
                     NLVNDMEFNSSFDIDFDTDF"
     misc_feature    334020..334301
                     /locus_tag="MGF_1971"
                     /note="cytadherence high molecular weight protein 1
                     N-terminal region; Region: termin_org_HMW1; TIGR03836"
                     /db_xref="CDD:163548"
     misc_feature    334368..334451
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    334617..334700
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    334842..334925
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    335091..>336410
                     /locus_tag="MGF_1971"
                     /note="terminal organelle assembly protein TopJ; Region:
                     termin_org_DnaJ; TIGR03835"
                     /db_xref="CDD:234368"
     misc_feature    335370..335453
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    335682..335765
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    336888..336971
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    337098..337181
                     /locus_tag="MGF_1971"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     gene            339931..340917
                     /locus_tag="MGF_2006"
                     /db_xref="GeneID:12396616"
     CDS             339931..340917
                     /locus_tag="MGF_2006"
                     /note="MGF_2006"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880550.1"
                     /db_xref="GI:385326113"
                     /db_xref="GeneID:12396616"
                     /translation="MNNEQTKTLDLGINANHNSYGSINAPSRAAQIQEKEYSGVFNPG
                     SLEVTNLKEESAQSLNNLERSIPWFYKREIFYNTLDLIFGLLVILGFGTGLILLCLYI
                     YFNNKSWHIVWAALPFGILALFIGYRTISSYANIKGGLKHEYIFSKAQIAVNIKRAYK
                     NLRLIPVNMNWLSAAIYLTITIAIIVTLVSAFAINLITIANLNQEFTREQINAAKTFG
                     YLYVLKANSELDKWPLYSIIVNGTIGIGTLILQIYLIINSSIRARAIENFYGKMPIEE
                     EDMHRAIVAANKRNFKIFLVYLVIIGLVVLLVKKIITGSLSAINKKKVISIK"
     gene            340917..341786
                     /locus_tag="MGF_2009"
                     /db_xref="GeneID:12396617"
     CDS             340917..341786
                     /locus_tag="MGF_2009"
                     /EC_number="3.6.1.-"
                     /note="MGF_2009"
                     /codon_start=1
                     /transl_table=4
                     /product="HAD superfamily hydrolase Cof"
                     /protein_id="YP_005880551.1"
                     /db_xref="GI:385326114"
                     /db_xref="GeneID:12396617"
                     /translation="MSDLDKNKQLKLIGIDLDGTLLSIRKKVTKKVIGSLLELRKKLP
                     NIVIAIITGRSYLSAKRVVNELQEAGVKINYLCSYNGSVLFKINEQSELIKLDEHSID
                     SLTTKAIFDYCTKNKIVFQGYLVTDEVNRSIVLSDNFSGRLIASFNKNKSFCSKDFVD
                     GRYYKINLISSNHKRLKRFNQFVSENYSDDLEIANIYPTFLEITTKNINKAFALASVC
                     DLENISLEQTAVIGDSLNDYSMFEIASYKFAMKRANKKLKDISTYIASSRRHNQFKEI
                     IQKTIAIVDDEKK"
     misc_feature    340950..>341186
                     /locus_tag="MGF_2009"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    340959..341717
                     /locus_tag="MGF_2009"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    order(340962..340970,341070..341075)
                     /locus_tag="MGF_2009"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    340962..340979
                     /locus_tag="MGF_2009"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    341070..341072
                     /locus_tag="MGF_2009"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <341406..341642
                     /locus_tag="MGF_2009"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    341424..341426
                     /locus_tag="MGF_2009"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <341541..341663
                     /locus_tag="MGF_2009"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(342165..343031)
                     /locus_tag="MGF_2020"
                     /db_xref="GeneID:12396618"
     CDS             complement(342165..343031)
                     /locus_tag="MGF_2020"
                     /EC_number="3.6.1.-"
                     /note="MGF_2020"
                     /codon_start=1
                     /transl_table=4
                     /product="HAD superfamily hydrolase Cof"
                     /protein_id="YP_005880552.1"
                     /db_xref="GI:385326115"
                     /db_xref="GeneID:12396618"
                     /translation="MKNKKLLIISDLDGTLLNDESKLSYQTIKVIKLLNKLGHHFCIA
                     TGRPSRASIDIYNELGLNTVMANLNGSYIWHPKDRFFKAINLSFSKDIVKNLLHKTSI
                     IKLVDNFIVENNEGTYIMNKPVSSREHDELLQCFHIDGKDNCTFGQDKILNLRQDPNA
                     ILLQVKNPHNIDEVVFQLKECFSTFVVRKWSLPVSGIIIEVNTVYANKGNALDYLSSY
                     YGIPKEFVVTFGDGENDIEMLQKSRFGYAMKNAISSAKLLARYITKYNNNDHGVGFEL
                     FHKIIKRSLKNS"
     misc_feature    complement(<342786..343013)
                     /locus_tag="MGF_2020"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(342204..343010)
                     /locus_tag="MGF_2020"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    complement(order(342894..342899,342993..343001))
                     /locus_tag="MGF_2020"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(342984..343001)
                     /locus_tag="MGF_2020"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(342897..342899)
                     /locus_tag="MGF_2020"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(342291..>342449)
                     /locus_tag="MGF_2020"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            complement(343034..344086)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /db_xref="GeneID:12396619"
     CDS             complement(343034..344086)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /EC_number="6.1.1.2"
                     /note="MGF_2027; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_005880553.1"
                     /db_xref="GI:385326116"
                     /db_xref="GeneID:12396619"
                     /translation="MIKIISGIQSTGSLHIGNYLGSISKNINLQNKYQLNLFVANLHT
                     ITVDFDPTQARQNIIELVKIYLASGFDTNKNNIFLQSEINEHAALGHVLLCHTTMGEL
                     ERMTQYKDKKQKFVQSNQTIKIPTGLLTYPTLMAADILLYQSDYVCVGDDQKQHLELT
                     RDIAIRMNKRYGELFKVPEPIIAKVGSRIMDLNDPSKKMSKSSLSKKGIINLDDSREE
                     VLSKIKSAKTDNLNKVNFDYKTQPEISNLVSIYYGVINDHFNLGLKSAKFNKTLDEEV
                     VPIDIIKHFENKSYKDFKEELLELIWNILDNIQTNMKKITDEDVMRVLKSGKDKLLPI
                     AQKTLLKVYQKLGMVI"
     misc_feature    complement(343040..344077)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    complement(343175..344077)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(343478..343480,343484..343489,
                     343523..343525,343619..343621,343628..343633,
                     343637..343642,343646..343648,343673..343675,
                     343682..343684,343694..343696,343847..343849,
                     343958..343960,343973..343975,344024..344026,
                     344033..344038,344042..344044,344060..344074))
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    complement(344033..344044)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(343685..343690,343697..343702,
                     343706..343708,343778..343783,343787..343798,
                     343802..343807,343814..343822,343826..343831,
                     343949..343954,343961..343963))
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(343475..343489)
                     /gene="trpS"
                     /locus_tag="MGF_2027"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            344159..344638
                     /gene="spxA"
                     /locus_tag="MGF_2026"
                     /db_xref="GeneID:12396620"
     CDS             344159..344638
                     /gene="spxA"
                     /locus_tag="MGF_2026"
                     /note="MGF_2026"
                     /codon_start=1
                     /transl_table=4
                     /product="regulatory protein spx"
                     /protein_id="YP_005880554.1"
                     /db_xref="GI:385326117"
                     /db_xref="GeneID:12396620"
                     /translation="MTNNQNSQTNNIVLFITASCIGCTRVRRFFREYNIQHKEINFYK
                     TAIEEKYFNDILSLTENGVFDIISTRSKYLQNNKVNIDELTISQLITLVNEHPSILKR
                     PIILQYDKSGIPKRLMVGYNSTDIRVFLREVADVKAYYLDEYWFDDESSPSSRKEDE"
     misc_feature    344192..344551
                     /gene="spxA"
                     /locus_tag="MGF_2026"
                     /note="Arsenate Reductase (ArsC) family, Spx subfamily;
                     Spx is a unique RNA polymerase (RNAP)-binding protein
                     present in bacilli and some mollicutes. It inhibits
                     transcription by binding to the C-terminal domain of the
                     alpha subunit of RNAP, disrupting complex...; Region:
                     ArsC_Spx; cd03032"
                     /db_xref="CDD:239330"
     misc_feature    order(344216..344218,344360..344362,344462..344464,
                     344519..344521)
                     /gene="spxA"
                     /locus_tag="MGF_2026"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239330"
     misc_feature    order(344216..344218,344225..344227)
                     /gene="spxA"
                     /locus_tag="MGF_2026"
                     /note="thiol/disulfide switch; other site"
                     /db_xref="CDD:239330"
     gene            344595..345419
                     /gene="ppnK"
                     /locus_tag="MGF_2031"
                     /db_xref="GeneID:12396621"
     CDS             344595..345419
                     /gene="ppnK"
                     /locus_tag="MGF_2031"
                     /EC_number="2.7.1.23"
                     /note="MGF_2031"
                     /codon_start=1
                     /transl_table=4
                     /product="inorganic polyphosphate/ATP-NAD kinase"
                     /protein_id="YP_005880555.1"
                     /db_xref="GI:385326118"
                     /db_xref="GeneID:12396621"
                     /translation="MMMKVHQVQEKKMNKTYYLISSLAPKSESLKPLIKKELNKKLVE
                     VDDPTVADYLFINGGDGTFIKNAIKYDRAGLKIIGINGGSLGFYTTFNETNIDQIANN
                     LDQLKYTQLDFIKLQIDDQIYHALNEFNINSTTAYGYDIFIDNEFYQKFRGTGLLIST
                     TTGSTGINKSANGAILFPRIKAIQMVELHPLLHSSFTTIQSPIILPIDTKIRIEIKEN
                     YCDHDACPRIVADGAVIRQGLSSTTIEISATRSQADYVATTDLRSYMQRLQKTFIY"
     misc_feature    344637..345416
                     /gene="ppnK"
                     /locus_tag="MGF_2031"
                     /note="ATP-NAD kinase; Region: NAD_kinase; cl01255"
                     /db_xref="CDD:260858"
     gene            345502..345879
                     /gene="ptsG_2"
                     /locus_tag="MGF_2038"
                     /db_xref="GeneID:12396622"
     CDS             345502..345879
                     /gene="ptsG_2"
                     /locus_tag="MGF_2038"
                     /note="MGF_2038"
                     /codon_start=1
                     /transl_table=4
                     /product="putative PTS system glucose-specific enzyme IIB
                     PtsG"
                     /protein_id="YP_005880556.1"
                     /db_xref="GI:385326119"
                     /db_xref="GeneID:12396622"
                     /translation="MYFKMNKFTWIFLNIITFGILRLVATKKAKRISSQINQELIKSE
                     KLPFDLDQFINILGGLENIQTTQATLNMIKINVVDKTKVNQDQIKSRLKINGIMWASH
                     DLSLVCGDYASSLSEQIIQLKNR"
     misc_feature    345640..>345795
                     /gene="ptsG_2"
                     /locus_tag="MGF_2038"
                     /note="Phosphotransferase system IIB components
                     [Carbohydrate transport and metabolism]; Region: PtsG;
                     COG1264"
                     /db_xref="CDD:224184"
     gene            345977..347731
                     /locus_tag="MGF_2040"
                     /db_xref="GeneID:12396623"
     CDS             345977..347731
                     /locus_tag="MGF_2040"
                     /note="MGF_2040"
                     /codon_start=1
                     /transl_table=4
                     /product="amino acid permease"
                     /protein_id="YP_005880557.1"
                     /db_xref="GI:385326120"
                     /db_xref="GeneID:12396623"
                     /translation="MPIIRMNKKNRSLKDAPKSKKIGFFSGITIAIGSSIGAGIFFKA
                     QAVLQNSHYSLAFAIFSWLFAAFSVTSMALALVEISSGRNDNLSIIGWCQTFNNHYVY
                     KTCKNFMVYIYVPLTYFFMPFFFLLSIQDGIRGFNENYHGLNTKADWAILMLISVGIS
                     AYFIVVSGISSSAANFQNLIISVVKFLPLLLAIILGFVIFNHNGSKPVNPKIGLGFQN
                     SATTDLATKYSFSNLSPGFGLFISVGGIYFAYDGFYYAAGIQTEMKKPQKTPLAILIG
                     LLFVTLVYLIMAIAMSLGSTDGSPFGFKEYFARNDLLPLYAAFQITIGVGILGIINGL
                     SLWANRFMEDLIKKFELPFSMKLINKISPNKVVVGMQYNLILAVPVVIIASLIGGLGY
                     IDNSYSDADYGTGVGRIYSFSDLMANWTSVIAFVYIVIAIMGGLANRKTNKIKVNKSK
                     IFVPSAVCAIFTMVVSVSLTFFQPIADALLLYNIPFNDQYKNVYISRVLLVLVLFVFL
                     FIMFIPILIEDQLMIKSYGSVSKGELAKLRIKAEVKKTSFKQELLDYIKTLKTKDLND
                     DLKAALKEVNVEVDELII"
     misc_feature    346040..347413
                     /locus_tag="MGF_2040"
                     /note="Amino acid permease; Region: AA_permease_2;
                     pfam13520"
                     /db_xref="CDD:257840"
     gene            complement(347786..348448)
                     /gene="mscL"
                     /locus_tag="MGF_2054"
                     /db_xref="GeneID:12396624"
     CDS             complement(347786..348448)
                     /gene="mscL"
                     /locus_tag="MGF_2054"
                     /note="MGF_2054"
                     /codon_start=1
                     /transl_table=4
                     /product="large-conductance mechanosensitive channel MscL"
                     /protein_id="YP_005880558.1"
                     /db_xref="GI:385326121"
                     /db_xref="GeneID:12396624"
                     /translation="MKDLFNKDKQVSLSKNAMKNATQVVKRGNIFMLAIGLLLGTSFN
                     AVIASLANDVIIAAIAKLYNVQDLQKWQVQGIFIGKFFAALLSFVIINVILVSALFVS
                     YYIIEVRKAIKAKQLLAEGVNPTTTKPIEINKDEKIIELLEYNNMLLQQQIEIFGKAH
                     NMKVEILSKKFSDSVISVPFDINKPEPQSVEAANLEKMLRPNAQNAVSTSNWSGTEGL
                     IG"
     misc_feature    complement(<348176..348370)
                     /gene="mscL"
                     /locus_tag="MGF_2054"
                     /note="Large-conductance mechanosensitive channel, MscL;
                     Region: MscL; cl00860"
                     /db_xref="CDD:260664"
     gene            complement(348502..349701)
                     /locus_tag="MGF_2059"
                     /db_xref="GeneID:12396625"
     CDS             complement(348502..349701)
                     /locus_tag="MGF_2059"
                     /note="MGF_2059"
                     /codon_start=1
                     /transl_table=4
                     /product="ion channel-like protein"
                     /protein_id="YP_005880559.1"
                     /db_xref="GI:385326122"
                     /db_xref="GeneID:12396625"
                     /translation="MNLGFSKFKIGRNKLMRILSIIVWSKSDIDEHLVQYEKRIKLFR
                     GIYALIIVFASLISFVTLVITPKTDNNNIFAQFAKVTLLLTFFVFITDWLAHAFTYKH
                     ATGLPQIKFVKAFLKYFFTFNSIVIIICVLSSGQAIKFFVTNLSATNELIFASFQSLA
                     LVKTIRLFMVLSLFKPFGAITSVFVTQKKLLASVFLIIIVLIILFAIIIWSQETVELL
                     RKRAAFLTQVSDNYLNFSQFAVFIHLNKLMQGSGQYEEAINKITDAQIQAAASALNSV
                     DASNFASLSSGYVQNFTEAFYFTTITLTTVGYGDFVPHAPISRVIVSFISLLAISIIA
                     IPSGIIAGSFLTEMQKSSERNKVKTKKNPDNKKDNFFMIPKKKQAETNIKKKPLDQCE
                     LIPIKQN"
     misc_feature    complement(348679..>348831)
                     /locus_tag="MGF_2059"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(350306..351469)
                     /locus_tag="MGF_2064"
                     /db_xref="GeneID:12396626"
     CDS             complement(350306..351469)
                     /locus_tag="MGF_2064"
                     /note="MGF_2064"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880560.1"
                     /db_xref="GI:385326123"
                     /db_xref="GeneID:12396626"
                     /translation="MNKQNILEKNKLNIKRISVTIVSFIVLLIAVLTFIFLKNISFKK
                     IFDILRDPSDTRQKVFIFLIFACMVYGFLWQFLTLYIIARRYKVKTRWYDWLIYALVS
                     TLINNVTPFAAGAEPYKVYWLVKNKVKLSDAITVVGATAIYWSIVQITVTWPSFIYIS
                     TNYNLLIESKSGIIAYWFSFFGMLVDFGIFTTFATAVFSVKFHLFVYKVVNKIRKLLK
                     LKDLTEDKRLEYVNQKKAFIKEFKHYWVVIFMFLFTASLVIFQYSSVYMSLVILDSKL
                     TDLYNFIKVFNFSNVAITANNFIPIPGGEGTIQVTLELYFQSLVNPSLLSREFIRYFD
                     SKAFNTDINNTIFLWRFALFYLPTMIGIIPSLYEIIVYFKSLHKPKNSTVIIT"
     misc_feature    complement(350369..351445)
                     /locus_tag="MGF_2064"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG0392"
                     /db_xref="CDD:223469"
     gene            351654..353435
                     /gene="dnaK"
                     /locus_tag="MGF_2065"
                     /db_xref="GeneID:12396627"
     CDS             351654..353435
                     /gene="dnaK"
                     /locus_tag="MGF_2065"
                     /note="MGF_2065"
                     /codon_start=1
                     /transl_table=4
                     /product="chaperone protein dnaK (Heat shock protein 70)"
                     /protein_id="YP_005880561.1"
                     /db_xref="GI:385326124"
                     /db_xref="GeneID:12396627"
                     /translation="MSNNNGLIIGIDLGTTNSCVSVMEGAQKVVIENPEGKRTTPSVV
                     SYKNGEIIVGDAAKRQMLTNPNTIVSIKRLMGTSKKVKINDKGVEKELTPEEVSASIL
                     SYLKDYAEKKTGQKISRAVITVPAYFNDAERQATKTAGKIAGLTVERIINEPTAAALA
                     YGIDKGHREMKVLVYDLGGGTFDVSLLDIADGTFEVMATAGDNRLGGDDWDNKIIEWI
                     IAEIKKDHPSLDLKSDKMAMQRLKEAAERAKIELSAQLETLISLPFIAVTPEGPVNAE
                     LTLSRAKFEELTKDLLERTRNPIADVLKEAKVDPSQVDEILLVGGSTRMPAVQKLVES
                     MIPNKAPNRTINPDEVVAIGAAVQGGVLRGDVKDILLLDVTPLTLAIETLGGVATPII
                     KRNTTIPVSKSQIFSTAQDNQESVDVSIYQGERPMARENKSLGTFSLGGIQPAPKGKP
                     QIEITFNIDANGILNVKAKDLTTGKENSITISNSSELDENEIQRMIRDAEANKERDAI
                     VKQRIEMRYEGEGIVNTINEILGSKEAEALPAQEKASLTKIVDGINGALKAEKWDELK
                     EQIDGFKKWRDDMSKKYGGGEAPAEPK"
     misc_feature    351669..353363
                     /gene="dnaK"
                     /locus_tag="MGF_2065"
                     /note="molecular chaperone DnaK; Provisional; Region:
                     dnaK; PRK00290"
                     /db_xref="CDD:234715"
     misc_feature    351669..352739
                     /gene="dnaK"
                     /locus_tag="MGF_2065"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    order(351687..351698,351702..351704,351708..351710,
                     352110..352112,352179..352190,352611..352613)
                     /gene="dnaK"
                     /locus_tag="MGF_2065"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            353718..355895
                     /locus_tag="MGF_2075"
                     /db_xref="GeneID:12396628"
     CDS             353718..355895
                     /locus_tag="MGF_2075"
                     /note="MGF_2075"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880562.1"
                     /db_xref="GI:385326125"
                     /db_xref="GeneID:12396628"
                     /translation="MAKKTTWLKLFCSLSGLSVISSSCFNPESFFSFKNESDTIKLSN
                     ITSNDLTVSDKLTHNNLLASNITSSNFSRYFELKLVQKADEQQDLDEQQDLNNLVDIK
                     VGGFSADDSNGILSFIVTLEKKNSNPVEFKQVSLEINGFLKKQEPVSQPKNDTDNVKK
                     PENSNNDESTDTTPPPTSDEPSTDQEKNPNSSDESSTDQSSSPTTVDETKKVDETKKP
                     EPSSSETKLRVFSDQEIYKKIYDRTFSLEFYTRYTRKNSSNSNIEQLYYLNNGTGWLL
                     DYQVSPQNPDLYRLFLATNLHVAQTLWNKNDFDRPVTDLKSAPETIGFSLGKSDQVEF
                     SAQNSSLNNSVVKYATLLDNTAFYNRVPNRANSWRVSSQRLTIPQTVFAAVDFVNDQE
                     TTQEFSSYWANQFKTQFVNNRLDDKNLLEHTYPKDAESRTKIADKYLEQGIGLYKDFA
                     VLSVVVNLSPKMLANETAQRYDGSRLLRKYVLEAIHELNESSRLAKLPGQLNLTNQDL
                     PYVDLDYPSIDQNQPNAYSFEEINKAYIAGYPGVEDSSNSSRVNFRWVQNNLNKDPNY
                     QLKPNINSGLVNKTQDITGLIQSYHNKYYHQYGITQEVLRSSLRSGSSGSVVYSKYGL
                     PFGIFWGGYNGGDPQQEENNRGLFDYLANDTKKSLNINVRYSNPNRASRFKINIEPYN
                     LIDGTNKQKYPNQTNSYREALAKYLVWSQNNNFSNSTYLFSHP"
     misc_feature    <354156..>354395
                     /locus_tag="MGF_2075"
                     /note="Ebola nucleoprotein; Region: Ebola_NP; pfam05505"
                     /db_xref="CDD:147601"
     misc_feature    354414..355610
                     /locus_tag="MGF_2075"
                     /note="Putative peptidase (DUF31); Region: DUF31;
                     pfam01732"
                     /db_xref="CDD:250823"
     gene            complement(356475..356960)
                     /locus_tag="MGF_2091"
                     /db_xref="GeneID:12396629"
     CDS             complement(356475..356960)
                     /locus_tag="MGF_2091"
                     /note="MGF_2091"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880563.1"
                     /db_xref="GI:385326126"
                     /db_xref="GeneID:12396629"
                     /translation="MKLDPNDIEVFRPLIAFNDHYSHMQTANYNKLREKMNLPLFKDY
                     SKIFTEEDKAKLILQGLLGSIRGDLIRDKAVIRGRVVTTGHSYNIGTDNVMKKHHLLY
                     SENYYGSYNTPTISTRNVELSYGLLATRMFKTVLGEKDSFKNTSFIKAGKTLQITEVT
                     Y"
     gene            complement(356966..357346)
                     /locus_tag="MGF_2095"
                     /db_xref="GeneID:12396630"
     CDS             complement(356966..357346)
                     /locus_tag="MGF_2095"
                     /note="MGF_2095"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880564.1"
                     /db_xref="GI:385326127"
                     /db_xref="GeneID:12396630"
                     /translation="MSDRGPTFNTYHATLDQINKYQASVQKEVAAQKAAEQTFNAIPT
                     ITGNNKGSVQTPQYQPKYNEIFNALLKTYGSGEQGGLYSDRDKYAYYDSFINDPKFVQ
                     TVNKYKEMFKKELEAGRGEFSNSL"
     misc_feature    complement(357407..357741)
                     /note="MGF_2099f; Potential unique hypothetical protein
                     gene region; intact in R strain"
     gene            complement(357407..357595)
                     /locus_tag="MGF_2098"
                     /db_xref="GeneID:12396631"
     CDS             complement(357407..357595)
                     /locus_tag="MGF_2098"
                     /note="MGF_2098"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical domain protein"
                     /protein_id="YP_005880565.1"
                     /db_xref="GI:385326128"
                     /db_xref="GeneID:12396631"
                     /translation="MNIQLDSSDVNSSSDQGRPKSQGELALEKAESWFRELKIKADQV
                     GDAVQYASVMQNIKAIEN"
     gene            complement(357520..357741)
                     /locus_tag="MGF_2099"
                     /db_xref="GeneID:12396632"
     CDS             complement(357520..357741)
                     /locus_tag="MGF_2099"
                     /note="MGF_2099"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical domain protein"
                     /protein_id="YP_005880566.1"
                     /db_xref="GI:385326129"
                     /db_xref="GeneID:12396632"
                     /translation="MVAKKKRLADQINLYSQVLESQYKQIGSAKDSEVGSYKSNLSAY
                     TAYIDWTYNLIQVMLILHLIKADQNHKEN"
     gene            complement(357704..358105)
                     /locus_tag="MGF_2102"
                     /db_xref="GeneID:12396633"
     CDS             complement(357704..358105)
                     /locus_tag="MGF_2102"
                     /note="MGF_2102; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880567.1"
                     /db_xref="GI:385326130"
                     /db_xref="GeneID:12396633"
                     /translation="MLTSLLLVAPLSAILVSCANKNETKEDSTNETVKTEKTLTNKND
                     EAASENQNPTNEGSSSTSNDKNTSEQPKQVNNKAVSEQNNAQTAPSAKNNAEKTLLLE
                     WVGQYVQKAKNLVSVISSHSGSEEKKISWSN"
     gene            358216..359475
                     /locus_tag="MGF_2103"
                     /db_xref="GeneID:12396634"
     CDS             358216..359475
                     /locus_tag="MGF_2103"
                     /note="MGF_2103; predicted transposase inserted in strain
                     F relative to strain R"
                     /codon_start=1
                     /transl_table=4
                     /product="trasposase"
                     /protein_id="YP_005880568.1"
                     /db_xref="GI:385326131"
                     /db_xref="GeneID:12396634"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LIDGEHVGKLELLRENADNDENVYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIP
                     KYQRIIHDKFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDW
                     HERPLENNYPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNT
                     ESATEWMNILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAK
                     YVSHSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGGSNKRAVEVVERAMDNIEKL
                     FSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLN
                     QKSNRVRNWYRIYEELMDVFPNLLNKN"
     misc_feature    358324..359454
                     /locus_tag="MGF_2103"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    358324..359289
                     /locus_tag="MGF_2103"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            360086..361933
                     /locus_tag="MGF_2118"
                     /db_xref="GeneID:12396635"
     CDS             360086..361933
                     /locus_tag="MGF_2118"
                     /note="MGF_2118"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880569.1"
                     /db_xref="GI:385326132"
                     /db_xref="GeneID:12396635"
                     /translation="MKRSKKILFSLGTVLPLAGGVLLTSCSEAMSRTKYNFAADADFR
                     KAAFGNIGTINQVKNVVENSLQLPKTAPTVTMAPDAGAAAPSAGSEAAGAEASTGTAA
                     AGGSGSSGSSASSSAGSGSQGGETTSTGSGGSSSNTSGQSGSAQANTAGGSGTSSSNS
                     GSQSSSTQGSAAAGTAASGSTSETAMMTMLSGAWKHFDAIVKAKMNSEKTTAEMGLMK
                     FYTDFKAKFDEVLKFEGSKNLRDGTASLEDLRTGKTDLETKAKALFTVYNALGTALGQ
                     SKTFDTTKKSFEELAEANQGLSTLYKLMNVDVYNFAKPIEGNSYNDLARFFEALNGFL
                     GGQFAMNTTTSNVFQLFGNITALLISRELRIIDGAINSVLLTTPSTNREGLETLLLTN
                     VNKNSTIKQRYDETVKTLNDVKAQTDQWANSPIVTKANNQQSKLEMAAAKANDTSKPI
                     LTRLVNALYGNSANMPGFAVKGLFRSVNDLKTQLDAVKTLVSANYTSLSDFINVYKMT
                     NTTWMEGVGIFVNSQALNGLNNTEIDKLTAASTSDAADTALFTEVKTELKRLVAATAS
                     LPKNGAGQDKKSAFYLNQMVRSITSDNQARLASMGEGAQEFSFYVNTAL"
     gene            362287..362910
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /db_xref="GeneID:12396636"
     CDS             362287..362910
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /note="MGF_2128"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S4"
                     /protein_id="YP_005880570.1"
                     /db_xref="GI:385326133"
                     /db_xref="GeneID:12396636"
                     /translation="MSRYTGSIYRKARRLNFSILESGKEFTNNKSKKGVKVPGQHGSL
                     IRPKLSNYGEQLQEKQKMQFMYGLNDRQFRRLFAVSKKMSGILTMNLFRTLESRLDNL
                     VFRMGFAPTRRGARQLVSHGHVLVNGKTFDIPSALISLGSVVELKPRAHNLPLVKLAL
                     ESKAVAPFVEVNKKTLSGTYVRYPERNELPADVNETYVVEYYKRLVK"
     misc_feature    362287..362898
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /note="30S ribosomal protein S4; Validated; Region: rpsD;
                     PRK05327"
                     /db_xref="CDD:235411"
     misc_feature    362290..362574
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /note="Ribosomal protein S4/S9 N-terminal domain; Region:
                     Ribosomal_S4; pfam00163"
                     /db_xref="CDD:249643"
     misc_feature    362578..362757
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(362578..362580,362614..362619,362623..362628,
                     362632..362637,362644..362649,362653..362655,
                     362674..362697,362701..362703)
                     /gene="rpsD"
                     /locus_tag="MGF_2128"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            362930..363355
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /db_xref="GeneID:12396637"
     CDS             362930..363355
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="MGF_2132"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S12"
                     /protein_id="YP_005880571.1"
                     /db_xref="GI:385326134"
                     /db_xref="GeneID:12396637"
                     /translation="MATIAQLIRKPRRHKVKKSKSPALQVNLNTLEKKVTSKSSPFKR
                     GVCTRVGTMTPKKPNSALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKD
                     LPGVRYHIVRGTLDTTGVDKRRQQRSAYGAKRPKADKKK"
     misc_feature    362936..363298
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    order(362939..362944,362948..362953,362960..362965)
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    362939..362941
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:239466"
     misc_feature    order(362963..362971,363044..363046,363050..363055,
                     363059..363061,363104..363109,363113..363121,
                     363140..363142,363164..363166,363173..363178,
                     363215..363220,363230..363235,363296..363298)
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(363095..363100,363230..363232)
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    363098..363103
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    order(363101..363118,363176..363202)
                     /gene="rpsL"
                     /locus_tag="MGF_2132"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     gene            363365..363832
                     /gene="rpsG"
                     /locus_tag="MGF_2137"
                     /db_xref="GeneID:12396638"
     CDS             363365..363832
                     /gene="rpsG"
                     /locus_tag="MGF_2137"
                     /note="MGF_2137"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S7"
                     /protein_id="YP_005880572.1"
                     /db_xref="GI:385326135"
                     /db_xref="GeneID:12396638"
                     /translation="MRKNRAEKRKVLPDPVYNSVLVTRAINAIMLDGKKGIAQKILYG
                     SFDLIAQKTQKDPLEIFNKAVENIMPRLELKVRRIAGANYQVPTDVSPERKVTLALRW
                     LVTLSRKRHEKTMLDKIANEIIDASNNTGASVKKREDTHKMAEANKAFAHMRM"
     misc_feature    363365..363826
                     /gene="rpsG"
                     /locus_tag="MGF_2137"
                     /note="30S ribosomal protein S7; Validated; Region:
                     PRK05302"
                     /db_xref="CDD:235398"
     gene            363846..365927
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /db_xref="GeneID:12396639"
     CDS             363846..365927
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="MGF_2142"
                     /codon_start=1
                     /transl_table=4
                     /product="Elongation factor G"
                     /protein_id="YP_005880573.1"
                     /db_xref="GI:385326136"
                     /db_xref="GeneID:12396639"
                     /translation="MARQYPLEKFRNFGIMAHIDAGKTTTSERILFHSGKTHKIGETH
                     DGASVMDWMAQEKERGITITSAATSVTWKDCQLNLIDTPGHVDFTVEVERSLRVLDGA
                     VAVLDAQMGVEPQTETVWRQASRYEVPRIVFVNKMDKTGANFQRSVDSIHSRLGVKSV
                     PIQLPIGAENDFVGIIDLVEMKAYFFDGGENENYETKEIPAEYLEEAKKAHNHMLDEI
                     VTFDEAVMEKYLDGQEISKAEIKSCIRKGVVSSTLFPVLCGTAFKNKGVKPLLDAVVD
                     YLPSPIDVPPAKGYKVGEEVQIPTSDDAPFVGLAFKVATDPFVGRLTFVRVYSGVLTS
                     GSYVINTTKDKKERVSRIVKMHAQQRDEIDEIRAGDICAIVGLKDTTTGDTIASENQN
                     LTLESMTFAQPVISLAVEPKTKADQEKMGISLSKLAEEDPTFRTYTDEETGQTIIAGM
                     GELHLDILVDRLRREFKVDVNVGAPQVSYRETLKAKADVEGKYIKQSGGRGQYGHVVI
                     TFEPNHDKGFEFEDKIVGGKIPKEYIKSVKAGLEAAMNNGPLAGYPMIDIKASLFDGS
                     YHDVDSNEMAYKIAASMALKEAGKRCQPALLEPIMAIEVTVPEQYFGDTMGDISSRRG
                     MIEGTESRDNVQVIKAKVPLSEMFGYATDLRSFTQGRGNYIMQFSHYAEAPKSVVEKV
                     IEDKAKKNKTA"
     misc_feature    363846..365909
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="elongation factor G; Reviewed; Region: PRK00007"
                     /db_xref="CDD:234569"
     misc_feature    363879..364688
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="Elongation factor G (EF-G) family involved in both
                     the elongation and ribosome recycling phases of protein
                     synthesis; Region: EF-G; cd01886"
                     /db_xref="CDD:206673"
     misc_feature    363894..363917
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="G1 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(363897..363899,363903..363905,363915..363920,
                     363927..363929,363936..363941,364041..364046,
                     364098..364103,364170..364175,364281..364283,
                     364293..364295)
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206673"
     misc_feature    order(363903..363905,363909..363920,364248..364253,
                     364257..364259,364623..364631)
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206673"
     misc_feature    363984..364043
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206673"
     misc_feature    364029..364031
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="G2 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    364086..364097
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="G3 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    364092..364148
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206673"
     misc_feature    364248..364259
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="G4 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    364623..364631
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="G5 box; other site"
                     /db_xref="CDD:206673"
     misc_feature    364761..365009
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="EFG_mtEFG_II: this subfamily represents the domain
                     II of elongation factor G (EF-G) in bacteria and, the
                     C-terminus of mitochondrial Elongation factor G1 (mtEFG1)
                     and G2 (mtEFG2)_like proteins found in eukaryotes. During
                     the process of peptide synthesis...; Region: EFG_mtEFG_II;
                     cd04088"
                     /db_xref="CDD:239755"
     misc_feature    365043..365264
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    365280..365624
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="EFG_mtEFG1_IV: domains similar to domain IV of the
                     bacterial translational elongation factor (EF) EF-G.
                     Included in this group is a domain of mitochondrial
                     Elongation factor G1 (mtEFG1) proteins homologous to
                     domain IV of EF-G. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG1_IV; cd01434"
                     /db_xref="CDD:238715"
     misc_feature    365637..365870
                     /gene="fusA"
                     /locus_tag="MGF_2142"
                     /note="EFG_mtEFG_C: domains similar to the C-terminal
                     domain of the bacterial translational elongation factor
                     (EF) EF-G.  Included in this group is the C-terminus of
                     mitochondrial Elongation factor G1 (mtEFG1) and G2
                     (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region:
                     EFG_mtEFG_C; cd03713"
                     /db_xref="CDD:239683"
     gene            366058..366978
                     /gene="pvpA"
                     /locus_tag="MGF_2159"
                     /db_xref="GeneID:12396640"
     CDS             366058..366978
                     /gene="pvpA"
                     /locus_tag="MGF_2159"
                     /note="MGF_2159"
                     /codon_start=1
                     /transl_table=4
                     /product="phase-variant protein A (pvpA) domain protein"
                     /protein_id="YP_005880574.1"
                     /db_xref="GI:385326137"
                     /db_xref="GeneID:12396640"
                     /translation="MGQELNKLKKHKIISMVLMAIGALILLSGIALTAVIASPINSVE
                     VTEMMNGQEVTTTKKISTFAFLINMLPNYQLSTLGYLQITGAAAGLVVGIVLLALGAT
                     FFVKTRRKTNEMLTALQDAEEVEEVAQEEQAEENVEATPTQQAEVKTEQLIGTQLVTT
                     DVASTTQAAGTEKAQGDLLPPSQQPTGMRPAPLPMGSPKLLGPNQAGHSQHGPRPMNA
                     HPGQPRPQQAGPRPMGAGGSNQPRPMPNRPQNPQGPRPMNPQGDPRPQPAGVRPNSPQ
                     ANQPGRRPTPNNPQGPRPMGPRPNGGPNRA"
     misc_feature    366082..>366396
                     /gene="pvpA"
                     /locus_tag="MGF_2159"
                     /note="IncA protein; Region: IncA; pfam04156"
                     /db_xref="CDD:252417"
     misc_feature    <366643..366864
                     /gene="pvpA"
                     /locus_tag="MGF_2159"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:263924"
     misc_feature    <366790..366963
                     /gene="pvpA"
                     /locus_tag="MGF_2159"
                     /note="Arsenite-resistance protein 2; Region: ARS2;
                     pfam04959"
                     /db_xref="CDD:252906"
     gene            complement(367063..367701)
                     /locus_tag="MGF_2168"
                     /db_xref="GeneID:12396641"
     CDS             complement(367063..367701)
                     /locus_tag="MGF_2168"
                     /note="MGF_2168"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880575.1"
                     /db_xref="GI:385326138"
                     /db_xref="GeneID:12396641"
                     /translation="MLKKLTINQVDHKLVNQIAKLIFNKFNLHKNIIPFLLKHKIEKL
                     FTYWALMKATMIIVDQTNKNILIYSDNPDQINKKYQQEYINLMNTFQYVETNDEKSAT
                     TSIIHRFKSLLSRYETLMLNQEVATDIKNLNQILLLLSDYQSFLNNAKELIQSEQELF
                     AFSASHLNYLDYENNKMYQIIKIPLMINNMQIKDVNQEDVVIYLYSTKQAVD"
     gene            367779..367973
                     /gene="rpmB"
                     /locus_tag="MGF_2169"
                     /db_xref="GeneID:12396642"
     CDS             367779..367973
                     /gene="rpmB"
                     /locus_tag="MGF_2169"
                     /note="MGF_2169"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_005880576.1"
                     /db_xref="GI:385326139"
                     /db_xref="GeneID:12396642"
                     /translation="MARRDDLTGLGPLAGNNRSHALNITKRRWNLNLQKVKVKTDRGT
                     LTVKVSARTIRTLRKLDLLA"
     misc_feature    367779..>367955
                     /gene="rpmB"
                     /locus_tag="MGF_2169"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            368063..368476
                     /locus_tag="MGF_2171"
                     /db_xref="GeneID:12396643"
     CDS             368063..368476
                     /locus_tag="MGF_2171"
                     /note="MGF_2171"
                     /codon_start=1
                     /transl_table=4
                     /product="Osmotically inducible protein C (OsmC)-like
                     protein"
                     /protein_id="YP_005880577.1"
                     /db_xref="GI:385326140"
                     /db_xref="GeneID:12396643"
                     /translation="MAKKEYAFTAKLNPDRTVTGKTPKHELLMDSSTTKGPSPLELMM
                     NGLMGCELSVISYYGPKLFGLQLEDLEMKVQAWRDPEPQDEYYGLRKIEIEWFVKSNK
                     SLEEVKEIIKYAHKVCPVFNSLSGRIVIDEKFTLK"
     misc_feature    368165..368461
                     /locus_tag="MGF_2171"
                     /note="OsmC-like protein; Region: OsmC; pfam02566"
                     /db_xref="CDD:251379"
     gene            complement(368541..369851)
                     /locus_tag="MGF_2179"
                     /db_xref="GeneID:12396644"
     CDS             complement(368541..369851)
                     /locus_tag="MGF_2179"
                     /note="MGF_2179"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical domain protein"
                     /protein_id="YP_005880578.1"
                     /db_xref="GI:385326141"
                     /db_xref="GeneID:12396644"
                     /translation="MTKYIENNELSTYTFNPRGLKAIIFIGVFSSLISIGFLVICGDV
                     SLGFKVFFNFIWYPFIGLGYCISALAIGFDVYTHRHLTFKQYVYKNRFFYLCFYSCAV
                     ISIIVFIITLSVLRSTNSHLVELGVLANKNDPLLGWGTNPKNWYGFVFLYTLVPLANY
                     NVIGTTFVVTLFWFNLFGFLIINFLNRVGFFWNTFLIVILVTYCFFSHLSLSVATENT
                     EIGKNNPWLFEVFRYSGIINTMTLFYFGLYMRKYMRIWKFKCSVTTLVVLIVSAIVAQ
                     TVLDFTYYKKIAFDFILANAYASPLILILSWLWLNTFLGYNLESKKTKSKFIHQFNRF
                     TNHIGFCYPIWFQLVGWTSTFIFGYLFINIIAKVDINPSWYQGLRLSFKLNADQNNAI
                     FISLMFFNMFVVPVAYYYPAKFMVYLLNKIDHKIRTKRKNKLNK"
     gene            369916..370737
                     /locus_tag="MGF_2180"
                     /db_xref="GeneID:12396645"
     CDS             369916..370737
                     /locus_tag="MGF_2180"
                     /note="MGF_2180"
                     /codon_start=1
                     /transl_table=4
                     /product="methyl transferase"
                     /protein_id="YP_005880579.1"
                     /db_xref="GI:385326142"
                     /db_xref="GeneID:12396645"
                     /translation="MSALYLVGLPIGNLSEINHRALEILNQLEIIYCENTDNFKKLLN
                     LLNIDFRDKKLISYHKFNETNRFSMIQEQLKSNDVGLVSDAGFPCINDPGQKLVSYLR
                     SIDFKQIICINGSNAALCALATSGFESSQFYYGGFFGYKKQEITNELNEKLKYNTTLI
                     YYESVHRIKNTLEIINENFPDLEVCIARELTKKFESLYFGKISEIIGKIEYKGEFVIL
                     INKRNIKQENEINEEIIKELNTLIKYNMRSKDACKYLADKYNLKSSLLYAFCIEK"
     misc_feature    369925..370575
                     /locus_tag="MGF_2180"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    order(369946..369948,370168..370176,370183..370188,
                     370261..370266,370399..370401,370474..370476,
                     370480..370485,370555..370563)
                     /locus_tag="MGF_2180"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    order(369964..369975,369979..369981,370174..370191,
                     370198..370203,370207..370212,370246..370248,
                     370252..370263,370267..370272,370279..370284,
                     370309..370323)
                     /locus_tag="MGF_2180"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            370715..371956
                     /locus_tag="MGF_2184"
                     /db_xref="GeneID:12396646"
     CDS             370715..371956
                     /locus_tag="MGF_2184"
                     /note="MGF_2184"
                     /codon_start=1
                     /transl_table=4
                     /product="replication-associated recombination protein A
                     (rarA)"
                     /protein_id="YP_005880580.1"
                     /db_xref="GI:385326143"
                     /db_xref="GeneID:12396646"
                     /translation="MLFVSKNKEPFYQPESVEDIIGQKHLLHEYGILRRMIDLRKPYS
                     LLVTGEPGIGKTTLCNILISEMNLPSFSFNSASDSLQELKQFISKAKDLNQCVIIIDE
                     IHRLHRDKQDLLIKGLDAKSFILFGITTENPYFTINPAIRSRVHTIELVNPTSIELFE
                     GYKKIVQQKNIVTISDDILYKIANMVNGDLRKGINIIELLDIYYKNVEITEEILKNVI
                     DNNVTLVSYGDTFHDLKSALQKSIRGSDPDAAVYYLAQLIATKDLITISRRLIACAYE
                     DIGLANPDLCSRVYLATQAAKEAGFPEANQILSSIVIEMALSEKSSSAYEAISDALVE
                     VANGNIQNVPWHIKKNPINLSSTLNNMQKYKNPHNYDNHWVSQDYLPREIRDKKYYIK
                     QAHNYNEKLINDYWLKWRKDK"
     misc_feature    370754..371953
                     /locus_tag="MGF_2184"
                     /note="recombination factor protein RarA; Reviewed;
                     Region: PRK13342"
                     /db_xref="CDD:237355"
     misc_feature    370796..371173
                     /locus_tag="MGF_2184"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    370859..370882
                     /locus_tag="MGF_2184"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(370862..370885,371015..371017,371102..371104)
                     /locus_tag="MGF_2184"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    371003..371020
                     /locus_tag="MGF_2184"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    371144..371146
                     /locus_tag="MGF_2184"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    371444..371947
                     /locus_tag="MGF_2184"
                     /note="MgsA AAA+ ATPase C terminal; Region: MgsA_C;
                     pfam12002"
                     /db_xref="CDD:256790"
     gene            complement(372024..372902)
                     /locus_tag="MGF_2191"
                     /db_xref="GeneID:12396647"
     CDS             complement(372024..372902)
                     /locus_tag="MGF_2191"
                     /note="MGF_2191"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880581.1"
                     /db_xref="GI:385326144"
                     /db_xref="GeneID:12396647"
                     /translation="MVKFFNKAIRRLIYIVGIVVVLLMIGIGVTGYVFHDNISTYYKN
                     FQDRNNSLLNQTRKILIDVQRITSNPEINTIPTRINNAINTIDQSLGKFKTTINNTKN
                     NVASLEQSIQEIKDSLKRHEVTFRIVANNQYDDVMRRLDEFQTTARDLNNEVIPNAEK
                     ILDNVSMGLDDARKLHNIINISELLKNVDKTVVPINNIINGLLQINNAVSSDQFSENL
                     KSVSLILMTVSLSLLSLGALTLILRLIFYRSINGYVVKRSKAKQQLADFFEKACKIYP
                     ELSNEIKKDVEHPQSS"
     misc_feature    complement(372333..>372698)
                     /locus_tag="MGF_2191"
                     /note="Flagella accessory protein C (FlaC); Region:
                     FlaC_arch; cl10488"
                     /db_xref="CDD:245313"
     gene            373711..374304
                     /gene="acpD"
                     /locus_tag="MGF_2192"
                     /gene_synonym="azoR"
                     /db_xref="GeneID:12396648"
     CDS             373711..374304
                     /gene="acpD"
                     /locus_tag="MGF_2192"
                     /gene_synonym="azoR"
                     /EC_number="1.7.-.-"
                     /note="MGF_2192"
                     /codon_start=1
                     /transl_table=4
                     /product="FMN-dependent NADH-azoreductase"
                     /protein_id="YP_005880582.1"
                     /db_xref="GI:385326145"
                     /db_xref="GeneID:12396648"
                     /translation="MSKVLFINASPVANEASFSYQLAKTFESEYLKLNPSDQVSWLDL
                     NELDKGSMTLTSKNSKEHFKDENVDPLINQIKSVDKLVVIAPMTNFNYPATLKNWLDK
                     ICVANKTFSYKYSKKGGSIGLMDHLKVMIINTQGAPEGWYAFADVTVLLKGVFEFIGA
                     MVDSIKVAGTKVEYLNKQPKEIVEPNLALIKEKAKNF"
     misc_feature    373711..374301
                     /gene="acpD"
                     /locus_tag="MGF_2192"
                     /gene_synonym="azoR"
                     /note="azoreductase; Reviewed; Region: PRK01355"
                     /db_xref="CDD:234946"
     gene            374405..375376
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /db_xref="GeneID:12396649"
     CDS             374405..375376
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /note="MGF_2194"
                     /codon_start=1
                     /transl_table=4
                     /product="30S ribosomal protein S2"
                     /protein_id="YP_005880583.1"
                     /db_xref="GI:385326146"
                     /db_xref="GeneID:12396649"
                     /translation="MFLFEDLNVESAQAAKAEESPAPTVQSKEEQVPANSTDKVLVTH
                     TKLLDVGAFNGVAKRKWNPKMKHYIIPRNAAQFSAQFDLINSDLLNLKLHEAFNYLTE
                     AAKAKKNILFVGTKSKAVQELIQSIAERTNSFYINQRWLGGTLTNFKTISNSINQLKR
                     LIHTRDNDLTKYTKKEQIMIMKKLAKLERFFGGIKDMQGLPHVLVIDDPIKEKNAVTE
                     ARKLRIPVIALCNTNSDPNVITLPIPANNYNIRSVTLLLNLLGDAVALAQGNPAKFAF
                     KPDEEIDIPQLVKKETRTVVNRDRAGFNKKQPKAEESAKPAEKKAEK"
     misc_feature    374543..375196
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /note="Ribosomal protein S2 (RPS2), involved in formation
                     of the translation initiation complex, where it might
                     contact the messenger RNA and several components of the
                     ribosome. It has been shown that in Escherichia coli RPS2
                     is essential for the binding of...; Region: RPS2; cd01425"
                     /db_xref="CDD:100106"
     misc_feature    order(374591..374596,374636..374644,374819..374821,
                     374825..374833,374840..374845,375056..375058,
                     375065..375067)
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /note="rRNA interaction site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100106"
     misc_feature    order(375062..375067,375071..375073,375113..375124)
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:100106"
     misc_feature    375167..375184
                     /gene="rpsB"
                     /locus_tag="MGF_2194"
                     /note="putative laminin-1 binding site; other site"
                     /db_xref="CDD:100106"
     gene            375963..381587
                     /locus_tag="MGF_2205"
                     /db_xref="GeneID:12396650"
     CDS             375963..381587
                     /locus_tag="MGF_2205"
                     /note="MGF_2205"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880584.1"
                     /db_xref="GI:385326147"
                     /db_xref="GeneID:12396650"
                     /translation="MIARSSNHFLINIINVSQKRTNKKERTGSMLKKWSLKSKSLLLK
                     TGLALGVISLASGVIIGSMIGFAENSAEKNGQLSPANKQLFDNDYSKIYDQNGNLNPE
                     LTITNANKTAQTGRTSSDATEFWFLDNPNQKYDFDQFFSEYYKRFNEPFVLEIKYGSF
                     SFFDEYVLAVRPKQFLEFTNWFITNVAWGPDLLTLNSFRLVPGVEQNGNAITLGSHST
                     LHKEVSEIKFFPDAFFGSLPIHSTIAGPGNEVDSLTYSVFSNETSKKDLDQFLKNIPL
                     ASALKNDIQREGNSDSTVGFGEIYRASKLVNKTFKIAIGSPTTDQQNRTAPPVYRSPI
                     IVNENFTQTDLDELKTQYPALNSQTLDLFKTYQIKSVKVTAPTQNNTEPALDLTVAEP
                     GSETTLNLNVDLNSLNNSRYVSYKTLLSAYQDNISNYLNFYDMDSYLNNEFYLYQDDN
                     KLNHFYNLFVEAINENPDLKALSSLEEQQARVKKYKVVSFEKTNNAQEYSLKVNLQEV
                     LENLQEGASSSLEFVANKANDYSPEGFDDFLEAINYQGGIDPVSLFYTPTDNQARDEQ
                     GNPLTGLDSRSYQLYVSVYNNLIKKVVKKYPHLLRQLDGPNVQRTVDSNGVFQYQVVE
                     GPFKGFTPSDRIGLPTVLAALVPGFDGLPIDFLKYVATHEYGHHYTLDQGQAFIDRDN
                     PVIVGGLSTRNGASEASFFSYRALINYLDARSNLEVVRVNANNQITPSGKFIRFRFGI
                     LDENGNVLRYETEPLEDIWGTADANDSLSEVLRNKKRRFLQDFSGLTEAAKLRNVAIR
                     DLFFANSFDSDSGTINPSISGLAKAFVKSQTEGGTSEYKWAPVTGGTSEYKWAPVTAA
                     SIISQLTDGAGNPLLNRSVFVSQNDQLSFRIFETEPNKPNVITRINMFNKDGSPVIQV
                     PLNVELSPAELAYVQRQAKVISDSISATINKNLADNGWDSAGTVLGGEISASVGSAIE
                     SEGVSALVEKIKTRSQPSELSPFANRFDDKSRKGFSYLALENSLSLQLVTLINNYLSF
                     SDIDTQQRAGSRQGTSASYIRSDANKIVAVEKTTASPKQFSNFDTYVFPFVRGNKFLG
                     EISNADDDGLIKGINGIASDNQLRTTQGLYNLNFTNTILTALGLFAPQGRNNLISYAT
                     KSSTQNGSNAQNSYVLEGATAFYRKIADVLNSATSTGMSYVDKAATGIAKLDDENVLV
                     VNPFGTDLTASDRSLLATVPTDKKINVTASSTAQTQTMSTFNSKNLSELLSFVSLDYS
                     KATYDSQTKQYNWDVNYVKTKFDLNAIEKLPAPNLPAAATLRAAITAAGTNTTAKNQA
                     LANYAIYLFRHSNLFMSVKDFSPATDLVKNRAVFSQLYGVTMLDRNFTRYYVEDLTLE
                     LDDGVNFDTKRLQAFFAKFVKDNKLEAVQSQLSFHDLLLLTGNIVYYANNGNVGLTLS
                     SFIFGYFSPGLSSDDVINYNATRVEPLLADKFTDYVYNIAETLTRDYVQTTYAPNIKE
                     FENVPNFLGGLSEAMSGLDYIVDATNINKVNDTRTSQTDLAKALQTVYLGRKYTAFYD
                     ELIKIQPDAVSKFNDAVYEFFAASDEVTRLRQATPNDTNAIAQALANQIVARQKVTDA
                     QNVLNELKAKARGMFFKNNDNNFFQTNERRTSSYFGQFISKNNGYFKDHFEKQTIGAQ
                     LYDDNLNPVIDNNIRTVDFNGNKVNKRPEAFFLSQLYNYGVSKRMVSGLFRNQSLDAL
                     ALYGYVPTELASKIGYLRFTNVLTNQAVYLKVNTQRTNNIFWLQKQGDPNSKRTIEDY
                     GYTSWLSDYALMGKYRDALLRPGNAYTVDFVDKNHNFLQTVDLGDVQYISENAKAVEQ
                     SPVKIENQNTTVDGNKRIKTVISIDFQFNVTN"
     gene            381626..384730
                     /gene="oppA_2"
                     /locus_tag="MGF_2239"
                     /db_xref="GeneID:12396651"
     CDS             381626..384730
                     /gene="oppA_2"
                     /locus_tag="MGF_2239"
                     /note="MGF_2239"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type oligopeptide transport solute
                     binding protein OppA"
                     /protein_id="YP_005880585.1"
                     /db_xref="GI:385326148"
                     /db_xref="GeneID:12396651"
                     /translation="MKFRFKKVIKLVGLAVVPLSFVLSSCTNAAPSKDQPVLSGSSNV
                     NRNDYDLGLVTNPLNTLNYVKYNSIDRVLPSLVDPYLKNGPSDALKRVLTAKRRYNFS
                     LLNIPQDRSTSNFDNYYKTNLETIQSDNGTGVIGSSFYALDDFNIVGGTADDSGVGDD
                     LRSRSTIYAFRNPRNTNNFMALTGYTNVKKNRWSNGDFSTSQDIRDYLEYILDLNTGS
                     QKLDTIRRYGIRGVDRFIDAQRDYLAKFNKSYKNPFGRRNYVFNQDLKIWVQDPNQTD
                     LYQSQTVDDRNQPLDTKEVEAIKNAAKDLGFYTGQLFLDYDNSFVARFLSMNPNFSLD
                     SEVQDFRVMTSDNQPMTIKLVKNPYVNPYQKFDLSTPDLQGSLQPLSKDENSFTLIFD
                     ENQTPNLSFLIGTILENLYPVNRRYIETVGGGIDRYGSEPDKFLTNGPFVIPRDNGIL
                     LGPNGYINLIKNLDYFDAENTISNRIRIFFSQNPNTNALFFEDGLISQTLIPANRINR
                     YWADPEIKQFLNKNQGFGTIAYGLNLDLETNANSYIQDQDLRNAIYYAINRSDVLRFV
                     GWDFSFPTSTWTAYGTHKAYDGRNLELFFEGQKSKTKNNKEFDLLNYDFVVHLSKRFN
                     FEKTVRHDLAHDLKTARFYLDRFKAKHPELKQVTLNFLDNSSDEQVRGATYLKQAMLE
                     AFGGYVNIEEKSLPENIFASYIEKGQYDIIYQNYDRFSGGQPQDGVLTFFKNDGIDSF
                     RQKNIGFKENPVGSYTYLDYLSNLVLEALQKTDPNFTRQTILKPDIDRIMMIINGDPA
                     MLAAYNNAVNSLNAFNLNTFSTDHLAAIIARLNQVNPEFQNTRYSNQYVNALLDYMII
                     TNWRRDPDQFNQRRNENIATARLHTAFNLILPSFKTVDEIAQLTDDTRVRLEIDTLDQ
                     VGSDTKKVQPNFWKKFIELSLNRFNESTIDYTSRLSSFFSGNFTDEELKENWSLDYVY
                     QFIGAIEKIIRDSGLIIPLMEVDTNWEVTRVGGVSSLFTFSLQYAYDYTRPPRDGLPR
                     TREA"
     misc_feature    <382853..>383764
                     /gene="oppA_2"
                     /locus_tag="MGF_2239"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cl01709"
                     /db_xref="CDD:261038"
     gene            384739..385791
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /db_xref="GeneID:12396652"
     CDS             384739..385791
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="MGF_2253"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system permease protein (DppB/OppB)"
                     /protein_id="YP_005880586.1"
                     /db_xref="GI:385326149"
                     /db_xref="GeneID:12396652"
                     /translation="MTEKIILDDKSYQLNDNAVIFRKKRVEELTLIQRLLAIDSPVLR
                     TLWKFFKIILEFFVIGLIVISITFFLINSVPGENPLTQGLDEASRRAIEQRYGLDLPL
                     FERYLRYLRGLFQGNFGISLALFPEQSINSFIWARFYKSFLVGIFSVALTVVIGIPLG
                     IWVGKNPGGWVDNISTILVSIFSSIPSIIFALLLVFIGRAMGIPYVYDQANFVTYILP
                     GLALSLGSIIVYIKYIRTELNRELNSVHAKFAYLKGVSKDRFVWKHALKPSLFPIATF
                     FPAVIFGSFIGSIFIEQIFLIPGSGDTLLQAIQTKDYNVILFLIVMFALITVLSYAFR
                     DILYELIDPRIRRRTS"
     misc_feature    384883..385782
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    385159..385725
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(385198..385203,385210..385215,385228..385230,
                     385261..385272,385276..385305,385312..385317,
                     385321..385323,385411..385416,385420..385422,
                     385426..385428,385435..385440,385444..385446,
                     385456..385461,385468..385470,385519..385521,
                     385561..385566,385573..385575,385594..385605,
                     385612..385617,385651..385656,385684..385689,
                     385696..385701,385705..385710,385717..385722)
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(385279..385323,385594..385611)
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(385321..385323,385396..385398,385612..385614,
                     385645..385647,385654..385656,385684..385686)
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(385471..385509,385525..385530,385540..385542)
                     /gene="dppB"
                     /locus_tag="MGF_2253"
                     /gene_synonym="oppB_2"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            385801..386877
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /db_xref="GeneID:12396653"
     CDS             385801..386877
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="MGF_2261"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system permease protein (DppC/OppC)"
                     /protein_id="YP_005880587.1"
                     /db_xref="GI:385326150"
                     /db_xref="GeneID:12396653"
                     /translation="MTKFKEDNLKTKPPGFKTKFKNWVARVANKIRSHSDVETDEFVD
                     PKSAPNPIIQPFNYQSWKLVGKIVDFQADQHMSPQAKPFREFVNRYSRSFAGVLGMVM
                     LVLIVLLAIFIPFFTQDPNTTNIVDRNLIFNSTDSRNIYHFLGTDDLGRDFWARLWWG
                     LRYSIALAFAVTVIEVFIGLTIGIMMGQFEFFDKVMTFIIKVISIVPTIIILILLTII
                     IAPSFWVIVFALSLTSWTGMANQIRAQVKRAKHSEWVMASRILGTPTWKILKNYVPVI
                     LPILITQLVFTIPGVVLAETSLAFIGLAIKDIPTLGNIISEGQKLFPTYARYVFIPAT
                     FLILITTSVQLIGATVQDSLRRQR"
     misc_feature    386044..386868
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    386044..386190
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    386281..386820
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(386329..386334,386341..386346,386359..386361,
                     386386..386397,386401..386424,386497..386502,
                     386506..386508,386512..386514,386521..386526,
                     386530..386532,386542..386547,386554..386556,
                     386605..386607,386644..386649,386656..386658,
                     386677..386688,386695..386700,386737..386742,
                     386773..386778,386785..386790,386794..386799,
                     386806..386811,386818..386820)
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386404..386424,386677..386694)
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386482..386484,386695..386697,386731..386733,
                     386740..386742,386773..386775)
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386557..386595,386611..386616,386623..386625)
                     /gene="dppC"
                     /locus_tag="MGF_2261"
                     /gene_synonym="oppC_2"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            386892..388091
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /db_xref="GeneID:12396654"
     CDS             386892..388091
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="MGF_2271"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system ATP-binding protein (DppD/OppD)"
                     /protein_id="YP_005880588.1"
                     /db_xref="GI:385326151"
                     /db_xref="GeneID:12396654"
                     /translation="MKDIQMNKKSFGYRIKDYFANLFGFITNRKFVFNWEEFSKNVRY
                     KEFENGEKLRIVAEIKDIELSFLNPSRPGEKNKVLRGPSIEIYEGKVHAIIGESGSGK
                     SVITSLLYGLTGDNAVIDSGEVKLFNNNVEKFSFRDWERSHYRGRVVSAVFQNPMSTL
                     NPTMKVGEQIMEGMLINKIVKNKKEAYARAVEFLKLTKISDPEAVMKLYPHEMSGGMI
                     QRVVIAAIVSLEPKILVMDEPTTALDPTVQALVLDVIKDLQQKLNLSIVFITHDLGVV
                     ASISDYISIMYAGQIIEEGTAQEILKFPQHPYTWGLILSMPDLNQGDRLATIRGSVPS
                     NLNNIVGDAFAVRNDYALGIDFVEEPKFYWVSPTHRVKSALLDERTEKYTPPKHIQEL
                     WDSFKAS"
     misc_feature    387063..388007
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    387063..387776
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    387177..387200
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(387186..387191,387195..387203,387351..387353,
                     387600..387605,387702..387704)
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    387342..387353
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    387528..387557
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    387588..387605
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    387612..387623
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    387690..387710
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    387765..387953
                     /gene="dppD"
                     /locus_tag="MGF_2271"
                     /gene_synonym="oppD_2"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            388094..389461
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /db_xref="GeneID:12396655"
     CDS             388094..389461
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="MGF_2285"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     ATP-binding protein DppF"
                     /protein_id="YP_005880589.1"
                     /db_xref="GI:385326152"
                     /db_xref="GeneID:12396655"
                     /translation="MSTVENKKDSKPYIEVKKKLLFFKKRYARFNTPGIEEMLKVPEN
                     KEVLASLRNVDITYGVGSKAFRAVVDMNLNIYTGEVLGLVGESGSGKSTIGRAIIGLV
                     PHSFGKINILDKTLPQKMTRGFKFGKALKEYKEIEKFMVNKVQMIFQDPANSLNPHVN
                     VESIVSEGLTNLKNAKEIYLYNIDQDVIKHVYEQWLDQNDPQIKQAFYGGYEHKLEEL
                     INKDEITAYDAIYHGFINKLKEFNQLNEAVAYLTKEQEKRNELNKLSEVDCKKILVRN
                     ILASVGLDESVLKRYPLEFSGGQQQRIGISRAVVLRPRLLIADEPISALDVSIQAQVV
                     NIFNDLKRKFNLTILFIAHDLRMVEYISDRIAVMNKGRLLEVGTTQEIMKNPLHPYTK
                     SLLDAVPSIAGHKGSLVGYKYDPSIHGYDHNNQPVWQKVNDNHFVLATDQELADWKQG
                     KYQEA"
     misc_feature    388235..389224
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    388241..389296
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    388346..388369
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(388355..388360,388364..388372,388538..388540,
                     389048..389053,389150..389152)
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    388529..388540
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    388976..389005
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    389036..389053
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    389060..389071
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    389138..389158
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    389216..>389311
                     /gene="dppF"
                     /locus_tag="MGF_2285"
                     /gene_synonym="oppF_2"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            389571..389723
                     /locus_tag="MGF_2295"
                     /db_xref="GeneID:12396656"
     CDS             389571..389723
                     /locus_tag="MGF_2295"
                     /note="MGF_2295"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880590.1"
                     /db_xref="GI:385326153"
                     /db_xref="GeneID:12396656"
                     /translation="MLRTNQRLTQSFDKINKQTFKKNKCNSSSFVLTILLRPSLSRMS
                     SSSIES"
     gene            389898..392591
                     /locus_tag="MGF_2297"
                     /db_xref="GeneID:12396657"
     CDS             389898..392591
                     /locus_tag="MGF_2297"
                     /note="MGF_2297"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880591.1"
                     /db_xref="GI:385326154"
                     /db_xref="GeneID:12396657"
                     /translation="MRYRNKTIIKIGSLLSFAVLSTSALASCVNNSTNNDFARGYVFE
                     NNDNVKIKAADGIRDLALNKESFVKALENMGATKANPWRIIDKSLSITTLTDDQRTMI
                     NNKTAALRSLSDGLIEYDFRLRGSTTPSVSEYFLRANTTAGTYFWTVDYPAVGSFIEG
                     WIANTKGAKVDQYLVQRIIDVANNPAAYVQEYTQQYVDLTASLAKAIIKSNLTQLKAP
                     TMPAATEGEPAQSSSASDMDYLNIFKGKTLAEVLTTNQTTLDNFQNSIGKYLGEWTAS
                     NTPRALYLNSFLDDQFSFIPLPSSNNTTINHLLVKSPEWKIRTDWKAGELLLRDSNGP
                     ANQGFVSELPENPAEGEELALQKAFSPGNTSNFPGSFSYLISSETTGEINYDANTRTR
                     TSNLTGTYKLEGAKGVKLYDANDKLLAVVLRPTTGTGAEMWAKSVEDQAKKENPDVYI
                     SKTGVVDPEVDSNLQKYIDQAVRYDWLIDHNVKWTDQNENPVASLSGRDFERGLESFW
                     LAAGIDYTVNGYLLDLLGVDLEKSVNGTVSDSNGKVTVTPGTEKITSSTYDIGKFTST
                     DDTFRIYLKQPYAFAMQTFKISFLTPMPYWDTRVRALRISGQADSTVSNLGTTNTEFK
                     TTASTNWTEGTVPGEIMVNADSSIDKEKTGWTKLFGYISASDSSQNLNNAYYSGSYYL
                     SAYSANQFTQTYNPNYQKAFSADYYANKTPVQKAITNFGGKRSADIIFQGYRDDDSSP
                     TQLTVPRSSITSASTTARYRQFYWSSQVTTPSSQMNYTVWAASPQGGEPEYQDAVTRN
                     IFRNWNSDDSRIIRAGIVNLINWYRLAQVVQSRGTFQYTSIPYRSLTDNTLFATVPLH
                     DAVLAIQENKLPAAFKVNGYSGSLRRPYSDFQPTRTNNQNN"
     gene            392711..393916
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /db_xref="GeneID:12396658"
     CDS             392711..393916
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="MGF_2312"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system permease protein (DppB/OppB) domain protein"
                     /protein_id="YP_005880592.1"
                     /db_xref="GI:385326155"
                     /db_xref="GeneID:12396658"
                     /translation="MLTYILKRIGFAALAVFILLTLTYLLTGLLPYLPISPGQNESPA
                     AFQRRVDALGFNEPIIVRYGKYLHDLFVNHSLGQYYSNSAINIGQWFFETVPNTLLIT
                     AISFVISIILGVSFGVLSAVYRGKALDTTLNTLSVVFVSVPSFVIAIVLLIIFRNTGV
                     PTRYVAPGSNGYTVGRFIASLTLPILSLSLGGFSSMTYYMRNEMVEVLQQDYIKTARS
                     KGLSESAIIFKHAFRNASIPILSIIVPSILGLISSSFIIETFFSVPGTASLLVAAIQR
                     NEVNMLAFQVLFFSSLGFLLQILLDFIYTLVDPRIRLAEANSFIFIRWIHNSIVRNKT
                     KKLWALVNETNAYVLSKDKDQSLIDSIKDNNDLSKHKVVVDKKFGLPTNIEYLILEGR
                     LYKLEKALG"
     misc_feature    392711..393655
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    392996..393595
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(393041..393046,393053..393058,393071..393073,
                     393104..393115,393119..393148,393155..393160,
                     393164..393166,393281..393286,393290..393292,
                     393296..393298,393305..393310,393314..393316,
                     393326..393331,393338..393340,393389..393391,
                     393431..393436,393443..393445,393464..393475,
                     393482..393487,393512..393517,393545..393550,
                     393557..393562,393566..393571,393578..393583,
                     393590..393595)
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(393122..393166,393464..393481)
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(393164..393166,393266..393268,393482..393484,
                     393506..393508,393515..393517,393545..393547)
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(393341..393379,393395..393400,393410..393412)
                     /gene="dppB"
                     /locus_tag="MGF_2312"
                     /gene_synonym="oppBa_1"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            393921..395060
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /db_xref="GeneID:12396659"
     CDS             393921..395060
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="MGF_2322"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system permease protein (DppC/OppC)"
                     /protein_id="YP_005880593.1"
                     /db_xref="GI:385326156"
                     /db_xref="GeneID:12396659"
                     /translation="MTISELSKNYQFEKELFDRVDANEQLSKQSLVIGKPTNYIVEII
                     KRFFKNTAAGVFSVLLIIIVLLSIIAPLVSQYSATQPLGIDEIYFNLPPRIFGTNPTK
                     DLIIPRDLLFIYDGTIVSETDMGNNTVLIRFHPYMLEELRNVYPILGTTQGGVDVWTN
                     LWQAMAASLQSALVVAVFASLIGVIYGAISGSFAGKWIDTVMMRIVEIIGGLPSIILI
                     IILAQIFVRTRSTSGGNLSIGSINAALIALYWTGPAQVTRIYIVKSKDAEYVQAARTL
                     GASQWRIIFYHLIPNISGRLAVIFVNFIPVAIFVDAGLVFLGLKSSQDITLGTILSST
                     YQNVSPDLLHISLPPIVVFSLFTISLQIIANAINDAVDPRIIGRK"
     misc_feature    <394347..395054
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    394422..394928
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(394461..394466,394473..394478,394491..394493,
                     394524..394535,394539..394568,394575..394580,
                     394584..394586,394662..394667,394671..394673,
                     394677..394679,394686..394691,394695..394697,
                     394707..394712,394719..394721,394770..394772,
                     394812..394817,394824..394826,394845..394856,
                     394863..394868,394905..394910)
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394542..394586,394845..394862)
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394584..394586,394647..394649,394863..394865,
                     394899..394901,394908..394910)
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(394722..394760,394776..394781,394791..394793)
                     /gene="dppC"
                     /locus_tag="MGF_2322"
                     /gene_synonym="oppC_1"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            395060..396391
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /db_xref="GeneID:12396660"
     CDS             395060..396391
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="MGF_2327"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     system ATP-binding protein (DppD/OppD)"
                     /protein_id="YP_005880594.1"
                     /db_xref="GI:385326157"
                     /db_xref="GeneID:12396660"
                     /translation="MRFKERYLVSDPNKKLKPGYMVDIDNLNVSFKTKDGMLQAVRGV
                     SISAKEGQIIGIIGESGSGKSVCVKSLIGFNDNSKITADNLNLYDIDITKIKNRDWCH
                     LRGEHVTYIPQDPLMSLNPTKKIGAQIKEALVIAEKRRYRQEVEQLKDQYLKQKQELE
                     KTNSNSAELFKHLEQLRVDHLTKLKEAKDKYRNEKSAKSIKTKIYQILEFIGIVDIKN
                     KINAYPHEFSGGMRQRIVIGIAIASRPKLIIADEPTTALDVTIQAKVLDLIKRINQIY
                     KITVIFISHNIALVANFCDYIYVMYAGKIVEQGNIDDIFLDPRHPYTWALISSIPDEG
                     IEGKLRSIPGSAPNLISPPKGDAFAARNEYAIKLDFNSQPPLIEITNTHKAATWLLHP
                     DAPKIELPELVKQKIETYKKSLSDLANIHDKDKTPEVVYNVFDIREKKIDE"
     misc_feature    395120..395986
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    395126..396226
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    395231..395254
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(395240..395245,395249..395257,395396..395398,
                     395810..395815,395912..395914)
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    395387..395398
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    395738..395767
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    395798..395815
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    395822..395833
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    395900..395920
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    395969..396226
                     /gene="dppD"
                     /locus_tag="MGF_2327"
                     /gene_synonym="oppD_1"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            396360..398879
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /db_xref="GeneID:12396661"
     CDS             396360..398879
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="MGF_2336"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type dipeptide/oligopeptide/nickel transport
                     ATP-binding protein"
                     /protein_id="YP_005880595.1"
                     /db_xref="GI:385326158"
                     /db_xref="GeneID:12396661"
                     /translation="MILERRRSMSNKKDEQVKTLLDVANLSVVFNSRGSQFTAVDNVS
                     FKVNKGDFFGIIGESGSGKSTIGKTLVRLNKLSGGMINLDGRLIGNKKLSRADKSWLH
                     QNAQMIFQDPMSSLNPIKTVLKLVAEPIMINKMIHKKTKALYQKITYIKPYFHYVFQA
                     REFDLTNQYQRNYYQKLTDQYQQAINQINNFQLSSSDFTTGYKELVFLLDDWSEKVQS
                     NIELSKKYFSDYKKIIDDYILDYDLKKYDPIDLEFDQAKLNQSNKAKILKYSQPVLDL
                     KEKKVAKKALYKQTIKEFNELYLFRNFSELLSWLTTVESEVKSFKYKMIMANKPLDYV
                     YAGINYYWKKAELKIIKLIKKDKFFEKENLDLLIKKINGHFADIFEPLVSIVINFSVE
                     LNQDILKTHKLTNQANTYLDLAKRLFHSIDRELDLKKVNETINQISSLINLHNYLVDA
                     NYLDRSFDQWKNDIYKNFDGLINEINQHKQESKRIVNEKNVDLFNLKKEIKQLNHEIS
                     ENYQSYQISNKSDSINQLEQLKKVTLDKKTKRDQAIQDYKNKLPEIYANRNNLTQEVK
                     KLEETYLSTKHRFHKLVKEKIHHLARTNHWHNKDLKVLIAAIKLRFKSMDAVDFEHKV
                     TTKDKNIYRNLFLKLPKWLNWIYLFPLRSILIRDKVFDALNQVGLKPEHAYRYPHEFS
                     GGQRQRVVIARALITDPQIVIADEPISALDVSIQAQIVNIMKEMVEKRGVTFLFIAHD
                     LSMVNYACENVIIMHRGKILERGNVDKIFKNPIHPYTKSLMKASPKLSNIHLDLASFD
                     EGLNYYKDYSVINKPSFYQVSDNHEVFCTKEQFDLWVNQKR"
     misc_feature    396417..>396785
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    396528..396551
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(396537..396542,396546..396554,396687..396689)
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    396678..396689
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    <398322..398648
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    <398325..398729
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="ABC-type oligopeptide transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     AppF; COG4608"
                     /db_xref="CDD:226967"
     misc_feature    398400..398429
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    398460..398477
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    398484..398495
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    398562..398582
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    398631..>398723
                     /gene="dppF"
                     /locus_tag="MGF_2336"
                     /gene_synonym="oppF_1"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            398858..399406
                     /locus_tag="MGF_2349"
                     /db_xref="GeneID:12396662"
     CDS             398858..399406
                     /locus_tag="MGF_2349"
                     /note="MGF_2349"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880596.1"
                     /db_xref="GI:385326159"
                     /db_xref="GeneID:12396662"
                     /translation="MGKSKALKTGYNHYSSKYVNSLNKNDLTDDKINNTINQKGLKYP
                     RGWFGFSFCLIIVVIALFLLIIVKRNVPPKTQILDATTISSGIGFLFHAVGFINRQKI
                     FMMLKFKFKKLELFFSLKKQREKRDFLYDHNNATNYIKSYEDYLTYAVEKNKASFKVF
                     YISFLIYAIWFLASVIISFSLF"
     gene            399435..399522
                     /gene="trnS"
                     /locus_tag="MGF_tRNA22"
                     /db_xref="GeneID:12396663"
     tRNA            399435..399522
                     /gene="trnS"
                     /locus_tag="MGF_tRNA22"
                     /product="tRNA-Ser"
                     /note="MGF_tRNA22; anticodon:GCT; Ser-tRNA; predicted with
                     tRNAscan-SE v., cove score=71.56"
                     /db_xref="GeneID:12396663"
     gene            400212..400778
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /db_xref="GeneID:12396664"
     CDS             400212..400778
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="MGF_2355"
                     /codon_start=1
                     /transl_table=4
                     /product="elongation factor P"
                     /protein_id="YP_005880597.1"
                     /db_xref="GI:385326160"
                     /db_xref="GeneID:12396664"
                     /translation="MASIIHAKDLRSGHTFTLDGKIYLVIENSFNKTAMREGIVKCKV
                     KNLRTGSITTEVLTGMKLEQANIEKVKMSFVYQDQNSFVFMNNETYEQIEVPAKLLEY
                     EKNFITENTEALIMRYEDEILGVNLPDQVVIEIDYAEDAVQGNSVNNALKKATLVTGY
                     VIEVPQFIKSKEKVIVSTVDGKYVSRAN"
     misc_feature    400224..400772
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="translation elongation factor P; Region: efp;
                     TIGR00038"
                     /db_xref="CDD:213496"
     misc_feature    400227..400388
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:254661"
     misc_feature    400413..400595
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="S1_EF-P_repeat_1: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_1;
                     cd04470"
                     /db_xref="CDD:239916"
     misc_feature    order(400482..400484,400557..400559,400572..400577)
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239916"
     misc_feature    400602..400769
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="S1_EF-P_repeat_2: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_2;
                     cd05794"
                     /db_xref="CDD:240220"
     misc_feature    order(400689..400691,400740..400742,400755..400760)
                     /gene="efp"
                     /locus_tag="MGF_2355"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            400747..401079
                     /locus_tag="MGF_2359"
                     /db_xref="GeneID:12396665"
     CDS             400747..401079
                     /locus_tag="MGF_2359"
                     /note="MGF_2359"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880598.1"
                     /db_xref="GI:385326161"
                     /db_xref="GeneID:12396665"
                     /translation="MTVNMSQEQTNIKSILYNKFGSIKITDKAFRSFIKNKIDTYLEN
                     NKVIELIKVDLYHFYDDTNAQINIYVKYLKKKYDNKLIKNLSKQITNAINVELGLVIT
                     SVNFIQQF"
     misc_feature    <400816..>401001
                     /locus_tag="MGF_2359"
                     /note="The alpha-D-phosphohexomutase superfamily includes
                     several related enzymes that catalyze a reversible
                     intramolecular phosphoryl transfer on their sugar
                     substrates. Members of this family include the
                     phosphoglucomutases (PGM1 and PGM2),
                     phosphoglucosamine...; Region: phosphohexomutase; cl03757"
                     /db_xref="CDD:261872"
     gene            401079..401471
                     /locus_tag="MGF_2361"
                     /db_xref="GeneID:12396666"
     CDS             401079..401471
                     /locus_tag="MGF_2361"
                     /note="MGF_2361"
                     /codon_start=1
                     /transl_table=4
                     /product="putative transcription termination factor N
                     utilization substance protein B (NusB)"
                     /protein_id="YP_005880599.1"
                     /db_xref="GI:385326162"
                     /db_xref="GeneID:12396666"
                     /translation="MKKQANQRSQYQIRYDRLTFIYQALLLDLNLDEIYQAISQLEDL
                     KDQEFLTNWTGLINQVPTIVSAHLKESWSWNRLDYMIKALFNLVITEAKVLKTEKAIL
                     ISQATKLIQEYGDLNSIKLVSAILNKVI"
     misc_feature    401130..401468
                     /locus_tag="MGF_2361"
                     /note="RNA binding domain of NusB (N protein-Utilization
                     Substance B) and Sun (also known as RrmB or Fmu) proteins.
                     This family includes two orthologous groups exemplified by
                     the transcription termination factor NusB and the
                     N-terminal domain of the...; Region: NusB_Sun; cl00223"
                     /db_xref="CDD:260276"
     gene            401475..402131
                     /locus_tag="MGF_2363"
                     /db_xref="GeneID:12396667"
     CDS             401475..402131
                     /locus_tag="MGF_2363"
                     /note="MGF_2363"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880600.1"
                     /db_xref="GI:385326163"
                     /db_xref="GeneID:12396667"
                     /translation="MMKWKKWRNHYITFLANLFVFIGFSINAILLREINPIDNSRVAL
                     SPEIMIITALIGGLLGIAFIGFDIKFFIKDFFYQKFHYDKKYTRMYIGGISVYLFNII
                     LGMLFVVLSVYFYRQADLTSANSLVTNFTITRNLIYISIGITSAITIVNFVIIRLARL
                     FIEQALDKRKNNTDENPKPVNSDDKSVIISFDQNNNLVKEQPVGPKADQKPSGGLNEL
                     "
     misc_feature    <401619..>401813
                     /locus_tag="MGF_2363"
                     /note="ER membrane protein SH3; Region: SHR3_chaperone;
                     cl07019"
                     /db_xref="CDD:263140"
     gene            complement(402128..402568)
                     /locus_tag="MGF_2370"
                     /db_xref="GeneID:12396668"
     CDS             complement(402128..402568)
                     /locus_tag="MGF_2370"
                     /note="MGF_2370"
                     /codon_start=1
                     /transl_table=4
                     /product="histidine triad (HIT) hydrolase-like protein"
                     /protein_id="YP_005880601.1"
                     /db_xref="GI:385326164"
                     /db_xref="GeneID:12396668"
                     /translation="MFTNSLEKINMTTTNCVFCKIINNEIQAHVVAQNHLAIAFLDAF
                     PVSNGHTLVIPKKHYQDFSHTPKEEMHAVTDLAQEVVKLLDRSDLNVHGYNYLSNQAS
                     IAGQEVFHFHLHIIPKYATKEGFGFKTNKVNILDLKEVMKLIKP"
     misc_feature    complement(402215..402526)
                     /locus_tag="MGF_2370"
                     /note="HINT (histidine triad nucleotide-binding protein)
                     subgroup: Members of this CD belong to the superfamily of
                     histidine triad hydrolases that act on alpha-phosphate of
                     ribonucleotides. This subgroup includes members from all
                     three forms of cellular life; Region: HINT_subgroup;
                     cd01277"
                     /db_xref="CDD:238608"
     misc_feature    complement(order(402221..402229,402233..402235,
                     402239..402241))
                     /locus_tag="MGF_2370"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238608"
     misc_feature    complement(402233..402235)
                     /locus_tag="MGF_2370"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238608"
     gene            402599..403978
                     /locus_tag="MGF_2371"
                     /db_xref="GeneID:12396669"
     CDS             402599..403978
                     /locus_tag="MGF_2371"
                     /note="MGF_2371"
                     /codon_start=1
                     /transl_table=4
                     /product="membrane protein"
                     /protein_id="YP_005880602.1"
                     /db_xref="GI:385326165"
                     /db_xref="GeneID:12396669"
                     /translation="MVNDNSTVILAKLSNYLSNLNNAKVKEHCSLIKKQNSFATSSFA
                     FLFLSAFLGLLLTVNVFVIIWTSYHQKIDYDDQEAVKLLLTQFETNWLISKVLVSLLL
                     ISLVILISLICFGYYFNNYKQLDTPIKEIKKPVNFINRISLVCACFAIFLVSFGYFTF
                     FIYSNDYHNAIKRKQAFDYMLKPDSIVNTKTLISAILGISFCLALILLIASFLVYSVF
                     SVQYNYFSSLDKLRRAIIKLNAQTKLEEKVQVSTKINVEAEPIKEEVKVEPTQTTKIN
                     QEADLNDLFKKFNKQPFNKSATQTQSVEPNIRTNQVDDSTVKAQQTTEYVWNTQQANP
                     TQETQVNNNQNPTSSLKDIFKKMNSYTKTETVNNQTGPVEQEVNQTSSTSTTNVSPAD
                     LYKNIFKFKSPLSATNEINNQKETSSVDENNTPKQEDYGIGVKSINQAEKQKEELKNL
                     FKKIKDSKE"
     gene            404201..405628
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /db_xref="GeneID:12396670"
     CDS             404201..405628
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /EC_number="4.2.1.11"
                     /note="MGF_2383"
                     /codon_start=1
                     /transl_table=4
                     /product="enolase"
                     /protein_id="YP_005880603.1"
                     /db_xref="GI:385326166"
                     /db_xref="GeneID:12396670"
                     /translation="MAKTNSTSKNNKLEIKSVFAYQAFDSRGFPTVACEVVLNDGSKG
                     LSMVSSGASTGEKEALELRDGGTKYHGKGVTKAVNNINKKIGPKILGVDATLQTQIDE
                     FMIELDGTKTKAKLGANAILAVSMAVCRAAAKSLNLPLYQYIAKKVAKVKGADFILPV
                     PMLNVINGGAHADNTIDFQEFMIMPVGAKTMAKALQMASEVFHSLQKLLKAKKFNTNK
                     GDEGGFAPNLKSAEEALDLMSQAVVDAGYALGKDVAFALDCAASEFYSKEKQAYVFKK
                     AVKAGILSEEKGTKTTEQLISYLEDLTKKYPIVSIEDGLDENDWKGMESLTKKIGKKV
                     QIVGDDTYCTNPELTSKGVSLSATNSVLIKLNQIGTLTETIQTINIAKKANWTAVVSH
                     RSGETEDAFIADLAVALSTGQIKTGSMSRSERIAKYNRLLAIEMQLGNKAKYLGSKTF
                     YNLSTPAATPKKSPAKKTTKAKSKK"
     misc_feature    404240..405562
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    404249..405505
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(404255..404257,404261..404287,404297..404299,
                     404333..404335,404714..404722,404783..404788,
                     404795..404800,404807..404812,404849..404854,
                     404873..404875,404879..404881,405386..405394,
                     405461..405469,405473..405478,405485..405487,
                     405494..405499)
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(404357..404359,404972..404974,405134..405136,
                     405215..405217)
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(404711..404713,404861..404863,405290..405292,
                     405374..405382,405443..405445)
                     /gene="eno"
                     /locus_tag="MGF_2383"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            405713..407083
                     /locus_tag="MGF_2391"
                     /db_xref="GeneID:12396671"
     CDS             405713..407083
                     /locus_tag="MGF_2391"
                     /EC_number="3.6.1.-"
                     /note="MGF_2391"
                     /codon_start=1
                     /transl_table=4
                     /product="SrmB-like ATP-dependent RNA helicase"
                     /protein_id="YP_005880604.1"
                     /db_xref="GI:385326167"
                     /db_xref="GeneID:12396671"
                     /translation="MNQIYPWKEFIAKTLKAMGIHEPTKIQKEAIPPLLKQKNLIGVA
                     PTGTGKTLAFLLPILQNLDFAQNLIQAVIIVPTRELANQIKSVLANFVKTNKAIRIKS
                     FVGSTQFDEQIISIKNNPPHILISTPSRFNQAIDHAVNWNLKSTKYLIYDEIDMMIDQ
                     GFFSDLIKTQEYIFNANKKVSIAAFSATLHLDAINKIKRFIKNATPINVSDSIWVNEK
                     IKHYLIKNKSLDKLDSLHAVIKNIDPYLCLIFVNKIKDIPPIQNWFEQNQIGFATLHG
                     KLDKRVRKQQFDLIKNNQVKYAIVSDLSSRGIDFKAVSHVISWNLPKDDIWYIHRSGR
                     TARGDQEGESYVFYDPDDEAILKRLENKKLVFIPLKINRDLSLTRYQLVKPEHKKRVD
                     DHLTNEIKKVLRSAPKKVQPGYKKKIKEQINKIKSKAKREAIEAKVKQRLISSYKKKN
                     RKLKTE"
     misc_feature    405734..406336
                     /locus_tag="MGF_2391"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cl17251"
                     /db_xref="CDD:266587"
     misc_feature    405749..407077
                     /locus_tag="MGF_2391"
                     /note="ATP-dependent RNA helicase SrmB; Provisional;
                     Region: PRK11192"
                     /db_xref="CDD:236877"
     misc_feature    405851..405865
                     /locus_tag="MGF_2391"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    406166..406177
                     /locus_tag="MGF_2391"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    406364..406753
                     /locus_tag="MGF_2391"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(406466..406477,406535..406540,406613..406621)
                     /locus_tag="MGF_2391"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(406637..406639,406700..406702,406712..406714,
                     406721..406723)
                     /locus_tag="MGF_2391"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            407230..413058
                     /locus_tag="MGF_2404"
                     /db_xref="GeneID:12396672"
     CDS             407230..413058
                     /locus_tag="MGF_2404"
                     /note="MGF_2404"
                     /codon_start=1
                     /transl_table=4
                     /product="putative cytadherence-associated protein"
                     /protein_id="YP_005880605.1"
                     /db_xref="GI:385326168"
                     /db_xref="GeneID:12396672"
                     /translation="MRNMVEKKKPEKKSIKNKSAHDNEPASISLDGNSKKKVSKKGLE
                     SLNYSDYYKKYLESKKDDFELLAKKTSIDTIKDKEAIKDEIKAEAFYAESALDYTKEM
                     KDESYSDHFKEMKDIDKKNVVISNEMKHDNKKEEEGEFVVRNQYHPSFNHVVEANHYD
                     DLPDFDVDSSSLNFDLNKSNKVNKPSKQKLASPLNNNLDRFSNERFNQPIPSRMYIPK
                     GYVRPMNLYGRPPFNPYFNPYFVPPYYYPPMHPGFARPNANPYQQPPYLNQQPPYFNQ
                     QQKELFPQQNSYTEQLLDFDPFATTTELVPVNNYNVITPNQNDLVVVNKKQSELSHII
                     SSFNKRMKEQLRIVSKQNEMIERLQTKVIELTEEKTTALIGEARLSTEDFLPTTQHNF
                     ESVVADTSSQEAKPEVEVVAKVVQKPAEVEVITNIYDIESDDPVVDILSLEADDLINT
                     ENLDQELAAFEEFDATSLDDQLDLSLLDDDITNTIQPQIKYELPVAPEDVKSEEPVAD
                     KGAQFDLEIDLEVPGLEDSQEIYTPNQLLDLAKEQPEGIKNSIVPTKVMDEMFGDKQK
                     SDPARRFWEAYVGNSEYGFYNNKTWNWKGKFSKLQKWIPFTSDEEVPFYGTKHVILSS
                     IKASERKKLWKELIDDPVYGHFEGSSKVWIWHGVFDQELNWIPDPTHDFKTEEEVLVE
                     KQKQSFPKKKDVSKKTNAPKVLKTNEITPDSDLHKMLLDDPRYKKHIGNVEYGYYDND
                     GVWIWTGTFDDNGEFKPDKVDLEVISDNLQSESNFSTLFDSWKKNNQNNLEYEIESKR
                     FKTVKPKVVYVNEQEQPDDHHVEEEQLARSKATKNELIKKSKYEKPTDEDLGILTYDK
                     SKIHDDQIVDASVLEGSSAQQAPFWLEFVGNEEYGHYNAKGNWIFDGYFDEQYEFVST
                     RVQEEVKQPTSGVSKTSILDDHANLDEYFKPASKEEILSYTPKAKKTEPVVEKVEEEF
                     FTKFIGDKNYGYYNDKNVWVWSGYFNEYDQFVPDEAPKNNKLLDEIVSLAAEQQKEQD
                     LLKAKVESELAAKQQAVQEQIQRELELRDQFLREQQAKEEALKLREQSLNEKAIRLKE
                     EILKLKLQSLKNQEEAKKQALKEQEFAEQFKQIKATKFIKPNKDNYKSIHQFVGGLSE
                     LSQIPTKPVEFAQPTLKTAEFKFEPSVVEEKVEFVVKDKLIDSVDAIVVDTKEVELPA
                     EQFSADQFSQQPQAKPQFDFKEELVLTEIIPAIVSEEISTPVVEISKPDLFTKQELDL
                     SNVEVKLADQASDSEVVSVDLSSVELADSQFSLAQDQVEPVVVIEQRAHEEVVLSEPV
                     VEFEQVQLEELDVVPLVEEQPEFVKVVEQPAPEVEVQEQPVQEVVHEEVLEVVEVVEH
                     PAPEVEVQAEEVVEEQPVKEVVELVEEPTHEETVEHPAPQVEEVFEEQPVQEQVHEVV
                     DEPVHEEVVEEHPAPEVEAESVDEEVEFWEQYVGDEHYGHYDENEEWIWDGYFDENQN
                     FFRNDEGFDQPEEVELASNVEDDHLVPSSEDLSEYPEEVVQEDEITEDEQPEPEIIDF
                     SANAKSHEEVEAQQPAEEFLQEVEAQPEEEAEEVEFWEQYVGNEDYGHYDENEEWIWD
                     GYFDEDNNFFRNEDGEQTDQPEEVEHVEEPVVAEEETLPTQAVEFDDQAELEEISEDD
                     QPEPEIVDFSGSSESEQEVHQEPAVEEEVEPAHEEAVAEEEPVVEQESVAEEQPEVEP
                     QPAVEEEVHEEEPAVEEPAEEAEFWEQYVGDEHYGHYDQDGEWVWAGYFDEDNNFIKN
                     EDEAVADEEPVSEESEEAESTQEEAASEGIEEVEVEGEHYIYADENGEINFDNYIGNE
                     NFGYYLEDGEWEWYEGDFDEKGNWFVYVQGEPEEVNVEEDIPALKGVDTESVDADDWL
                     SQFDEDAASAIFENEESDEDLDDDFGLLSGKKKNKKAKKANK"
     misc_feature    408961..409041
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    409141..409227
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    409414..409494
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    409573..>411279
                     /locus_tag="MGF_2404"
                     /note="terminal organelle assembly protein TopJ; Region:
                     termin_org_DnaJ; TIGR03835"
                     /db_xref="CDD:234368"
     misc_feature    409882..409965
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    410158..410241
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    411634..411717
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    412006..412089
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    412492..412575
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     misc_feature    412744..412830
                     /locus_tag="MGF_2404"
                     /note="EAGR box; Region: EAGR_box; TIGR03834"
                     /db_xref="CDD:213869"
     gene            complement(413278..413354)
                     /gene="trnR"
                     /locus_tag="MGF_tRNA23"
                     /db_xref="GeneID:12396673"
     tRNA            complement(413278..413354)
                     /gene="trnR"
                     /locus_tag="MGF_tRNA23"
                     /product="tRNA-Arg"
                     /note="MGF_tRNA23; anticodon:TCG; Arg-tRNA; predicted with
                     tRNAscan-SE v., cove score=86.83"
                     /db_xref="GeneID:12396673"
     gene            complement(413404..413922)
                     /locus_tag="MGF_2452"
                     /db_xref="GeneID:12396674"
     CDS             complement(413404..413922)
                     /locus_tag="MGF_2452"
                     /note="MGF_2452"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880606.1"
                     /db_xref="GI:385326169"
                     /db_xref="GeneID:12396674"
                     /translation="MFNKRYVINQHLELKKIDNYQINELYDFLNSLNNEHHLGFSKSE
                     VDLVNLEEYIVLAKKRWTEKSSYFFVIYLDKQIFGLIKINVDKTNGQIKYLLQTYDPK
                     IIEQLIDFFIRVAQSTNLKWLYLKVEQDNNQLDQILNSVCMYKLNSLELKEINIVRSN
                     TKLIDNYWAKRV"
     gene            413890..414807
                     /locus_tag="MGF_2451"
                     /db_xref="GeneID:12396675"
     CDS             413890..414807
                     /locus_tag="MGF_2451"
                     /note="MGF_2451"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880607.1"
                     /db_xref="GI:385326170"
                     /db_xref="GeneID:12396675"
                     /translation="MLINYISFIKHGFYIIILINKNMPFKKDLNLSDCFKIVDNQLVL
                     SEKYKQEYGSKFKKITGSRFPNVLGINEFNTPFIEWLKMVNLYYETMDPILSKAGVVI
                     EPKVREYIMNKFKINYKTYDPIKVGFDLFKDNQIFGGIPDGEPVDQDGNLLYDENHPM
                     LEIKTTSIDKLSYKKVDGLLRMMVDQSGLPIVKAKREKYFEWYDENKQIKVKKEYVLQ
                     LSLYLYLRNAKYGRFGVIFLRPEDYQNPEAIDLSQRLIDVVDMKVEKSSIEPYIEQAT
                     QWYQDHIIKGISPKMTRSDLEFLKLHKII"
     misc_feature    414058..414564
                     /locus_tag="MGF_2451"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     pfam09588"
                     /db_xref="CDD:255437"
     gene            414825..416015
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /db_xref="GeneID:12396676"
     CDS             414825..416015
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /note="MGF_2460"
                     /codon_start=1
                     /transl_table=4
                     /product="thiamine biosynthesis protein ThiI"
                     /protein_id="YP_005880608.1"
                     /db_xref="GI:385326171"
                     /db_xref="GeneID:12396676"
                     /translation="MNTSNYQIMIKFGELWLKNNNRINFINQLKANLQQAISKFELKL
                     NLQYDHFLITNYHKQDQTELIEILKRIPGISYVCLVQQLQRDLNLLQDLVLEMVNDHD
                     QLAFEIKRKDKSYELTSLDLKKTLSAYCLKNRQIKINLTNPTKMISIDVVKNYFILYL
                     HKYSAAGGLPVKSSGKVLVLLSGGIDSPVASDLLYKRGMHVDFLTFITPPHTSKQALD
                     KTVLLAQTVSKHNEVSDAKIFIHNFTNVLKEISHTKYENYRITLMRRCFYKIANKLIN
                     QYGYDCIATGESLGQVASQTINSMKAISNASKDLLVLRPLLCYDKSQIIEHAKKIKTY
                     EISILPYSDACSLYAPKKPITNPRIEIIDKIEAKLDFLDIVIDNSITNDIIQFDLNKQ
                     WDNN"
     misc_feature    414846..416000
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /note="thiamine biosynthesis protein ThiI; Provisional;
                     Region: PRK01565"
                     /db_xref="CDD:234960"
     misc_feature    414846..415325
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /note="THUMP domain of thiamine biosynthesis protein ThiI;
                     Region: THUMP_ThiI; cd11716"
                     /db_xref="CDD:212585"
     misc_feature    415350..415889
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /note="ThiI is required for thiazole synthesis in the
                     thiamine biosynthesis pathway. It belongs to the Adenosine
                     Nucleotide Hydrolysis suoerfamily and predicted to bind to
                     Adenosine nucleotide; Region: ThiI; cd01712"
                     /db_xref="CDD:238845"
     misc_feature    order(415362..415370,415374..415385,415440..415442,
                     415446..415448)
                     /gene="thiI"
                     /locus_tag="MGF_2460"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238845"
     gene            416000..416986
                     /locus_tag="MGF_2470"
                     /db_xref="GeneID:12396677"
     CDS             416000..416986
                     /locus_tag="MGF_2470"
                     /note="MGF_2470"
                     /codon_start=1
                     /transl_table=4
                     /product="phosphodiesterase"
                     /protein_id="YP_005880609.1"
                     /db_xref="GI:385326172"
                     /db_xref="GeneID:12396677"
                     /translation="MRQQLEVHDQIWAKVQEFDHLTFFVHERPDFDALGSAFAFKELI
                     NNMFPEKKVYVMGTYKLDPELGASLFPFEKEPVDIEFLERSLGIVFDTANAERILTGQ
                     HKLVKEIIRIDHHPKTEIIGSIEWVDPTFSSTAEMIGWFIKWMGFKLNSIIAKYIYAG
                     IITDTGRFLYLATTPSTFMMTAEILATGFNRNEVHDAVYLKPILEHKYYSYVVNHAKI
                     TPNGLAYIAVRKGAHKRFGIRSPMTMVHALNNIDGVKIWTAIYFDDQSQKWKGSIRSY
                     DIPINHFAAMFNGGGHKFASGFSLDNKQDFYKLIKVLDDYLKTIDNDQLSQN"
     misc_feature    416009..416953
                     /locus_tag="MGF_2470"
                     /note="Exopolyphosphatase-related proteins [General
                     function prediction only]; Region: COG0618"
                     /db_xref="CDD:223691"
     misc_feature    416039..416485
                     /locus_tag="MGF_2470"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     misc_feature    416771..416944
                     /locus_tag="MGF_2470"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            416958..417797
                     /locus_tag="MGF_2479"
                     /db_xref="GeneID:12396678"
     CDS             416958..417797
                     /locus_tag="MGF_2479"
                     /EC_number="2.1.1.-"
                     /note="MGF_2479"
                     /codon_start=1
                     /transl_table=4
                     /product="SpoU rRNA methylase family protein"
                     /protein_id="YP_005880610.1"
                     /db_xref="GI:385326173"
                     /db_xref="GeneID:12396678"
                     /translation="MTMINFHKINAKNNPIFKDLKIAFKNGYNKQISDYFCVGGIKNN
                     LIALNNNWLPHTIFVSKSFDQKLISNIKSKLKQHKVRWIMISDQLNDQLKAINTQAGD
                     CYFYYLLKDLNHPTFDLSDQHNYLFLDHIQDPSNLGTILRNAAAFDLTKVLIHDSVNL
                     YNPKLIRASAGAIFSNQISLIKNLDQFLNAIKKKGLRLVATANHEDATPLDQFDHQLG
                     NIIIFGNEANGVSEQLLNQADQTIKIVINNQYAESLNVATSSGIILYELNKLWKKRSL
                     SNQ"
     misc_feature    416991..417764
                     /locus_tag="MGF_2479"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    417330..417752
                     /locus_tag="MGF_2479"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            417767..418759
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /db_xref="GeneID:12396679"
     CDS             417767..418759
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /EC_number="5.4.99.-"
                     /note="MGF_2485"
                     /codon_start=1
                     /transl_table=4
                     /product="RNA pseudouridine synthase"
                     /protein_id="YP_005880611.1"
                     /db_xref="GI:385326174"
                     /db_xref="GeneID:12396679"
                     /translation="MKKTIVIKSVDDCIRIDKFLFKYLKNYTRTNIYKMIRKKDITVN
                     NQRIDFDYILKVNDKITYYDFLRTDHKKKVPEFFKAKPELDLIYEDENLVIFEKPLGI
                     PAQQTDEPSQYDHMQNRLVHYLVKSNQYDYLNNQAYLPSIVNRLDTYTTGIMLGAKNL
                     KAQQALNQIIKNRDLKKFYHCLVHGEINPKKATLTAYLTKDPNRSLVSIQKEKTNDNK
                     IIITRYQTLYYFKKQNYTLLDVELITGRTHQIRAHLASINHPVVGDYKYAKKQYQNNQ
                     GNFKHQLLHSYKIIFDLANYDQDFILKYLDQNQYQTKSPAWFHSQLHPNPYEEK"
     misc_feature    417806..418024
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    417809..418681
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /note="pseudouridine synthase, RluA family; Region:
                     rluA_subfam; TIGR00005"
                     /db_xref="CDD:161659"
     misc_feature    order(417809..417811,417845..417850,417854..417859,
                     417863..417868,417875..417880,417884..417886,
                     417905..417910,417911..417925,417929..417931)
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    418043..418639
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    order(418196..418207,418517..418519)
                     /gene="rluA_2"
                     /locus_tag="MGF_2485"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            418781..419053
                     /locus_tag="MGF_2488"
                     /db_xref="GeneID:12396680"
     CDS             418781..419053
                     /locus_tag="MGF_2488"
                     /note="MGF_2488"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880612.1"
                     /db_xref="GI:385326175"
                     /db_xref="GeneID:12396680"
                     /translation="METTKTIYNDELIKGWLKEIIKLVPGITSELSDDDIEIDEDTIT
                     ITVVCKLGIRPYQVCLMAQSMIYYELSRWDDHHPYFINVIIKEIKG"
     gene            419062..420786
                     /locus_tag="MGF_2491"
                     /db_xref="GeneID:12396681"
     CDS             419062..420786
                     /locus_tag="MGF_2491"
                     /note="MGF_2491"
                     /codon_start=1
                     /transl_table=4
                     /product="dihydroxyacetone kinase-like protein"
                     /protein_id="YP_005880613.1"
                     /db_xref="GI:385326176"
                     /db_xref="GeneID:12396681"
                     /translation="MASDTLTTKQLQSMFIEGYNVIFNRYEYINNLNVFPVPDGDTGT
                     NMKITTKGGVDAISDLEFNSLQSLGKVFATGLFMNACGNSGVIFSQIIKGFTKSLPDG
                     DEVGIKQLINSFKEAKEVAYSVIQSPVEGTILTVVRLTADQLVQKQDEISSVEQLFEL
                     ATEFAKDALKQTPKMLPALKSANVVDSGGFGLVSFLEGMLTELTKDFSRLNNDKQFVN
                     KKALSSKAEQELVEEGHGYCTEFLLKLGLKAKDDQTKIKFNEEKFKKEISKDVESLVL
                     INDKEEGIVKLHAHTLTPDLVLKHAQPYGEFLKVKIENMNKQVTERKQDDSNLGQLAN
                     KPIDLLMDIDLSKIKDFKTETAIIATVPSRVLGKMIVQNYDVDQFIDTSATGNPTIKD
                     FVKNIYSVKSKNVIIVVDDTNLLLSAKEAIALLKKHINCELISCQNFIEALSAISGYM
                     RSDSLKSNVKVLHKIIKSTGSAFISTSVKNIKYPHLQVHKGDYIGVMKKKIIVSDSDI
                     YKCLLDTVAQLIDEVKKPELVLIIYGKNTSSSEVRTIVKLISEKFGIYCEAINGSQKL
                     YQYYIGVQ"
     misc_feature    419092..420783
                     /locus_tag="MGF_2491"
                     /note="DAK2 domain fusion protein YloV; Region: YloV;
                     TIGR03599"
                     /db_xref="CDD:234275"
     misc_feature    419167..419661
                     /locus_tag="MGF_2491"
                     /note="DAK2 domain; Region: Dak2; pfam02734"
                     /db_xref="CDD:251502"
     misc_feature    419767..420783
                     /locus_tag="MGF_2491"
                     /note="Dihydroxyacetone kinase family; Region: Dak1_2;
                     pfam13684"
                     /db_xref="CDD:257987"
     gene            420729..421772
                     /gene="plsX"
                     /locus_tag="MGF_2500"
                     /db_xref="GeneID:12396682"
     CDS             420729..421772
                     /gene="plsX"
                     /locus_tag="MGF_2500"
                     /note="MGF_2500"
                     /codon_start=1
                     /transl_table=4
                     /product="Fatty acid/phospholipid synthesis protein PlsX"
                     /protein_id="YP_005880614.1"
                     /db_xref="GI:385326177"
                     /db_xref="GeneID:12396682"
                     /translation="MWSDQRITKTISILHRCAIMFRIAVDCMGFENSVSEAVKAVIKY
                     AKKHKDLSFVLVGDENQIRPLVENKKYLNYRIVHTTNEIGMSDSVLTAYRKKDSSMYL
                     TIELLKNNEVDTIISAGSSSAYVALTYNLIGKIHHKIKVGFMSYVPTVTKRGFWFLDV
                     GANKEYLGEELYYLGKMANTFITSVFNYQPRLGVLNIGAEKNKGFEYHQVVYNLLEND
                     KTVDFLGFIEPRGLIKGECDLLVSDGYSGNLVLKSLEGALKSVGKILKKNYKINPLGA
                     LFSANVIYQITKTFDYKNNAGAVVLGLNKLVLKTHGSADAKQFYSTIRLAHESLLNNL
                     IEKITKECSTFLN"
     misc_feature    420786..421763
                     /gene="plsX"
                     /locus_tag="MGF_2500"
                     /note="putative phosphate acyltransferase; Provisional;
                     Region: PRK05331"
                     /db_xref="CDD:235414"
     gene            421840..423807
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /db_xref="GeneID:12396683"
     CDS             421840..423807
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /EC_number="3.1.26.3"
                     /note="MGF_2505"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribonuclease 3 (Ribonuclease III)"
                     /protein_id="YP_005880615.1"
                     /db_xref="GI:385326178"
                     /db_xref="GeneID:12396683"
                     /translation="MENLEKNTKKKIKKPNNFKKNNKDKTEELKDKPTPRMFKMTPKS
                     SKFLHQLGVTGRKHTEKPVPLNDPDYEKKIREIQAKEAKKIRSDEVVNNNSKKQNNNK
                     QAKKKANKNKKQKGNNNNFQNNKKPENWKQKPAANNQVKAIPNSEKSTAKTAINLIIK
                     RTFETLKQNNLIAPNLKQNPNKKDKPQQPNVAAKNNNQKEVKKPYNNFVNNQKNHNKN
                     NAGNKGDNKQPTKPLNQSKLSKSTIVELPFTPNFTSNQPKPTQKEDSKKVKAKKAENS
                     QPQESNKQVKKLEVKTNQQKQDQTKKKQPKENKNQQIKAVNLNNNQQKTNNNNQKNSV
                     DKSENDNNKKKSEANQKQENLNPNNNNKKKEDSKNESNNIPLINKNISDQQIVKISNY
                     IKDNYPVIYADLKEKNRLGFNSNLDDDKLIVYANYEAKDLELLLKKFKVVTNNIGLYE
                     EALTHNSYANEMHLKYNYQRLEFLGDAIINKIVAEYLFNHSDSSEGEMTKDRIKIIQS
                     NTLIKAATQLELINYIRVGEGLKIAPLSPKILEDIFEAFIGAMYLDQGEYAVRKILND
                     TIIGYYQKGQLTENTDYKSIFQEIIHSTGLNMKIHYERTYDRQKNLHTVSLYAGGIMY
                     GEGKDSSTHKAEIKAAKEAISKFRGLLKLEK"
     misc_feature    423127..423777
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="ribonuclease III; Reviewed; Region: rnc; PRK00102"
                     /db_xref="CDD:234633"
     misc_feature    423181..423570
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="RIBOc. Ribonuclease III C terminal domain. This
                     group consists of eukaryotic, bacterial and archeal
                     ribonuclease III (RNAse III) proteins. RNAse III is a
                     double stranded RNA-specific endonuclease. Prokaryotic
                     RNAse III is important in...; Region: RIBOc; cd00593"
                     /db_xref="CDD:238333"
     misc_feature    order(423244..423249,423256..423261,423268..423270,
                     423277..423282,423289..423294,423298..423303,
                     423331..423333,423493..423495,423520..423522)
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238333"
     misc_feature    order(423244..423246,423253..423255,423265..423267,
                     423463..423465,423472..423474)
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="active site"
                     /db_xref="CDD:238333"
     misc_feature    order(423253..423255,423463..423465,423472..423474)
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238333"
     misc_feature    order(423583..423585,423601..423606,423727..423738,
                     423745..423747)
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="dsRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238007"
     misc_feature    423586..423777
                     /gene="rnc"
                     /locus_tag="MGF_2505"
                     /note="Double-stranded RNA binding motif; Region: dsrm;
                     pfam00035"
                     /db_xref="CDD:249528"
     gene            423913..426066
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /db_xref="GeneID:12396684"
     CDS             423913..426066
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="MGF_2519"
                     /codon_start=1
                     /transl_table=4
                     /product="Chaperone protein ClpB"
                     /protein_id="YP_005880616.1"
                     /db_xref="GI:385326179"
                     /db_xref="GeneID:12396684"
                     /translation="MFASFTPTEEKNVLSKYSRNLNDEIARNAIDPTIGREEEIRRLI
                     EILSRKNKNNPVLIGEPGVGKTAIVEGFARKIVNGDVPDNLKDVEVVELSLSSLIAGT
                     QFQGSFEERLNKILKEVKNSSGKVILFIDEIHQLVGMGKNSSNSAMDAANILKPMMAR
                     GEIKVIGATTIDEYRKYIEKDGALERRMQKILVDEPTKQEALTIMRGLRERWEAFHKV
                     RIFDDALVAAVEMSARYISDRYLPDKAIDLIDEAAAKIKTLIHSLPPELDNIKQKIIH
                     LSTELAALEREKKENHSNVRLGRIEQLKKEIKDFTNKQNELTVKWTQQKTIYECINKL
                     KEEVTNLTAEIERLQAKGEYTQASKLLYLEIPKRQEEIEKKTKELSEFTDNLIKTSIS
                     RVEIAEVISQATKIPLSKLVASEQQKLLNLKNDLSKYIKGQDHAIKNVSDAVLRGRAQ
                     INDPNRPIGSFLFLGPTGVGKTEVAKKLAYCLFDNEKAMVRIDMSEFMERHSVDKLIG
                     SPPGYIGYDQPGVLSDAIRTKPYAVVLFDEIEKAHPDVLNILLQILDDGQLTDNHNRL
                     VNFKNTIIIMTSNIGAEHILANNPAKTIEELKRKIRPELLNRIDELITFKALNDKDLS
                     AIAQKLLSDLSDRIKKQQINITFDKKIVENVVKHGSNTVFGARPLKRYIQREVENFLA
                     KKIIENKLEKNKSYVCTFNAETNEYTLVNLRKAVS"
     misc_feature    424012..424500
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    424066..424491
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    424087..424110
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(424090..424113,424303..424305,424420..424422)
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    424291..424308
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    424471..424473
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    425203..425757
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    425305..425328
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(425308..425331,425521..425523,425647..425649)
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    425509..425526
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    425734..425736
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    425764..425997
                     /gene="clp"
                     /locus_tag="MGF_2519"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            complement(426121..426747)
                     /locus_tag="MGF_2533"
                     /db_xref="GeneID:12396685"
     CDS             complement(426121..426747)
                     /locus_tag="MGF_2533"
                     /note="MGF_2533"
                     /codon_start=1
                     /transl_table=4
                     /product="Deoxynucleoside kinase"
                     /protein_id="YP_005880617.1"
                     /db_xref="GI:385326180"
                     /db_xref="GeneID:12396685"
                     /translation="MLVAISGMVASGKSTLSNNLHLHYKNSKILYEYDEKDEVFNQFL
                     EWLYNKNAVVDFAFQSYVVQNYSRHLKQALSQNYDYIFSDRFNLEHFIFAKNKISKKP
                     KKFINAYEAMFDVLVSEDKIPDLVIYLDFNFDEFKKRIFKRNRIVETSTFNDNIDYWR
                     NLHSIYKKEFINQQQKYKFKVVYLDTNNKNEEDIFKQSVEIINLYSAK"
     misc_feature    complement(426136..426747)
                     /locus_tag="MGF_2533"
                     /note="Deoxynucleoside kinases [Nucleotide transport and
                     metabolism]; Region: COG1428"
                     /db_xref="CDD:224345"
     misc_feature    complement(426166..426741)
                     /locus_tag="MGF_2533"
                     /note="Deoxyribonucleoside kinase (dNK) catalyzes the
                     phosphorylation of deoxyribonucleosides to yield
                     corresponding monophosphates (dNMPs). This family consists
                     of various deoxynucleoside kinases including deoxyribo-
                     cytidine (EC 2.7.1.74), guanosine (EC 2.7.1; Region: dNK;
                     cd01673"
                     /db_xref="CDD:238836"
     misc_feature    complement(order(426304..426306,426319..426321,
                     426466..426468,426571..426576,426604..426606,
                     426706..426711,426715..426717))
                     /locus_tag="MGF_2533"
                     /note="Substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     misc_feature    complement(426550..426552)
                     /locus_tag="MGF_2533"
                     /note="Substrate specificity [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     gene            complement(426750..427397)
                     /locus_tag="MGF_2540"
                     /db_xref="GeneID:12396686"
     CDS             complement(426750..427397)
                     /locus_tag="MGF_2540"
                     /note="MGF_2540"
                     /codon_start=1
                     /transl_table=4
                     /product="Deoxynucleoside kinase"
                     /protein_id="YP_005880618.1"
                     /db_xref="GI:385326181"
                     /db_xref="GeneID:12396686"
                     /translation="MLIGISGMVACGKSVLSKRIHEHYKTSLFLREFKEDDVVFNKFL
                     EWLYEKRPNTEISFQAYICENHSTKMNEIWKNYRSENKDSKKDHIIIDRFCIEHNIFA
                     RLILAKKGDKFLNAYQAMFDMMIDKNEIPDIAIFLDVNFENFKKRLFKRNRKVEVNNF
                     DENLDYWKELHQNYRKNFEILCEKYKVNAYYIDTNDMTEIEVFNKAVEIIDNHNR"
     misc_feature    complement(426759..427397)
                     /locus_tag="MGF_2540"
                     /note="Deoxynucleoside kinases [Nucleotide transport and
                     metabolism]; Region: COG1428"
                     /db_xref="CDD:224345"
     misc_feature    complement(426807..427391)
                     /locus_tag="MGF_2540"
                     /note="Deoxyribonucleoside kinase (dNK) catalyzes the
                     phosphorylation of deoxyribonucleosides to yield
                     corresponding monophosphates (dNMPs). This family consists
                     of various deoxynucleoside kinases including deoxyribo-
                     cytidine (EC 2.7.1.74), guanosine (EC 2.7.1; Region: dNK;
                     cd01673"
                     /db_xref="CDD:238836"
     misc_feature    complement(order(426930..426932,426945..426947,
                     427092..427094,427221..427226,427254..427256,
                     427356..427361,427365..427367))
                     /locus_tag="MGF_2540"
                     /note="Substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     misc_feature    complement(427200..427202)
                     /locus_tag="MGF_2540"
                     /note="Substrate specificity [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     gene            427574..428911
                     /locus_tag="MGF_2543"
                     /db_xref="GeneID:12396687"
     CDS             427574..428911
                     /locus_tag="MGF_2543"
                     /note="MGF_2543"
                     /codon_start=1
                     /transl_table=4
                     /product="TlyC-like protein"
                     /protein_id="YP_005880619.1"
                     /db_xref="GI:385326182"
                     /db_xref="GeneID:12396687"
                     /translation="MTSEESSSVTDNNSIVTDNSSIAIYIIYGVLILLFLFISVIFSA
                     LETAFTSLTSFKWNGYIKEHNIQKKLRTKIINKLIKNFTLTLSTILICNNVANIIIST
                     LSTLLFNRIVENQAVGSSLAVFVTTFITLFFGEIAPKSIAKFRPIKTVLLFSFVMIFF
                     YYLVFPVTFLISKVFKKYSKTQTSEKEVTFFIDEAKNEGVLENDEALLIKNAINFDET
                     LIQQVYTKWKEVVYVHEHSSIGLIKKRFLSDNVSRIPIINDENKTIGVLHLKDYLSIV
                     ENKDEDNWTEYLSEPIYVLTDYKLDKVLYLMKRERVQIAIVVNNFNEYESIGIITMED
                     LLEQLVGQIYDEQDEVGQVQEINAYTWMVDSSINAQYFLHKYINKNINVKKNIKLLDY
                     INNNTQHNARYEDGIYHDDFMTVKYLEYDEETKVKLVEIIKNEIQVTEISTNY"
     misc_feature    427652..428188
                     /locus_tag="MGF_2543"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    428249..428581
                     /locus_tag="MGF_2543"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    428255..428587
                     /locus_tag="MGF_2543"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     gene            428913..430679
                     /gene="trkG"
                     /locus_tag="MGF_2548"
                     /db_xref="GeneID:12396688"
     CDS             428913..430679
                     /gene="trkG"
                     /locus_tag="MGF_2548"
                     /note="MGF_2548"
                     /codon_start=1
                     /transl_table=4
                     /product="Cation transport protein"
                     /protein_id="YP_005880620.1"
                     /db_xref="GI:385326183"
                     /db_xref="GeneID:12396688"
                     /translation="MLKINGKNRKNSLSKRNKIIKWLKIIFTGETISQKIAHFYIYFI
                     LIGSILLYLPISLKYSDTYEKATNVTFQGLAAEPIIEKAKYSFIDSFFIATSAFSDTG
                     LSTLVVRETYTIFGQIILAILIEVGGVGFVVFWYLIWRIFAKIFKDQSSLEKTLLLQS
                     ERGGEKLSTTSKTIMVAVTAVMIFQIIYAIFYSLYFYFVPSFEQQNIIDLQNSDVNGL
                     LIDFKASQITVDNPYRKFFTYHNAGSAIWAGIFHSVSSINNAGFDIFGPFSLSSFRND
                     HHIVLLFITATQFFIGGIGYPTIFDIYEKIRYKRLYKNRVKYKFSIFTKLSLITSAIL
                     LMLPIVIVAPVEVLSKNGSFNVTSQIFEQSLKNNLKFEPSLNIQTPEQLYQTIYGKNS
                     KLDYVLNLWFMIFSSRSAGFSTISMYNLTDVSKLIFSLLMFIGAAPSSTAGGVRTTTF
                     ALVMVVIFQKFKGYKQVRLFKRSIPSETINSACLITLLSAIFLIVAAVGTKITFDFVL
                     PDVRFSIMDVFFEYSSGYGTVGLSVGITSYLTSINLVPLVLLIALMIIGQLGVSTSIL
                     AWVKSDAIKWNYSYVDEDVKIG"
     misc_feature    428958..>429392
                     /gene="trkG"
                     /locus_tag="MGF_2548"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     misc_feature    429006..430622
                     /gene="trkG"
                     /locus_tag="MGF_2548"
                     /note="Trk-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: TrkG;
                     COG0168"
                     /db_xref="CDD:223246"
     misc_feature    429393..430613
                     /gene="trkG"
                     /locus_tag="MGF_2548"
                     /note="Cation transport protein; Region: TrkH; cl17365"
                     /db_xref="CDD:266653"
     gene            430800..431966
                     /gene="ackA"
                     /locus_tag="MGF_2562"
                     /db_xref="GeneID:12396689"
     CDS             430800..431966
                     /gene="ackA"
                     /locus_tag="MGF_2562"
                     /EC_number="2.7.2.1"
                     /note="MGF_2562"
                     /codon_start=1
                     /transl_table=4
                     /product="acetate kinase"
                     /protein_id="YP_005880621.1"
                     /db_xref="GI:385326184"
                     /db_xref="GeneID:12396689"
                     /translation="MNKILVINAGSSSIKFQLYDANEKVLAKGLCERIFIDGAFKYEF
                     EDGSKDEGNSAFPTHKEALTHLLESLKKHKVINDLSEIVGVGHRVVQGAYWTDSTLIT
                     PQVLEKIYELAKLAPLHNKPEADVIDVVQKLIPKAKNVAVFDTSFHTSMPEVAYEYAI
                     PREWKEKHLVRRYGYHGTSYRYVTKRFEQLLNKKAVNLVICHLGNGASIAAIKDSKSI
                     NTSMGFTPLEGLVMGTRSGDIDPSVVQYIAKQTNKTLDQVIDDLNKKSGLLGLSSYAD
                     MRDVTSNLPKTQLTLDVYTQRVADYILKYANQINASIDGLVFTAGVGENASLIIQEVV
                     NKVHLLKVSLDPKAFEQKYSDYRKLSDDKSQLNVYQVRTNEEIMIMRDVVRLSK"
     misc_feature    430806..431963
                     /gene="ackA"
                     /locus_tag="MGF_2562"
                     /note="acetate kinase A/propionate kinase 2; Reviewed;
                     Region: PRK00180"
                     /db_xref="CDD:234680"
     misc_feature    430812..>431231
                     /gene="ackA"
                     /locus_tag="MGF_2562"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(430821..430832,430836..430838,430842..430844,
                     431181..431183,431229..431231)
                     /gene="ackA"
                     /locus_tag="MGF_2562"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            432136..433554
                     /locus_tag="MGF_2572"
                     /db_xref="GeneID:12396690"
     CDS             432136..433554
                     /locus_tag="MGF_2572"
                     /note="MGF_2572"
                     /codon_start=1
                     /transl_table=4
                     /product="NADH oxidase"
                     /protein_id="YP_005880622.1"
                     /db_xref="GI:385326185"
                     /db_xref="GeneID:12396690"
                     /translation="MKVIVVGINHAGTSAIRTMLAENPKLDVVAFDRNDNISFLGCGI
                     ALAVSGVVKDTTDLFYSNPEQLRSMGAKVHMKHEVLSVDHNRKVVVVCNLEKNSTFEE
                     SYDKLILATGAWPITTADASLPFTEKYCGGIEGLVACKTYQHALEIIDQFKKPDVNNI
                     VVIGAGYIGVELVEAAHQKGKKTLLVDMLPRPAANYFDKEFGTDLMTTMKKEGVDVRC
                     GTKVMGYLVDTEGGKKVIRGITLEKDGVQTKVEADLVIQCIGFLPNTSLLADAHKVKN
                     GALIIDQYCQTSVKDVYAIGGAAAIMNAATGEYQNIDLATNAVKTGVVAASHINGMTN
                     IKLENVVGTNAIHVFGHHLASTGISEEVAKIRGIQAVASYFEDADRPEWMNTYDRVKI
                     KLVYDPKTLRLLGAQVGSTKNNHSEVIYLLALAIQRKLTLVDVAFADVFFLPHYNKPF
                     NFIISAILQALGLNYFKESIKK"
     misc_feature    432136..433485
                     /locus_tag="MGF_2572"
                     /note="coenzyme A disulfide reductase; Reviewed; Region:
                     PRK09564"
                     /db_xref="CDD:181958"
     misc_feature    432610..432849
                     /locus_tag="MGF_2572"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    433168..433476
                     /locus_tag="MGF_2572"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            433615..434694
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /db_xref="GeneID:12396691"
     CDS             433615..434694
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /EC_number="1.2.4.1"
                     /note="MGF_2578"
                     /codon_start=1
                     /transl_table=4
                     /product="Pyruvate dehydrogenase E1 component alpha
                     subunit"
                     /protein_id="YP_005880623.1"
                     /db_xref="GI:385326186"
                     /db_xref="GeneID:12396691"
                     /translation="MAIIVKNKIPELLHRVIDNEGRVIDPSYVQKLSDERVIEAYYYM
                     NLSRELDKKMLTWQRSGKMLTLAPNIGEEALQLGTSLAMTKKDWLVPAFRSGALMLHR
                     GVKPYQLMLYWNGNEKGNVFDEGVRVIPINITIGAQYSQAAGIGYALKQNKERAAAVT
                     FIGDGGTAEGEFYEAMNLASIHKWQTVFCVNNNQYAISTRTNLESAVSDLSTKAIAVN
                     MPRVRVDGNDLLACYDAMLEAIEYSRSGMGPIFVEFVTYRQGPHTTSDDPSVYRTKQE
                     EEEAKKSDPIARIKKFLTAKGLWDEAKEKTMFEQIEAKISEEYDVMLQHIQTTVDDVF
                     DHTYATLPQNLVEQKAVAKKYFGDK"
     misc_feature    433732..434574
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of
                     PDC_ADC_BCADC subfamily, TPP-binding module; composed of
                     proteins similar to the E1 components of the human
                     pyruvate dehydrogenase complex (PDC), the acetoin
                     dehydrogenase complex (ADC) and the branched chain...;
                     Region: TPP_E1_PDC_ADC_BCADC; cd02000"
                     /db_xref="CDD:238958"
     misc_feature    order(433804..433806,433957..433959,434011..434016,
                     434107..434109,434113..434124,434131..434133,
                     434143..434145,434155..434157,434200..434211,
                     434251..434253,434266..434268,434410..434412,
                     434422..434424)
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(433891..433896,434011..434013,434017..434019,
                     434101..434112,434191..434193,434197..434199,
                     434398..434400)
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238958"
     misc_feature    order(433996..433998,434002..434004,434008..434010,
                     434023..434025,434032..434037,434044..434049,
                     434053..434058,434065..434067,434122..434127,
                     434143..434148,434155..434157)
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238958"
     misc_feature    order(434383..434403,434407..434439,434461..434469)
                     /gene="acoA"
                     /locus_tag="MGF_2578"
                     /note="phosphorylation loop region [posttranslational
                     modification]"
                     /db_xref="CDD:238958"
     gene            434719..435696
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /db_xref="GeneID:12396692"
     CDS             434719..435696
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /EC_number="1.2.4.1"
                     /note="MGF_2585"
                     /codon_start=1
                     /transl_table=4
                     /product="Pyruvate dehydrogenase E1 component beta
                     subunit"
                     /protein_id="YP_005880624.1"
                     /db_xref="GI:385326187"
                     /db_xref="GeneID:12396692"
                     /translation="MSDKIIVNNIEALNNALDIALSKDKSVVLYGQDAGFEGGVFRAT
                     KGLQQKHGADRVWDTPISEAAVTGAAIGASYAGLKPIVEIQFSGFSYPAMQQLFCHAA
                     RIRNRSRGKLNAPIVIRMPMGGGIKALEHHSESLEAIYAHIPGVKVVMPCNPYDTKGL
                     MLAAINDPDPVVFFEPKKLYRSFKQEIPAGEYVVEIGKANVLTQGSKLTIVTYGANVI
                     DTLEIVNQYPAGDLELIDLRTISPIDWNTVLGSVQKTGRLLVVHEAVKSFSVSAEIMA
                     RVSETLHSSLKKAPVRVTGFDITVPLAKGEAIQFDLKKRTVDAINELLA"
     misc_feature    434737..435690
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="Pyruvate/2-oxoglutarate dehydrogenase complex,
                     dehydrogenase (E1) component, eukaryotic type, beta
                     subunit [Energy production and conversion]; Region: AcoB;
                     COG0022"
                     /db_xref="CDD:223101"
     misc_feature    434749..435249
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="Pyrimidine (PYR) binding domain of the beta
                     subunits of the E1 components of human pyruvate
                     dehydrogenase complex (E1- PDHc) and related proteins;
                     Region: TPP_PYR_E1-PDHc-beta_like; cd07036"
                     /db_xref="CDD:132919"
     misc_feature    order(434791..434793,434797..434799,434815..434817,
                     434881..434883,434890..434892,434896..434913,
                     434920..434925,434929..434937,434992..434994,
                     435001..435006,435031..435036,435100..435102,
                     435109..435111,435154..435159,435220..435225)
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="alpha subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132919"
     misc_feature    order(434812..434814,434899..434901,434905..434907,
                     434983..434985,434992..434994)
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132919"
     misc_feature    order(434815..434817,434890..434892,434896..434907,
                     434989..434994,434998..435000,435013..435015,
                     435025..435027,435034..435036,435100..435102,
                     435106..435111,435133..435135,435139..435144,
                     435148..435150)
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132919"
     misc_feature    435307..435636
                     /gene="acoB"
                     /locus_tag="MGF_2585"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            435854..437170
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /db_xref="GeneID:12396693"
     CDS             435854..437170
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /EC_number="2.3.1.12"
                     /note="MGF_2592"
                     /codon_start=1
                     /transl_table=4
                     /product="Dihydrolipoamide acetyltransferase (E2)
                     component of pyruvate dehydrogenase complex"
                     /protein_id="YP_005880625.1"
                     /db_xref="GI:385326188"
                     /db_xref="GeneID:12396693"
                     /translation="MFEYKFTDVGEGLHEGVVAQIYVKVGDTIKEGDPMFSVETDKVT
                     TDLPAPEGGKVTAILASVGQTVHVGEVMLVLNGDGSSAPAAAPATPAFVAPTPAVTPA
                     PTPAEAAPSGGGGGASVVGEVKVSNTLFGLFGDQRAASTPTPAPTPAFAPTPVPVATP
                     LAQAVASDLNVNLHNVTPANGAKIFSSDVFASAQQSSPAASVAANDNETYKEITSIRK
                     AIAKAMTTAHEEIPATVLTFNFDVTKLVSYRKQVKDAVLASYNVKLSFLPFLLKAITK
                     AVVAHPIFNSHYDKASNRLVLKKKINLGIAVDTADGLMVPNIKSAQDKSVIELAREVN
                     NLAEKARSKKIGLADLADGTISVTNFGSIGALFGTPIIKFPEVAIIATGTVEEKLART
                     PENQIVIKQIMPITIAADHRWIDGADIGRFAKTLKEIVENLNGLLI"
     misc_feature    435854..437167
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Reviewed; Region: PRK11856"
                     /db_xref="CDD:237001"
     misc_feature    435857..436078
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    order(435947..435949,435968..435985,435995..435997)
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    435977..435979
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    436523..437167
                     /gene="aceF"
                     /locus_tag="MGF_2592"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            437175..438572
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /db_xref="GeneID:12396694"
     CDS             437175..438572
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /EC_number="1.8.1.4"
                     /note="MGF_2598"
                     /codon_start=1
                     /transl_table=4
                     /product="Dihydrolipoamide dehydrogenase (E3) component of
                     pyruvate dehydrogenase complex"
                     /protein_id="YP_005880626.1"
                     /db_xref="GI:385326189"
                     /db_xref="GeneID:12396694"
                     /translation="MVLNMYNYDLIVIGAGPGGYVAGEHAAKNGLKTLVIERGTYGGV
                     CLNVGCIPTKTLLQSSKVKHYIEKAAEYGLDLVNNQLSVNWANILKRKEAVVNKLVNG
                     VKTILKVAKADTIVGEARIVDGHTVTVNNQTFTTKDIIVATGSSPRKLPLPGFDQGRA
                     EGVIIESTKALELPQIPQSLVVIGGGVIGIEFAMLYASLGTKVTILQAVDRLCELLDQ
                     DASDFIAKRMKSLGVNVVYNAKILGYQNNAIIYEDNGTAYQLPSQYILESVGRVVNDQ
                     VFGSFNVARDDRNRIKLNDKLQTSTDSIYVIGDAAGQIMLAHYAYHQALYAVDTILNR
                     KTKKLSSLTTPGCIYTYPEIATIGYTEQQLKEKNIEYVVSKMPMAVNGKAIADGSTEG
                     FIKFMFGKKYGEILGCVLIASTASDMISEIALAMENELTVFELEQAIHPHPTIAEIIS
                     ECAKQAIYNHFNKKH"
     misc_feature    437193..438560
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /note="dihydrolipoamide dehydrogenase; Region:
                     lipoamide_DH; TIGR01350"
                     /db_xref="CDD:233368"
     misc_feature    437199..>437303
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    437733..437939
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    438204..438533
                     /gene="lpd"
                     /locus_tag="MGF_2598"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            438632..439627
                     /gene="lplA"
                     /locus_tag="MGF_2607"
                     /db_xref="GeneID:12396695"
     CDS             438632..439627
                     /gene="lplA"
                     /locus_tag="MGF_2607"
                     /EC_number="2.7.7.63"
                     /note="MGF_2607"
                     /codon_start=1
                     /transl_table=4
                     /product="Lipoate-protein ligase A"
                     /protein_id="YP_005880627.1"
                     /db_xref="GI:385326190"
                     /db_xref="GeneID:12396695"
                     /translation="MAHFYLSDSNNCYINAATEEYLLKHLNLSLPIIYIWQNADTIFI
                     GRNQNTLAQINTNETTKDKINLIRRFSGGGTVFQDLGNICYSYIDYLDEKRANAYQFF
                     AQPIIEFLNSLKINATFKGRNDLEIEGMKFSGTAQYLYQDKILHHGTLLYNTDMSKLA
                     KYLHVDKAKIQAKGIDSIKKRVTNIIDHLQEKRSVTWFIDELIKFYFKKYNLTKIVLD
                     DQAKQWIKDRANNHFKSWEWIYGSSQEYKFNNKKRFSGGELELSLNTDQGVIKQIKFN
                     GDFLSVKQIEEIEEKLQNTKFDYQSFSQVLDQFDLPLYLGTITKEELLSLLFDNK"
     misc_feature    438647..439354
                     /gene="lplA"
                     /locus_tag="MGF_2607"
                     /note="Lipoate-protein ligase A [Coenzyme metabolism];
                     Region: LplA; COG0095"
                     /db_xref="CDD:223173"
     misc_feature    438650..439597
                     /gene="lplA"
                     /locus_tag="MGF_2607"
                     /note="lipoyltransferase and lipoate-protein ligase;
                     Region: lipoyltrans; TIGR00545"
                     /db_xref="CDD:161920"
     misc_feature    439358..439612
                     /gene="lplA"
                     /locus_tag="MGF_2607"
                     /note="Bacterial lipoate protein ligase C-terminus;
                     Region: Lip_prot_lig_C; pfam10437"
                     /db_xref="CDD:255989"
     gene            439665..440663
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /db_xref="GeneID:12396696"
     CDS             439665..440663
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /EC_number="2.7.1.11"
                     /note="MGF_2611"
                     /codon_start=1
                     /transl_table=4
                     /product="6-phosphofructokinase"
                     /protein_id="YP_005880628.1"
                     /db_xref="GI:385326191"
                     /db_xref="GeneID:12396696"
                     /translation="MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEG
                     YKGLVEDQIVLANQQEVIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLV
                     VIGGDGSYQGAKLLSEMGINVIVMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIIST
                     SVSHNRVSISEVMGRHCGDLAVYAALATKADLVITSENIKTTQEIVDLAAKRMLQDHK
                     RTFTVIVCEHIYGEDGRDSLKTIAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAM
                     KFAIKAFECINEQRYGVVLGLSGDEIVAYNFQEALNKRNPSRIKLINLSNRINGGF"
     misc_feature    439683..440654
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="Phosphofructokinase, a key regulatory enzyme in
                     glycolysis, catalyzes the phosphorylation of
                     fructose-6-phosphate to fructose-1,6-biphosphate. The
                     members belong to PFK family that includes ATP- and
                     pyrophosphate (PPi)- dependent phosphofructokinases;
                     Region: PFK; cl00204"
                     /db_xref="CDD:260258"
     misc_feature    order(439707..439709,439797..439799,439890..439892,
                     439983..439991,439995..440000,440049..440051,
                     440055..440057,440061..440063,440181..440189,
                     440343..440345,440442..440444,440451..440453)
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    order(439707..439709,439797..439799,439890..439892,
                     439983..439991,439995..440000)
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    order(439737..439739,439749..439751,439836..439838,
                     439851..439853,439860..439862,440079..440081,
                     440115..440117,440127..440129,440136..440138,
                     440220..440225,440229..440231,440316..440318,
                     440478..440483,440493..440495,440514..440516,
                     440559..440561,440643..440645)
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    order(439737..439739,439749..439751,439836..439841,
                     439848..439853,440136..440138,440229..440231,
                     440235..440237,440310..440312,440316..440324)
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    order(440049..440051,440055..440057,440061..440063,
                     440160..440162,440181..440189,440343..440345,
                     440424..440426,440442..440444,440451..440453)
                     /gene="pfkA"
                     /locus_tag="MGF_2611"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            440672..442198
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /db_xref="GeneID:12396697"
     CDS             440672..442198
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /EC_number="2.7.1.40"
                     /note="MGF_2614"
                     /codon_start=1
                     /transl_table=4
                     /product="Pyruvate kinase"
                     /protein_id="YP_005880629.1"
                     /db_xref="GI:385326192"
                     /db_xref="GeneID:12396697"
                     /translation="MNKKHKDFDLNFLKKTKIVATCGPSITYKLFSLADLEDPSKQEI
                     VQKAKENLRQLFLNGVSTVRLNFSHGNQEEQAVRMILARSVANELNLPISIMLDTNGP
                     EIRLNQISETDNTVKKDQIVKIYTNREIVGNATEFSVSDSSKKYNMAKDVSLGSIVLV
                     DDGKLTLQVIEVAEDFSYIRAIAKNEHKIITKKRINLPNAKYSIPFLSQKDYNDITFG
                     LKNKVDYIAASFVNSADDIYEIKAILKQYGMEHVQVIAKVETRHAIKNLDEIIDVSDG
                     VMVARGDLGLEIPYYEVPYWEKYIIKACRFKNKRVIVATQMLDSLEKNVQPTRAEVTD
                     VFFAVERGCDATMLSGETANGMYPIIAVETMKKINKQSELLFDYKRAITHYFPMTDVC
                     KTAFGERVLDIAKKICPNREIENEDFSTHFLVHFTNNREEIFALSNAKLAASVIIVTD
                     DQNVYTGHGVDYGVFTYKVDDLTKALSNYQLVAKKAILHYSELFEIKPDNKTNFVLLK
                     "
     misc_feature    440708..442174
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /note="pyruvate kinase; Provisional; Region: PRK05826"
                     /db_xref="CDD:235619"
     misc_feature    440708..>441790
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cd00288"
                     /db_xref="CDD:238178"
     misc_feature    order(440714..440719,440945..440947,440951..440953,
                     440975..440986,441254..441259,441275..441277,
                     441284..441298,441341..441343,441365..441367,
                     441386..441388,441422..441424,441530..441532,
                     441584..441589,441599..441601,441695..441697,
                     441701..441703,441788..441790)
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238178"
     misc_feature    order(440861..440863,440867..440869,440963..440965,
                     441359..441361,441440..441442,441446..441448,
                     441518..441520,441614..441616)
                     /gene="pykF"
                     /locus_tag="MGF_2614"
                     /note="active site"
                     /db_xref="CDD:238178"
     gene            442208..442501
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /db_xref="GeneID:12396698"
     CDS             442208..442501
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /note="MGF_2625"
                     /codon_start=1
                     /transl_table=4
                     /product="10 kDa chaperonin GroES/Hsp10/Cpn10"
                     /protein_id="YP_005880630.1"
                     /db_xref="GI:385326193"
                     /db_xref="GeneID:12396698"
                     /translation="MNIKPLHDNVLVEVLAEAKTSKLGIITTIQNPDKATSTKGLVIA
                     LGDGMIYAKQQKVDYQIKVNDHVYFKEYSGTEIVVNDKTYKILSYEEIIGVIR"
     misc_feature    442211..442495
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    order(442211..442213,442217..442219,442223..442225,
                     442232..442234,442319..442324,442385..442387,
                     442415..442417,442430..442432,442436..442438,
                     442484..442492)
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    442259..442300
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(442346..442348,442379..442381)
                     /gene="groES"
                     /locus_tag="MGF_2625"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            442501..444105
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /db_xref="GeneID:12396699"
     CDS             442501..444105
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="MGF_2627"
                     /codon_start=1
                     /transl_table=4
                     /product="60 kDa chaperonin Cpn60"
                     /protein_id="YP_005880631.1"
                     /db_xref="GI:385326194"
                     /db_xref="GeneID:12396699"
                     /translation="MAKELTFEQQARAKLLEGINKLAKAVKITAGPKGRNALIEKKYG
                     APLIVNDGVTIAREIELKDPVENMGAKLIAEAAISTNDIAGDGTTTATILTHEIVNKA
                     IEAINNGTNPVNLRIGIENAAKLVSEYLTSVSKPIKSIDEITQVGAISSGSKFIGELI
                     AKAMDIVGPSGVISIDDAKSFDTTLDTTDGLEFKGGYSSPYMVTDSEKMLSELANPKI
                     LVSLNKINTVKEILPLLEASVESSAPLLIVASDIAEDVVTALAINKLRGTLNVVSVKC
                     AEFGEAQKNTLEDLAISVNTILVDSAAGIEFKDLELNKLGSAEKVIISKDKTTVINGA
                     CHKDVLAKYLNNLKAKSANLTSKYDKERITKRIANLSNGVAVIHVGGATEVAQKELKL
                     RIEDALNSTKAAVEEGIVAGGGIALMNAIEVLKQVKESNPEIALGYEIVRSSLTAPAR
                     QIIENAGQNSSKIINNIINSKQLGYGYNAETNEFVNMINNGIIDPTKVTKTALEKACS
                     VAALLITTEVAINDELKEEKPSLNHL"
     misc_feature    442501..444090
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    442507..444066
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    order(442507..442509,442519..442521,442570..442572,
                     442603..442614,442618..442620,442633..442638,
                     442642..442644,442672..442674,442678..442680,
                     442702..442704,442714..442716,442723..442725,
                     443083..443085,443179..443181,443263..443265,
                     443644..443646,443650..443652,443869..443871,
                     444034..444036,444043..444063)
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(442588..442596,442756..442758,442768..442770,
                     442945..442947,443686..443688,443737..443739,
                     443854..443856,443974..443976,443980..443982)
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(442822..442824,443794..443796,443848..443850,
                     443875..443877,443881..443886,443893..443895)
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(442918..442920,443050..443052,443071..443073,
                     443617..443619,443719..443724)
                     /gene="groEL"
                     /locus_tag="MGF_2627"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            444208..444669
                     /gene="msrB"
                     /locus_tag="MGF_2632"
                     /db_xref="GeneID:12396700"
     CDS             444208..444669
                     /gene="msrB"
                     /locus_tag="MGF_2632"
                     /EC_number="1.8.4.12"
                     /note="MGF_2632"
                     /codon_start=1
                     /transl_table=4
                     /product="Peptide methionine sulfoxide reductase B msrB"
                     /protein_id="YP_005880632.1"
                     /db_xref="GI:385326195"
                     /db_xref="GeneID:12396700"
                     /translation="MKKYKKKPIEVLKKELTPLQFDVTQNSATERPYTNEYDQNFKKG
                     IYVDITTGEPLFLSTDKYDSGCGWPAFSHPIAKSLINEVKDLSHNMVRVEVRAKNSDS
                     HLGHVFTDGPTDKGGLRYCINSASLKFIPYEDLKKAGYEEFIAILDQEAKH"
     misc_feature    444214..444642
                     /gene="msrB"
                     /locus_tag="MGF_2632"
                     /note="methionine sulfoxide reductase B; Provisional;
                     Region: PRK00222"
                     /db_xref="CDD:234692"
     misc_feature    445112..446371
                     /note="MGF_2638f; Potential transposase gene region"
     gene            445112..445357
                     /locus_tag="MGF_2638"
                     /db_xref="GeneID:12396701"
     CDS             445112..445357
                     /locus_tag="MGF_2638"
                     /note="MGF_2638"
                     /codon_start=1
                     /transl_table=4
                     /product="putative transposase domain protein"
                     /protein_id="YP_005880633.1"
                     /db_xref="GI:385326196"
                     /db_xref="GeneID:12396701"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LVDGKHVGKLELLRENADNDENVYQNGSYTRNVKWGQ"
     gene            445373..446371
                     /locus_tag="MGF_2641"
                     /db_xref="GeneID:12396702"
     CDS             445373..446371
                     /locus_tag="MGF_2641"
                     /note="MGF_2641"
                     /codon_start=1
                     /transl_table=4
                     /product="putative transposase"
                     /protein_id="YP_005880634.1"
                     /db_xref="GI:385326197"
                     /db_xref="GeneID:12396702"
                     /translation="MKRIRGENQDSQIIPKYQRIIHDKFILDVLSLASTRLSNNEIAD
                     QITSMYGFKVSPSVISNCIQTVQDEMRDWHERPLENNYPIIMIDGKVFKIKTEESGRS
                     KYVNKTLYVVVGINADGQKELIALYVSNTESATEWMNILDNLKERGLSEACIIVSDGL
                     KGLKEAIENVYPKAMHITCTVHMIRNAAKYVSHSMKSDFLRDLKNIYGADNWESAKHS
                     FEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALRTLVYTSNIVENYNSVIGSFLA
                     AKKSFNNINQLLLDLYVHFGYNPRYKKLNQKSNRVRNWYRIYEELMDVFPNLLKKN"
     misc_feature    <445379..446185
                     /locus_tag="MGF_2641"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    <445409..446350
                     /locus_tag="MGF_2641"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    446375..447613
                     /note="MGF_2649f; Potential transposase gene region"
     gene            446552..447613
                     /locus_tag="MGF_2649"
                     /db_xref="GeneID:12396703"
     CDS             446552..447613
                     /locus_tag="MGF_2649"
                     /note="MGF_2649"
                     /codon_start=1
                     /transl_table=4
                     /product="putative transposase"
                     /protein_id="YP_005880635.1"
                     /db_xref="GI:385326198"
                     /db_xref="GeneID:12396703"
                     /translation="MYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIPKYKRIIHD
                     KFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDWHERPLENN
                     YPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNTESATEWMN
                     ILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAKYVSHSMKS
                     DFLRDLKNIYGADNWESAKHSFEYLKNKWGCSNKRAVEVVERAMDNIEKLFSFSKALR
                     TLVYTSNMVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRYKKLNQKSNRVRN
                     WYRIYEELMDVFPNLLKKN"
     misc_feature    446555..447427
                     /locus_tag="MGF_2649"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     misc_feature    446558..447592
                     /locus_tag="MGF_2649"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            448220..449275
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /db_xref="GeneID:12396704"
     CDS             448220..449275
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="MGF_2661"
                     /codon_start=1
                     /transl_table=4
                     /product="RecA (Recombinase A)"
                     /protein_id="YP_005880636.1"
                     /db_xref="GI:385326199"
                     /db_xref="GeneID:12396704"
                     /translation="MFNKKNYDKIMNNIKNSKRNNDRITNITNYDVLKLLQQKFGKTN
                     IYLNEKDELKDLEAISTGSIKLDHALGTDGFIKGRIVEIYGNESCGKTTLALSTIKQA
                     IDRNMRVAFIDAEHALDLRYVKRLGIDLTKLIIARPDYGEQGFEIIKSLIKTELIDLI
                     VVDSVAALVPKVEIEGKMEDQTMGTHARMMSRGLSRIQPLLAKHNVSVIFINQLREKV
                     GIMFGNPEVTTGGKALKFYSSTRLELRRAEIIKDAANNAIGIRSKATITKNKLSTPMT
                     TTYIDFYFKSGISEVNEIIDLAIDYQIIEQSGSWFSYQKEKIAQGKANLITKLGESEE
                     LYKLIKTEVLNKLKDCQ"
     misc_feature    448292..449266
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="RecA is a  bacterial enzyme which has roles in
                     homologous recombination, DNA repair, and the induction of
                     the SOS response.  RecA couples ATP hydrolysis to DNA
                     strand exchange; Region: recA; cd00983"
                     /db_xref="CDD:238483"
     misc_feature    448310..449263
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="recombinase A; Provisional; Region: recA; PRK09354"
                     /db_xref="CDD:236476"
     misc_feature    order(448313..448318,448322..448327,448334..448336,
                     448346..448360,448565..448570,448574..448594,
                     448607..448612,448913..448915,448925..448927,
                     449072..449074,449210..449212)
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238483"
     misc_feature    448472..448495
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238483"
     misc_feature    order(448478..448498,448562..448564,448574..448576,
                     448583..448585,448706..448708,448856..448858,
                     448955..448957,448997..448999,449063..449074)
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238483"
     misc_feature    448694..448708
                     /gene="recA"
                     /locus_tag="MGF_2661"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238483"
     gene            449291..451072
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /db_xref="GeneID:12396705"
     CDS             449291..451072
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /EC_number="3.1.4.16"
                     /note="MGF_2667"
                     /codon_start=1
                     /transl_table=4
                     /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
                     /protein_id="YP_005880637.1"
                     /db_xref="GI:385326200"
                     /db_xref="GeneID:12396705"
                     /translation="MITISILLMYLIVGLLTALTVLIFVFILLKFYEFRFFKQTETYQ
                     RELEQEILKINKQEELEEKLKEHYLFQSNHKVFTKRDLREIRNFFIAVLSDKILLENK
                     KKLLSNEIIEKKKENEELKTKLDAKKVEEKITLLKEMNLTHEEAKKRLLEEYRGYVRN
                     DLDKMVKEEEKAANDKKNAITNELNKLLINAMGNVSLLTETVRMNTVKTIKYEYVDVD
                     PIKVKKVTDDFFGKIIGKEARNKEYIERLFNVEIIIKPESSRISISSFNTIKLEVAYN
                     ALNKIIEAVNDQGTHVLDESLIRKSWYGALNEFSAEAKRIGEETLKELGLYESAFIPT
                     KEISEFIGRLKFRGSNTQNVLTHSIEAAQIAESIADQLNLNKEKAKVCALLHDIGKAI
                     DKESVSSEGKWKNLKYAANDHVSAGVAIAQYYKFDIDIIDAINCHHGRKKIYEKSKNF
                     YAKITKIADFLSAARPGVRFVKDNDIERRFDTISNILTKYVDEKIISTYKILKNGYNI
                     NLMINPDITESEYSQLTLDLKKDIESDKELSKYPITITYVQNITRSETTNAIAHAKKT
                     VEIYSEDKAELVNDEELSTVEFLDEDI"
     misc_feature    449321..450964
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /note="hypothetical protein; Provisional; Region:
                     PRK12705"
                     /db_xref="CDD:237178"
     misc_feature    450344..450706
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(450359..450361,450446..450451,450665..450667)
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    450449..450451
                     /gene="cvfA"
                     /locus_tag="MGF_2667"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            451136..452620
                     /locus_tag="MGF_2678"
                     /db_xref="GeneID:12396706"
     CDS             451136..452620
                     /locus_tag="MGF_2678"
                     /note="MGF_2678"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880638.1"
                     /db_xref="GI:385326201"
                     /db_xref="GeneID:12396706"
                     /translation="MDDNKKKSRLIGDALINRTEDFLIEEDDILSDEDVKKNDENLKD
                     GSFSESFNQDSFFNNGSSEPLDSTDRILITEEYDDEDLLNVPSEIIVPDKKHSKTATE
                     YLNIEHITDLYSPNTGTFNTMSVHDVSFVKRGNEIDLEKSNSFSLSPKNQEVVPSLHK
                     VIKSAKPPVIQKADKPIQKKKVLDEIDFEKLSTVEFKLEPTNHDNSKLNNPLVLQSDS
                     VKQDQILKDHDLDFDSKTLDTLVSKPVTKNNIFESSSIIKEFNNKEILVSKPNYRDDK
                     FEKTTGIDFDLGDDDYLIKEISFQKEHEDLTETNSRIQLSLENDPAVIPRKMTVNMQN
                     IESDIDQITNGDKSNLYRYIKTGNSNLATANFLKQTVYKQEKDKSIEHRTDAADSEEL
                     KLVLNRKDNNALVFKDIDERIKKEAQPKKQVKERSYPNDYDPPIQNTNAESHIPIRNV
                     GNKQARKRKNGGINWVVFLVLVLIMIAIAAILFAIVFLLQNRSR"
     gene            452976..454505
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /db_xref="GeneID:12396707"
     CDS             452976..454505
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /EC_number="3.6.3.31"
                     /note="MGF_2687"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type spermidine/putrescine import
                     ATP-binding protein potA"
                     /protein_id="YP_005880639.1"
                     /db_xref="GI:385326202"
                     /db_xref="GeneID:12396707"
                     /translation="MEDKVFIQLRNVNKTFDDGFVAVRNLNLDINKSEFVTLLGPSGC
                     GKTTTLKLLAGFEQPTYGQIKINGIDIKDMPVHKRPFATVFQDYALFPNMTVYNNVCY
                     GLKIMRVPKENTDPKLAVEAENIKKEAEKKAAAKIKDLSRKKNDLSNKLDKIRKEYEK
                     NDWMLENDEMRFAQYQEELIKLEAQLSEAYEQSEINKLNQEIVELKTNYQKKIPIDNR
                     YDKVLKELENADGWTSYWETYPIMKKEHFENKVLTRRLTKKEIEERANNMIKLVGLTG
                     KEDKYPSELSGGMQQRVALARALVIEPETLLLDEPLSALDAKVRKQLQNELKRIHKEL
                     NITFILVTHDQEEALSLSDKIVVMSQGDIEQVGKPNAIYDSPINEWTAKFIGAANIFD
                     GKYLGDYKIELNSGDIIDTDEEYEFKKGDNVRVLIRPEDFDVVEKDQGFFNVEVIKTS
                     YKGVLWEVECLMSDKTKIKVDNIDEVKVGAIVGLKFDEMDVHMMRKEEEEEEEEEEED
                     V"
     misc_feature    452982..454463
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    452994..454133
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    453093..453116
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(453102..453107,453111..453119,453231..453233,
                     453900..453905,454002..454004)
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    453222..453233
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    453828..453857
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    453888..453905
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    453912..453923
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    453990..454010
                     /gene="potA"
                     /locus_tag="MGF_2687"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            454498..455427
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /db_xref="GeneID:12396708"
     CDS             454498..455427
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="MGF_2698; potential translational start determined
                     by homology"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type spermidine/putrescine transport system
                     permease component I"
                     /protein_id="YP_005880640.1"
                     /db_xref="GI:385326203"
                     /db_xref="GeneID:12396708"
                     /translation="MFKNFRSIKNFNAIAQTLKAPKKTWLILPYFLLLLVLFIIPLII
                     VLVNAFSPFSVQTQDGKTIPVDVSENFSIIDSFTITKMLKSFGLAIACTIICLVIAFP
                     FAYILSITKSKLFKYSVVALVTAPIWNSFLIKVIGLKSLLDLIFGEANSTFGDGWSLL
                     GLVYIFMPFMILPIYTVLISMPKNYMLASQDLGYNYFMSFFKIVIPYCKNAIISGVTL
                     VLLPSFTTAGIGRFVNNANNGELIGGYLLSLGANGLESRVAISQASALSLTLAILILV
                     FYTLFFVVPKIFGYLKKRSVLKNKIKAAVDHNE"
     misc_feature    454750..455316
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(454789..454794,454801..454806,454819..454821,
                     454849..454860,454864..454893,454903..454908,
                     454912..454914,454987..454992,454996..454998,
                     455002..455004,455011..455016,455020..455022,
                     455032..455037,455044..455046,455095..455097,
                     455137..455142,455149..455151,455170..455181,
                     455188..455193,455233..455238,455266..455271,
                     455278..455283,455287..455292,455299..455304,
                     455311..455316)
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(454867..454896,454900..454914,455170..455187)
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(454912..454914,454972..454974,455188..455190,
                     455227..455229,455236..455238,455266..455268)
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(455047..455085,455101..455106,455116..455118)
                     /gene="potB"
                     /locus_tag="MGF_2698"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            455420..456265
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /db_xref="GeneID:12396709"
     CDS             455420..456265
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="MGF_2705"
                     /codon_start=1
                     /transl_table=4
                     /product="ABC-type spermidine/putrescine transport system
                     permease component II"
                     /protein_id="YP_005880641.1"
                     /db_xref="GI:385326204"
                     /db_xref="GeneID:12396709"
                     /translation="MNKLKSILRQSYIFIILLFIYLPLLIIVVLSFNGVTERGNVNVT
                     FSQFDPNKAFETYLALAEGDFLTPLTTSLIVAFVSTPISVFIATITAFGIWRNKKVYQ
                     KLMISASNTSIVVPDIIAGLSLIIFFIAVWVSLAQPLGLFTIIISHISISTPFALVSI
                     YPRMLKMNPNLILASQDLGYNKIQTFFKITLSYLTPALIVGGLIAFATSFDDFIITSY
                     VRGSARTIATELYSIAKGIKGWAIAFGAILVFIGILTTAISVIKKAITERINYKEKVA
                     RSIHN"
     misc_feature    455420..456181
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    455624..456181
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(455672..455677,455684..455689,455702..455704,
                     455732..455743,455747..455776,455783..455788,
                     455792..455794,455867..455872,455876..455878,
                     455882..455884,455891..455896,455900..455902,
                     455912..455917,455924..455926,455975..455977,
                     456017..456022,456029..456031,456050..456061,
                     456068..456073,456107..456112,456140..456145,
                     456152..456157,456161..456166,456173..456178)
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(455750..455794,456050..456067)
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(455792..455794,455852..455854,456068..456070,
                     456101..456103,456110..456112,456140..456142)
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(455927..455965,455981..455986,455996..455998)
                     /gene="potC"
                     /locus_tag="MGF_2705"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            456243..457682
                     /locus_tag="MGF_2711"
                     /db_xref="GeneID:12396710"
     CDS             456243..457682
                     /locus_tag="MGF_2711"
                     /note="MGF_2711"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type spermidine/putrescine-binding
                     periplasmic transport protein potD"
                     /protein_id="YP_005880642.1"
                     /db_xref="GI:385326205"
                     /db_xref="GeneID:12396710"
                     /translation="MLDQFTTNVCIKMKKKPVKLIVSALALSSVLLTSCEAGANLLNR
                     NFVYANFESYMSPNLQSELRQTYNNLQFDAFASNEKALTNFKNKTYTIGTLSTYAVLD
                     LIHQGILQKLDWSKFNLSYLNDQDQEVPIHNANDALGLFTDEVQEILTSYSIDNKPVN
                     LLDYAVPYFFQSLVFAYRGAKIDSLVDHQSSWYDILSTISSEQYRDRFNNNKLGIVED
                     ERSLYSIANLIKTTKENQTVTVNPPPSQLTLSDFYNVYQEIADAGINYRNLATNNRST
                     ALLNSDSSVILNNLDSGRIDGGIMYNGDAIFSAQGGEFHAEKDDPLKPKSEDFHIVTP
                     VNTPLALDLIVVNKLNIEQFPGFLDQAYQVIKKVGLEGVNETLADFQAVLTEKPETIY
                     KNGPLENFNYVQYTSPLKKISDPENGLVAVEGWLEVADQEELSNNINSAYFIQDIKNV
                     TNFIEAPLNDIQKASLVNAFARFKNNWLR"
     misc_feature    456285..457673
                     /locus_tag="MGF_2711"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            457711..458673
                     /gene="gcp"
                     /locus_tag="MGF_2719"
                     /db_xref="GeneID:12396711"
     CDS             457711..458673
                     /gene="gcp"
                     /locus_tag="MGF_2719"
                     /EC_number="3.4.24.57"
                     /note="MGF_2719"
                     /codon_start=1
                     /transl_table=4
                     /product="O-silalo-glycoprotein endopeptidase"
                     /protein_id="YP_005880643.1"
                     /db_xref="GI:385326206"
                     /db_xref="GeneID:12396711"
                     /translation="MYYKVILGIESSCDDLSIAIAIDNKIVTTKTKSSSSVHANYGGV
                     VPEIAARYHEEILHQTLNEALTEANLTINKIDLITYTENPGLLNCLHVAKVFANTLGY
                     LLKIPAQGINHLYGHIFSPMIDDGDCLYQKSDLIYPALGIVVSGGHTAIYDVQSPSKI
                     TLLDETLDDAIGEVYDKVGRALGLQYPAGAKIDQLYNPEQAETVEFLKTNKLSAFSYS
                     GFKSAVLRYIELNKDQPDFNLVQVVSSFQKFIIDDFIDRIKNVINKADSKYQTILLGG
                     GVSANSYLRSELKELAIKTLVPKPIYSGDNAAMIINYAQFLLNE"
     misc_feature    457726..458667
                     /gene="gcp"
                     /locus_tag="MGF_2719"
                     /note="tRNA threonylcarbamoyl adenosine modification
                     protein YgjD; Region: T6A_YgjD; TIGR03723"
                     /db_xref="CDD:234330"
     misc_feature    457726..>458046
                     /gene="gcp"
                     /locus_tag="MGF_2719"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214; cl17884"
                     /db_xref="CDD:248438"
     gene            458782..459906
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /db_xref="GeneID:12396712"
     CDS             458782..459906
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /EC_number="2.5.1.6"
                     /note="MGF_2728"
                     /codon_start=1
                     /transl_table=4
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="YP_005880644.1"
                     /db_xref="GI:385326207"
                     /db_xref="GeneID:12396712"
                     /translation="MYTAESVGSAHPDKLCDQIADAILDACLKQDQNSRVACEVMACN
                     HLIIIAGEISTKASVDYVGTAWKVVNQFGYDRSDFTIIANINQQSSEIAQSVDQKNHK
                     IGAGDQGITVGYACDETKNQMPLAVMMAHDLVRLAKELIDNKTFNHAKYDMKAQVSLN
                     YLDNNQVELKTILMSIQHKENVDLSVFKLFVKKFIMDEVATKYGFNKNYEALINPSGL
                     FVSGGPTADTGLTGRKLLVDSFGIYAHHGGGAYSGKDYTKVDRSGAYYARWIAKHIVK
                     AKLASQCEVIISWAIGLTKPLDIVVNCFNTNTVELELINQIVKKIFNHDLATIIELLK
                     LKTTNYSGLAVYGHFGKSEKQYRFEDTIYLDQILKISNKE"
     misc_feature    458782..459900
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    458782..459048
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    459082..459438
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    459445..459840
                     /gene="metK"
                     /locus_tag="MGF_2728"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            complement(459988..461106)
                     /locus_tag="MGF_2742"
                     /db_xref="GeneID:12396713"
     CDS             complement(459988..461106)
                     /locus_tag="MGF_2742"
                     /note="MGF_2742"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880645.1"
                     /db_xref="GI:385326208"
                     /db_xref="GeneID:12396713"
                     /translation="MNPFSQWIKLVEKLHYDSGYVFCNIVDLVLINHLNFHKVSKPLT
                     FFLIYDQNLNELSIFDNSNGFSYYELISLSNFFQGDNEQYHGYFRSLIKLAYQFEFFN
                     QSASEEVGYYFKLHNVNQQLIFNDLKQIQRGEYYNRTSFANGTLIRLKQLKAPYELND
                     FKVIANQLKLIYQKFINTDKLKFYILYKKGQEFFDLSTNPLNKLTTLDKAKSLAKTKK
                     PALANLKNGKKRILIQETIDWNNQKIYLSGYLGVLSEPDFKKAGLYLYNNNKLVKGIN
                     VYDRYRPELLFGSASHLNNAYLYGELELANLSTGLSSDIFEYDARFEKQLLKILLSIV
                     GDQRYNQTDKISGLIKALAKQKKANRPPTKVTNKEKMK"
     gene            461177..461950
                     /locus_tag="MGF_2743"
                     /db_xref="GeneID:12396714"
     CDS             461177..461950
                     /locus_tag="MGF_2743"
                     /note="MGF_2743"
                     /codon_start=1
                     /transl_table=4
                     /product="putative transcriptional regulator"
                     /protein_id="YP_005880646.1"
                     /db_xref="GI:385326209"
                     /db_xref="GeneID:12396714"
                     /translation="MYNTVLLYIYLKIQSKQWLPNKRIPSERQLSIKFGLSRNLIRKV
                     FSVLCNYNVLDNNTKPGYFVHKDYKTGFFINFLDFDKVISFDHTELYRTPFSQYDINM
                     FKELSNKDDFLSSAFPKVNQVVYYDQNKEVVFVNQVLLNRKLLVYHNTNAMSFQDFVM
                     FAENGQPIVRHKQISMVCTDMGPVKEFIKPNKLNNNYLVTYSVYFNIENEILAISKIF
                     HLLPDSKINSLDVKLEFHDYQSRIESKIKNDTLVKRGRK"
     misc_feature    461180..461368
                     /locus_tag="MGF_2743"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(461180..461182,461249..461251,461255..461260,
                     461282..461296,461300..461305,461312..461314,
                     461342..461347,461351..461362)
                     /locus_tag="MGF_2743"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     gene            462032..462973
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /db_xref="GeneID:12396715"
     CDS             462032..462973
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /EC_number="1.8.1.9"
                     /note="MGF_2748"
                     /codon_start=1
                     /transl_table=4
                     /product="thioredoxin reductase"
                     /protein_id="YP_005880647.1"
                     /db_xref="GI:385326210"
                     /db_xref="GeneID:12396715"
                     /translation="MSYRVDGKNDLFDLVIVGSGPAGISAAIYAKRANINVCVVEGSA
                     PGGKILKTGFIDNYPGYTSIKGPDLAVNMFNQLNSLSVPIFYSQVNAIEKQENYFFTY
                     LDSKTLLSKAVIVATGTLERKLGLANEAKFETKGISYCAICDGPLYKNRDVAVVGGGN
                     AAVEESLYLSGICNKVYLVHRRDEFRADSYAVAKLKEKKNVHFLLSHVVDSYLGDQTL
                     KGIKVKNLKNNELTDLTIDCLFPYIGAVPNTSFLKPFNILNEEGYVLVDANQKTSVDG
                     LYAAGDCVHKKIRQISTAISDGTIAALAVNDFFKLHK"
     misc_feature    462068..462955
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /note="thioredoxin-disulfide reductase; Region:
                     TRX_reduct; TIGR01292"
                     /db_xref="CDD:233345"
     misc_feature    462074..462580
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    462488..462706
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    <462821..462946
                     /gene="trxB_2"
                     /locus_tag="MGF_2748"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            462974..463861
                     /locus_tag="MGF_2751"
                     /db_xref="GeneID:12396716"
     CDS             462974..463861
                     /locus_tag="MGF_2751"
                     /note="MGF_2751"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880648.1"
                     /db_xref="GI:385326211"
                     /db_xref="GeneID:12396716"
                     /translation="MVTFSQEVKSEICDQSLDEKNAKYFLNGMIFDKLQLVDESYQSY
                     TSQHPKTIIFLKKILILLNQELKNEIRHTHRINQLKKHEYELIFKLDKSLLSLDNHEL
                     EEQQLRAFFGGLFLSVGNLSKFSAKDHHLELIFNYEHKALLTHDFLVQNGFSNFKLIT
                     RKNKYILYLKKTQEIIDFLAYINAFSCMFRYEDSNLKRKLVRKVQLSNNLDIVNLTKT
                     IDLNNKLIPMIEMIVNDQAFHEQKPLFKSYCYTKLNHPSASLAELSELLTKQGYQITR
                     TGLGHYNKKVRTLYKQLKN"
     misc_feature    462980..463858
                     /locus_tag="MGF_2751"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1481"
                     /db_xref="CDD:224398"
     misc_feature    463292..463552
                     /locus_tag="MGF_2751"
                     /note="LAGLIDADG-like domain; Region: LAGLIDADG_3;
                     cl08299"
                     /db_xref="CDD:263576"
     misc_feature    463595..463846
                     /locus_tag="MGF_2751"
                     /note="WhiA C-terminal HTH domain; Region: HTH_WhiA;
                     pfam02650"
                     /db_xref="CDD:251447"
     gene            463906..464139
                     /locus_tag="MGF_2757"
                     /db_xref="GeneID:12396717"
     CDS             463906..464139
                     /locus_tag="MGF_2757"
                     /note="MGF_2757"
                     /codon_start=1
                     /transl_table=4
                     /product="putative preprotein translocase subunit SecG"
                     /protein_id="YP_005880649.1"
                     /db_xref="GI:385326212"
                     /db_xref="GeneID:12396717"
                     /translation="MNPTEITFFVLAIIALIVGLGLSNSGTTGGLASLSGQDLEIFKK
                     TKDRGIIKILQIVMFILMLLFLILGLIYHFVIK"
     gene            464170..466344
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /db_xref="GeneID:12396718"
     CDS             464170..466344
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /EC_number="3.1.-.-"
                     /note="MGF_2759"
                     /codon_start=1
                     /transl_table=4
                     /product="exoribonuclease R (VacB)"
                     /protein_id="YP_005880650.1"
                     /db_xref="GI:385326213"
                     /db_xref="GeneID:12396718"
                     /translation="MNNNNNRRKIINDILQIVRLEDKKPIPPGIIVKKLDNRYTKTAI
                     YKEIDKMLANGELKKLANNKVVLGYQNSAPDLSKIMVGRLAIGTNGNGFIKLENEELS
                     KYYVHNSNLNNALNNDLVEFAPLSVQNDWYKHDLTDACILKVLERARTRYVGTYEDTG
                     DEYLVLPDDPKLIYKVVLDRHYLELKEHDRILFEIIEIKQGVIRAALVKKIGSKEDLG
                     IDIDAIAYNHLIEPTFSQEIINEAKSLKYELDDHQKAIRKDLRDLSFVTIDPASALDL
                     DDSIYLKKIDDDSYNLKVAIADVCHYVKFDGPMDRGARTKATSVYLANKVIPMLPEEL
                     SNDLCSLNPGVDKFVIVGDLMIDGTGKIMSHEFYPAIINSHKRFSYEEVNEYFSATND
                     LKDVDPSIRQMLDEARVLAKILRRMKIKRGYLQFDIDETSIELDDRFEPINIVKKPHG
                     EAQEMIEDFMVAANEAVCLFASKYNLDFIYRVHSKPAVHKLNSFANWARALEFEIFGD
                     LNSIKSTDIQKWLTNNADHKQIKLINKLLLRSMNKAYYSVENTRHFSLASKHYTHFTS
                     PIRRYADNIVHRILWMFIFDPQAYTDLQRNELKSHLVEWCDLINKQELVAVDCERDVN
                     AFLYVKYMSNFLGNWYHNVTINAITNFGMFVELDNGIEGLVRLNNINGDYYRYDPNTD
                     SLIGRNNHKKYQIGDTVDVKLLSADKRLKRIDFAIHEDNKCK"
     misc_feature    464209..466320
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /note="ribonuclease R; Region: RNase_R; TIGR02063"
                     /db_xref="CDD:233703"
     misc_feature    464938..465921
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /note="RNB domain; Region: RNB; pfam00773"
                     /db_xref="CDD:250123"
     misc_feature    466099..466320
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /note="S1_RNase_R: RNase R C-terminal S1 domain. RNase R
                     is a processive 3' to 5' exoribonuclease, which is a
                     homolog of RNase II. RNase R degrades RNA with secondary
                     structure having a 3' overhang of at least 7 nucleotides.
                     RNase R and PNPase...; Region: S1_RNase_R; cd04471"
                     /db_xref="CDD:239917"
     misc_feature    order(466105..466107,466129..466131,466159..466161,
                     466165..466167)
                     /gene="rnr"
                     /locus_tag="MGF_2759"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239917"
     gene            466335..466967
                     /locus_tag="MGF_2771"
                     /db_xref="GeneID:12396719"
     CDS             466335..466967
                     /locus_tag="MGF_2771"
                     /note="MGF_2771"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880651.1"
                     /db_xref="GI:385326214"
                     /db_xref="GeneID:12396719"
                     /translation="MQITTLLILILIAFLVIMVVSIIQFIIFIFTKKAEKESFFNFFK
                     KIFKKKQDDRSLNDFYDNLSSSLLKLSADKIGGIIAIEREDNLDYYINVGYKITGEFS
                     PEFIISVFYNKNSPLHDGGIIIRDMKMVSISSYFPMTQQLLDVSYGARHRAGVGLSEK
                     SDAIVFIVSETNGKISVAQKGRIKRLSNNPERLFDEIIKLLDDKKPRDFF"
     misc_feature    466554..466883
                     /locus_tag="MGF_2771"
                     /note="DisA bacterial checkpoint controller
                     nucleotide-binding; Region: DisA_N; pfam02457"
                     /db_xref="CDD:251307"
     misc_feature    <466866..>466964
                     /locus_tag="MGF_2771"
                     /note="Probable RNA and SrmB- binding site of polymerase
                     A; Region: PolyA_pol_RNAbd; pfam12627"
                     /db_xref="CDD:257174"
     gene            467149..468897
                     /gene="vlhA.2.02"
                     /locus_tag="MGF_2779"
                     /db_xref="GeneID:12396720"
     CDS             467149..468897
                     /gene="vlhA.2.02"
                     /locus_tag="MGF_2779"
                     /note="MGF_2779"
                     /codon_start=1
                     /transl_table=4
                     /product="VlhA.2.02 variable lipoprotein family protein"
                     /protein_id="YP_005880652.1"
                     /db_xref="GI:385326215"
                     /db_xref="GeneID:12396720"
                     /translation="MKKKSLFRLASLIGVGSFAAVVPASCNSLIRSVNHTEIAPDDSN
                     RSNNNQDGDQGGLSNQSETRNQLSGLLNKQANQVGMYNEYKQIQAGLKGAYEAAKAVV
                     DNANSTSEQLNEAKTALENTISQAERNKDSFNQNNAQLIGVYNQIKEQISGINESLDR
                     AAYSGIRAKLRPIYQAAITVLQNGLQTAGGSVVSLPYATKVSSDLSAALAKLPEWKQN
                     ADEFANFKKFALSPTNFVGPIANDNAEQPSDFGFSAFSVAVDASYKYAKNKIKVGDAT
                     NASEEVQALTDVGWIYNFGREANDGYEFSFDYYGPSKAWLYFPFKLSKQTNQTVSFYY
                     SLNDRNAAIERKVIINAPTVDSIQVAKVPLDDLKFGRNKVAFSSIEGTTTPMVGNFYI
                     SSSDHNDDSVYNSIFGNTLSEDKNSVTVNFLDGYGLADNSKTLLRQVSATLGDSTESN
                     AYYVIGWLGGNAGNNTMSATSINSTSRTYTFYVNAPKAGAYNVSGYTNSNQARDLVFK
                     TAPLPKNPQQTYTLTLSSLPASGENKVVKFDTATMGNDKTLTLQKGLNRIVVMGGTSF
                     EGNAPNLGNVTFTFKG"
     misc_feature    <467317..467661
                     /gene="vlhA.2.02"
                     /locus_tag="MGF_2779"
                     /note="The Bin/Amphiphysin/Rvs (BAR) domain, a
                     dimerization module that binds membranes and detects
                     membrane curvature; Region: BAR; cl12013"
                     /db_xref="CDD:264507"
     misc_feature    467764..468891
                     /gene="vlhA.2.02"
                     /locus_tag="MGF_2779"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            469171..470988
                     /gene="vlhA.2.01"
                     /locus_tag="MGF_2791"
                     /db_xref="GeneID:12396721"
     CDS             469171..470988
                     /gene="vlhA.2.01"
                     /locus_tag="MGF_2791"
                     /note="MGF_2791"
                     /codon_start=1
                     /transl_table=4
                     /product="VlhA.2.01 variable lipoprotein family protein"
                     /protein_id="YP_005880653.1"
                     /db_xref="GI:385326216"
                     /db_xref="GeneID:12396721"
                     /translation="MKKNLLKVISFLSVGSILGLTLSSCTSLSNSVEQKPVDPINQQP
                     KLNTGEQTKRQLNNLIDSQPTTLQMYEDYKNIRNTLNAAYQAARIISDSNNSTPEQLE
                     AAIVALRNAIGKASADRTAFNNQHSELVMAYNRLKAQMQSASLIISSLNQEKYSAIKT
                     NITPIYDQAKAIIANTLQSFGQKEKATITNIENITQSISKLVSEKQNADEYAVFKRFD
                     VKKENLIGTFANTGPVPEEYSFVAYSANINNYSYNFATPKIWVYPHEITDRSEGAIVS
                     NSSELTNVGWIYSLTPAAQAEAKYEFNFEYYGPSSVAYLYFPYKSINSLSNRIVFDYL
                     LNHQESSDNSFRDHLIIPTPSVDSISVIRLPITNLRYGMNTITLRSHKNLPFPVVGNM
                     YLSSAPDGDTNALDKIYNDIFGNIVSPDNPKEITVDVLKAYGLASSSTIVMRQFNPNV
                     NNKPLTLDGVAQNKPYYLIGNLGGSDQTGTASPNALRTFSPNTRTYTFYVNAPQAGSY
                     NISGIYNSSQSLGLEFKTTSGTGQTQSTSVVKITNLSSGSTDADNTLKTFDTAKTETT
                     VEDTTRVLTLTKGLNKILVTGLGSNAAPNLGNITFRLAS"
     misc_feature    469753..470985
                     /gene="vlhA.2.01"
                     /locus_tag="MGF_2791"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            complement(471170..472285)
                     /locus_tag="MGF_2806"
                     /db_xref="GeneID:12396722"
     CDS             complement(471170..472285)
                     /locus_tag="MGF_2806"
                     /note="MGF_2806"
                     /codon_start=1
                     /transl_table=4
                     /product="permease"
                     /protein_id="YP_005880654.1"
                     /db_xref="GI:385326217"
                     /db_xref="GeneID:12396722"
                     /translation="MSKKLISKKFEQVPLALSGLTLGTIGLGFSWETLLTHFKQVSSA
                     PETYKTATLVVLFMLMLLSLLYGTIVAIKYLTNRKQFVGYLRTPNQAGWVFPFFMALG
                     LFGNFLGYLNVNYLQTNFAFSVVINIIVVFSTLCHVLCLIYFVNVVLAKHDLEKDEVY
                     TSWNMPLVGLGISCSFYPNLGLNNEYYLAYYQILWLICSFLFVGSYFLFGYKQLFKGF
                     ANKEDIGTMSIMASPPNLLLVGFLRIFNPAVHQHALLINFSVTAFNILTYSFIFFSMV
                     GLFIYFLTAIKLLVMRNFGFAWTAFTFSGTINARALLDTVNQGGLPNSIYYILLGISV
                     GLISVVSLIVSLLTIKTFLNFKTWFEHETKVHTSGMV"
     misc_feature    complement(471233..472255)
                     /locus_tag="MGF_2806"
                     /note="Voltage-dependent anion channel; Region: SLAC1;
                     pfam03595"
                     /db_xref="CDD:252046"
     misc_feature    complement(471377..471379)
                     /locus_tag="MGF_2806"
                     /note="gating phenylalanine in ion channel; other site"
                     /db_xref="CDD:187756"
     gene            472434..473771
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /db_xref="GeneID:12396723"
     CDS             472434..473771
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /EC_number="3.4.11.1"
                     /note="MGF_2807"
                     /codon_start=1
                     /transl_table=4
                     /product="cytosol aminopeptidase"
                     /protein_id="YP_005880655.1"
                     /db_xref="GI:385326218"
                     /db_xref="GeneID:12396723"
                     /translation="MEKNTKKTHSSSKKMLLVQAKVNNKLKDYTFKTEGGVVLFEFTS
                     HYDGVKLYNKLVEMFCSQKEKVEVDLDSFLTATNADSETVALLVACAIEYASVIPFTR
                     KTKPDTKPSFLVKVSKEFKAAYDAAKNVAEAVTLSRRLQDTPSDVLYPETFVDLFKAE
                     FKDLKNVKLSVYNKEQIKKMGLNLLYGVNKGSERECRFLVVEYLNNKSSKEKFAYVGK
                     GITYDSGGMNLKTGPHMRNMKYDMSGAAIVVSTVLALAKNKVKTNVVALAPLTENLIG
                     PKAQRPDDIVVAYNKKTVEIDNTDAEGRLVLADAISYAALDVKATRIFDVATLTGLMS
                     YILGKTYTGVFSTSDKFWKEFEDNAFSAGEAVWRLPMHNDYLEMLKTPLADIANSTNA
                     PYAGSSRAAMFLNEFAEGVDLIHCDIAGTGSDKAGLGLSPMIRALYLQAKNQK"
     misc_feature    472611..473747
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /note="Cytosol aminopeptidase family, N-terminal and
                     catalytic domains.  Family M17 contains zinc- and
                     manganese-dependent exopeptidases ( EC  3.4.11.1),
                     including leucine aminopeptidase. They catalyze removal of
                     amino acids from the N-terminus of a protein and...;
                     Region: Peptidase_M17; cd00433"
                     /db_xref="CDD:238247"
     misc_feature    order(472857..472859,472863..472871,473004..473006,
                     473010..473012,473097..473099,473115..473117,
                     473130..473132,473139..473141,473148..473153,
                     473247..473249,473253..473264,473268..473270,
                     473274..473288,473304..473306,473310..473312,
                     473322..473324,473433..473447,473454..473456,
                     473532..473537,473541..473543,473556..473558,
                     473562..473567,473580..473582,473586..473588,
                     473616..473621,473625..473627,473727..473729)
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /note="interface (dimer of trimers) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238247"
     misc_feature    order(473085..473087,473100..473102,473121..473123,
                     473154..473156,473331..473333,473337..473339,
                     473343..473345,473418..473420)
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /note="Substrate-binding/catalytic site; other site"
                     /db_xref="CDD:238247"
     misc_feature    order(473085..473087,473100..473102,473154..473156,
                     473331..473333,473337..473339)
                     /gene="pepA"
                     /locus_tag="MGF_2807"
                     /note="Zn-binding sites [ion binding]; other site"
                     /db_xref="CDD:238247"
     gene            473797..474078
                     /locus_tag="MGF_2818"
                     /db_xref="GeneID:12396724"
     CDS             473797..474078
                     /locus_tag="MGF_2818"
                     /note="MGF_2818"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880656.1"
                     /db_xref="GI:385326219"
                     /db_xref="GeneID:12396724"
                     /translation="MLKEHNEPTNQPDLEQVKQSHTKLIQEQEQLDLDKKTDKHNEVY
                     EYQSNSKLDKLSKWTKILIIIFLILLCVGSIVGAVFAVMTARSMGLQQS"
     gene            474181..474783
                     /locus_tag="MGF_2823"
                     /db_xref="GeneID:12396725"
     CDS             474181..474783
                     /locus_tag="MGF_2823"
                     /note="MGF_2823; potential translational start determined
                     by homology and predicted by Prodigal"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880657.1"
                     /db_xref="GI:385326220"
                     /db_xref="GeneID:12396725"
                     /translation="MEYFKSSIYKKTNPLILTLFLLFFVVGYYVVIWVLFGEFNLLKL
                     NWLLGEGVIITQDQMINQRNFNPLILAFIFPPLGVYFLLILLIRYLFKQTAYDLIPLT
                     YSFSIALITIILSGLFKFANQGLIIFGRIVLVIVVFSISFFLLVFIINKLMIRLDLKH
                     DYVYLNDLLEENQNKNKRTEQIKQLKKPESSTITISDKNK"
     gene            474788..476092
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /db_xref="GeneID:12396726"
     CDS             474788..476092
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="MGF_2827"
                     /codon_start=1
                     /transl_table=4
                     /product="GTPase ObgE"
                     /protein_id="YP_005880658.1"
                     /db_xref="GI:385326221"
                     /db_xref="GeneID:12396726"
                     /translation="MQFIDRCQIKLIAGNGGDGIIAWRREAHYDKGGPAGGSGGKGGN
                     IILVADHNQSTLLSLKYSKIIRASNGDNGKPDLSSGQNGMDKYVKVPIGTTVYDEQTN
                     EVIVDLIRDKQEYIICHGGKGGRGNAAFKSSTLRAPNLYELGDEGEEKAVRLELKYLA
                     NVGIVGYPNAGKSTLISKLSNAKPKIANYQFTTLVPILGIVENNDKRLVFADIPGLIE
                     NASEGYGLGHDFLRHVERCEVLIHLISMNPLDHDDVIDAYEKIMTELRKYSQLLVNKK
                     MLVVANKMDVEGASENFNKLRSYLAKKGIDISSISAINGDVNNLVDRVFDLYQKTLST
                     TTETNPFSIPMVAEKVYYYDGEKTIDDDPLDVIKDGENRWIVSSKKLTYWFKKIPQTT
                     LDNITRLGQKIKSLGVEDQLKKMGAKPNDVIVICDYEYLIDE"
     misc_feature    474794..476089
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="GTPase CgtA; Reviewed; Region: obgE; PRK12297"
                     /db_xref="CDD:237046"
     misc_feature    474794..475261
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
                     /db_xref="CDD:110047"
     misc_feature    475265..475771
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="Obg GTPase; Region: Obg; cd01898"
                     /db_xref="CDD:206685"
     misc_feature    475283..475306
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="G1 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(475292..475309,475631..475636,475640..475642,
                     475718..475723)
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206685"
     misc_feature    475328..475375
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206685"
     misc_feature    475364..475366
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="G2 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    475421..475432
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="G3 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(475430..475453,475460..475498)
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206685"
     misc_feature    475631..475642
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="G4 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    475718..475726
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="G5 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    475877..476077
                     /gene="obg"
                     /locus_tag="MGF_2827"
                     /note="Obg family GTPase CgtA, C-terminal extension;
                     Region: Obg_CgtA_exten; TIGR03595"
                     /db_xref="CDD:188347"
     gene            complement(476095..476379)
                     /locus_tag="MGF_2844"
                     /db_xref="GeneID:12396727"
     CDS             complement(476095..476379)
                     /locus_tag="MGF_2844"
                     /note="MGF_2844"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880659.1"
                     /db_xref="GI:385326222"
                     /db_xref="GeneID:12396727"
                     /translation="MNFKLTHHSRIRAVQRLVLQEKNELFIDHEINEILRDLIPYYVD
                     KKNFAYFEIPKKFLIDRHKRTYAIVDQNNGIITSITPISPSKFIKIYSMN"
     gene            complement(476369..477013)
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /db_xref="GeneID:12396728"
     CDS             complement(476369..477013)
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /EC_number="2.7.1.48"
                     /note="MGF_2848"
                     /codon_start=1
                     /transl_table=4
                     /product="uridine kinase"
                     /protein_id="YP_005880660.1"
                     /db_xref="GI:385326223"
                     /db_xref="GeneID:12396728"
                     /translation="MKNVQPMIIAISGGSGSGKTTITQSIIAKIKSDTNLKVATVCLD
                     NYYKPFSDLSLEARKKLNYDDPNSFDFDQVYYDLLALSNNQTIKMPIYDYKNYTRSDQ
                     FTEINPSDVILYEGILSLYDPRILDLSKFKLFIDTPSDERLARRIERDSLERARDIKQ
                     VLNQWRSQVRVMHRKYVQKQKEDANLILPWYTLNHEGMSIIQNAIIKIAQGNEF"
     misc_feature    complement(476390..476992)
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /note="Uridine monophosphate kinase (UMPK, EC 2.7.1.48),
                     also known as uridine kinase or uridine-cytidine kinase
                     (UCK), catalyzes the reversible phosphoryl transfer from
                     ATP to uridine or cytidine to yield UMP or CMP. In the
                     primidine nucleotide-salvage pathway; Region: UMPK;
                     cd02023"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(476435..476437,476579..476581,
                     476954..476956))
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(476576..476578,476816..476818,
                     476882..476884))
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /note="Sugar specificity; other site"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(476552..476554,476723..476725,
                     476732..476734,476738..476740,476825..476827,
                     476873..476875))
                     /gene="udk"
                     /locus_tag="MGF_2848"
                     /note="Pyrimidine base specificity; other site"
                     /db_xref="CDD:238981"
     gene            477088..478458
                     /gene="arcA_2"
                     /locus_tag="MGF_2849"
                     /db_xref="GeneID:12396729"
     CDS             477088..478458
                     /gene="arcA_2"
                     /locus_tag="MGF_2849"
                     /EC_number="3.5.3.6"
                     /note="MGF_2849"
                     /codon_start=1
                     /transl_table=4
                     /product="arginine deiminase"
                     /protein_id="YP_005880661.1"
                     /db_xref="GI:385326224"
                     /db_xref="GeneID:12396729"
                     /translation="MAVKKKKTEKRSVKVSSKKVDNQPIVKVNNQLTTLDDRDARLKA
                     KTPLDFNVYNNSSKLKEVIIYRPGIEVERIIKKNQTTFSSAKHLERIQREHDILSAIL
                     QKNDVKVQYLNLMLASALDQLDEELKEEFIQRFILEAKITSLSAFNTLFNYFRSFDSN
                     LEMINAMIAGVRKNEVPSLIINRFSDLVLDDSAYYIQPLSDFLLQAKYFGTIGNGVVI
                     YQHNDDYFNRHTLFYEYLVKFHPRFNNVNLYFSRNTDKCYLSSDDILLINQDTLLISV
                     SEHTNILGIEVFARNLYNDPKNKILRIIVCARKNSDQFIRMNQLISSLDYDKFIVHQK
                     ALGEMVFFELLDSEQKDIDGLNKLEFKEIEISFESLIELIIKRRPKFILSGGGDELNG
                     ISEANNSALEVLMIKPTEVIVYDRNKITNQLLLQQGLVVHYLPSAELARTNAGVNNLV
                     IPLIRE"
     misc_feature    477235..478455
                     /gene="arcA_2"
                     /locus_tag="MGF_2849"
                     /note="Arginine deiminase [Amino acid transport and
                     metabolism]; Region: ArcA; COG2235"
                     /db_xref="CDD:225144"
     gene            478506..478582
                     /gene="trnR"
                     /locus_tag="MGF_tRNA24"
                     /db_xref="GeneID:12396730"
     tRNA            478506..478582
                     /gene="trnR"
                     /locus_tag="MGF_tRNA24"
                     /product="tRNA-Arg"
                     /note="MGF_tRNA24; anticodon:TCT; Arg-tRNA; predicted with
                     tRNAscan-SE v., cove score=85.67"
                     /db_xref="GeneID:12396730"
     gene            complement(479222..480481)
                     /locus_tag="MGF_2868"
                     /db_xref="GeneID:12396731"
     CDS             complement(479222..480481)
                     /locus_tag="MGF_2868"
                     /note="MGF_2868"
                     /codon_start=1
                     /transl_table=4
                     /product="transposase"
                     /protein_id="YP_005880662.1"
                     /db_xref="GI:385326225"
                     /db_xref="GeneID:12396731"
                     /translation="MNSKDEQMKQIQKLIVEFVKQFGPSSGKQLLNITDYIAKPVLQA
                     LIDGEHVGKLELLRENADNDENVYQNGSYTRNVKWGQEEIPIKMKRIRGENQDSQIIP
                     KYQRIIHDKFILDVLSLASTRLSNNEIADQITSIYGFKVSPSVISNCIQTVQDEMRDW
                     HERPLENNYPIIMIDGKVFKIKTEEGGRSKYVNKTLYVVVGINADGQKELIALYVSNT
                     ESATEWMNILDNLKERGLSETCIIVSDGLKGLKEAIENVYPKAMHITCTVHMIRNAAK
                     YVSHSMKSDFLRDLKNIYGADNWESAKHSFEYLKNKWGGSNKRAVEVVERAMDNIEKL
                     FSFSKALRTLVYTSNIVENYNSVIGSFLAAKKSFNNINQLLLDLYVHFGYNPRHKTLN
                     QKSNRVRNWYRIYEELMDVFPNLLNKN"
     misc_feature    complement(479243..480373)
                     /locus_tag="MGF_2868"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    complement(479408..480373)
                     /locus_tag="MGF_2868"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            481411..481572
                     /gene="rpmG"
                     /locus_tag="MGF_2871"
                     /db_xref="GeneID:12396732"
     CDS             481411..481572
                     /gene="rpmG"
                     /locus_tag="MGF_2871"
                     /note="MGF_2871"
                     /codon_start=1
                     /transl_table=4
                     /product="50S ribosomal protein L33"
                     /protein_id="YP_005880663.1"
                     /db_xref="GI:385326226"
                     /db_xref="GeneID:12396732"
                     /translation="MAQKRGTRLGCNDCNEINYITRKNAKKNPEKLSLNKYCSRCRGT
                     TVHKEVKRK"
     misc_feature    481420..481563
                     /gene="rpmG"
                     /locus_tag="MGF_2871"
                     /note="50S ribosomal protein L33; Validated; Region: rpmG;
                     PRK00504"
                     /db_xref="CDD:234783"
     gene            481572..482633
                     /locus_tag="MGF_2872"
                     /db_xref="GeneID:12396733"
     CDS             481572..482633
                     /locus_tag="MGF_2872"
                     /note="MGF_2872"
                     /codon_start=1
                     /transl_table=4
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="YP_005880664.1"
                     /db_xref="GI:385326227"
                     /db_xref="GeneID:12396733"
                     /translation="MLTADFQFKHDIIKKALKQHKADAILFTSDQNRLWFTEFKSSAG
                     FLLVTNTKSVLVIDSRYYLAASKEIKRTEVVLLAANVLSDVAKKLKIKHLLIEGDYLT
                     YQYQSMLDRISEKQTPIETQSLRAIKTPSEIKKLKKVIDITKEVGNKLTSMMKVDMTE
                     IQLAKLVTFALIDAGGEKNSFDPIVASGPNGAKPHHHPTNRKFKDGDFVTVDFGTIYQ
                     GFCSDITRTWVLNKPKNQRLINAYKLVDKSNQAGIKAAKADMTGQEVDAVCRKIIDET
                     EFKGLFVHSTGHGVGIDIHEKPNVATSYTDKLGVDSIVTIEPGIYIPNVGGIRIEDMI
                     QVKADKSIWLSKDIKRMKL"
     misc_feature    481596..481952
                     /locus_tag="MGF_2872"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:250531"
     misc_feature    481608..482618
                     /locus_tag="MGF_2872"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    481968..482594
                     /locus_tag="MGF_2872"
                     /note="Similar to Prolidase and Aminopeptidase P. The
                     members of this subfamily presumably catalyse hydrolysis
                     of Xaa-Pro dipeptides and/or release of any N-terminal
                     amino acid, including proline, that is linked with
                     proline; Region: APP-like; cd01092"
                     /db_xref="CDD:238525"
     misc_feature    order(482154..482156,482205..482207,482238..482240,
                     482433..482435,482520..482522,482562..482564)
                     /locus_tag="MGF_2872"
                     /note="active site"
                     /db_xref="CDD:238525"
     gene            482639..483379
                     /locus_tag="MGF_2882"
                     /db_xref="GeneID:12396734"
     CDS             482639..483379
                     /locus_tag="MGF_2882"
                     /note="MGF_2882"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880665.1"
                     /db_xref="GI:385326228"
                     /db_xref="GeneID:12396734"
                     /translation="MFKFQHEDIDSKISELKKELEKNRKPSKLLTVLKVDLWRFISAA
                     IFSLSLLILSLLIFIGVVYPKQFALNSQNMIGLFWIYQPNNDPLIGTFMRTSASLQLT
                     SYGISCIIFFLINMVSVLFYYGYSFKDQNYLNLDKKARTIFNYKAFSYSFFILVSGII
                     FILGLVVTDFTQFPDSSRPIAINQSFGYAFKITKELSPNVYQLGIDLFGYLLIILFFI
                     FNLASIYSFFKLNTKLTDHLFKKKQPKH"
     gene            483379..483810
                     /gene="smpB"
                     /locus_tag="MGF_2884"
                     /db_xref="GeneID:12396735"
     CDS             483379..483810
                     /gene="smpB"
                     /locus_tag="MGF_2884"
                     /note="MGF_2884"
                     /codon_start=1
                     /transl_table=4
                     /product="SsrA-binding protein"
                     /protein_id="YP_005880666.1"
                     /db_xref="GI:385326229"
                     /db_xref="GeneID:12396735"
                     /translation="MRLLVNNKKAKYNYELLDKYEAGISLSGNEVKSLALHHGKLDDS
                     YVIIRKNEAYLLNLLIPKYKFDTSKVLNETRTRKLLLHKSEILKIDLIKKQQSLVIIP
                     YQIYFVNNKIKISIYLARPKKRYDKRQTIKEREINKKIRKY"
     misc_feature    483397..483744
                     /gene="smpB"
                     /locus_tag="MGF_2884"
                     /note="Small protein B (SmpB) is a component of the
                     trans-translation system in prokaryotes for releasing
                     stalled ribosome from damaged messenger RNAs; Region:
                     SmpB; cd09294"
                     /db_xref="CDD:187755"
     misc_feature    order(483439..483456,483460..483465,483469..483474,
                     483481..483483,483532..483534,483616..483633,
                     483715..483717)
                     /gene="smpB"
                     /locus_tag="MGF_2884"
                     /note="SmpB-tmRNA interface; other site"
                     /db_xref="CDD:187755"
     gene            483818..485458
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /db_xref="GeneID:12396736"
     CDS             483818..485458
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /EC_number="3.4.22.40"
                     /note="MGF_2888"
                     /codon_start=1
                     /transl_table=4
                     /product="Aminopeptidase C"
                     /protein_id="YP_005880667.1"
                     /db_xref="GI:385326230"
                     /db_xref="GeneID:12396736"
                     /translation="MNKNNKIDFQKYLKKNLSYQKKREYLLTRNALVANDINLMAANV
                     FNPDKNLTEFLVDAHKPTLTITNQDMSGRCWIFAGLNPLRRQTAEKLKVSNFVFSQTY
                     MDFWDKYERANVFLNKMIEKADVELDDRDLKAELQSAGQDGGWYGFFENLVNKYGLVP
                     QEVMPDSFSGHNTFILNELLQVVLIKATKEIRAHKKASQKQKEVVDATLKKVLEMLVL
                     AYGPVPSKFDWQYVADAKKDEENKELANKEEKSTKTKVEQKTPVQQEEEKAKQELKEI
                     KTEFSFIKQITPLEFSKQYVNYQEYDFLDLWTIGNTTDYKINQRYSLKDSNNLFEASD
                     FNFLNVDRNILKFFALANLVAKQTMWFACDVNHYRNNKTGGFDNQQFDYQSLFNIDFS
                     VDRNKQVRSHFISSNHAMTLSGVDFDEAKSLLKQKELVKKYKNLKKFDQYQFVLDLSQ
                     TLVFKKWKIENSWGEKVGNKGFYYMNDQWFNDYLIDIVISTKAADDFFKNPKFIDPDL
                     IGLVKQLKTKEILKAGLSTEPILIDGYDPLGANNKGVK"
     misc_feature    483836..485434
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /note="Peptidase C1B subfamily (MEROPS database
                     nomenclature); composed of eukaryotic bleomycin hydrolases
                     (BH) and bacterial aminopeptidases C (pepC). The proteins
                     of this subfamily contain a large insert relative to the
                     C1A peptidase (papain) subfamily. BH is...; Region:
                     Peptidase_C1B; cd00585"
                     /db_xref="CDD:238328"
     misc_feature    order(483947..483949,483968..483970,483974..483982,
                     484313..484318,484499..484501,484505..484507,
                     484511..484513,484529..484531,485183..485185)
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238328"
     misc_feature    order(484019..484021,484037..484039,485039..485041,
                     485198..485200)
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /note="active site"
                     /db_xref="CDD:238328"
     misc_feature    485432..485434
                     /gene="pepC_2"
                     /locus_tag="MGF_2888"
                     /note="G bulge; other site"
                     /db_xref="CDD:238328"
     gene            485458..486948
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /db_xref="GeneID:12396737"
     CDS             485458..486948
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /EC_number="3.4.22.40"
                     /note="MGF_2898"
                     /codon_start=1
                     /transl_table=4
                     /product="Aminopeptidase C"
                     /protein_id="YP_005880668.1"
                     /db_xref="GI:385326231"
                     /db_xref="GeneID:12396737"
                     /translation="MAKLELKDSLKQLNNLSRSKFNKQLTNILNTVGVKGVSYNGYNF
                     SKNSLSFNLDLSAQPITNQFQTGRCWIFAGLNLLRYHLAKELNIDDLELSQSYLAFWD
                     KFEKANYFLETVTELRDKKVSDRTLSFILKNGVADGGQWTMLTNLIKKYGLVPKSVMP
                     DIANSASTNQLNYLINLKLNQAASKILDNKDKPVAELNKIKTKALDEVFYLLSSIYGE
                     LPTKFDFSYTKVIKKDSADRSESHFNYLPKKVVEINFTPLTFYQKYFKQLVEKQGFVS
                     VINAPANNKPFNQTFSVKYLNNVIESDEILHYNLEQGLFSYLTIKQLFNQQPVWFGCE
                     VKNIYLNEAKTFWDDQSFDYQTLFNVDLSLSKNDQLDYWLSSINHAMLITGVDLDLEK
                     FNQIDQEFNQLVKANKIKQAYQYLVEQMDQLTIHKWKIENSWGQDLGHAGYFVISDSY
                     FKRYTYQVAINQQLFNQLVEQLKLTKEFDKPVRLLEPWDPIGTLAK"
     misc_feature    485467..486933
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /note="Peptidase C1B subfamily (MEROPS database
                     nomenclature); composed of eukaryotic bleomycin hydrolases
                     (BH) and bacterial aminopeptidases C (pepC). The proteins
                     of this subfamily contain a large insert relative to the
                     C1A peptidase (papain) subfamily. BH is...; Region:
                     Peptidase_C1B; cd00585"
                     /db_xref="CDD:238328"
     misc_feature    order(485578..485580,485599..485601,485605..485613,
                     485938..485943,486127..486129,486133..486135,
                     486139..486141,486157..486159,486736..486738)
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238328"
     misc_feature    order(485644..485646,485662..485664,486592..486594,
                     486751..486753)
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /note="active site"
                     /db_xref="CDD:238328"
     misc_feature    486931..486933
                     /gene="pepC_1"
                     /locus_tag="MGF_2898"
                     /note="G bulge; other site"
                     /db_xref="CDD:238328"
     gene            486918..487379
                     /locus_tag="MGF_2902"
                     /db_xref="GeneID:12396738"
     CDS             486918..487379
                     /locus_tag="MGF_2902"
                     /note="MGF_2902"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880669.1"
                     /db_xref="GI:385326232"
                     /db_xref="GeneID:12396738"
                     /translation="MRSNWNPSQIIDEINNSIKNKKQPMILILVGFIIGMIVFGIGIY
                     LSLSNPNSNNANRSLETNDMNTKAENSTQSTASRLFLIAFIIIFGFVMIGFFIHIKER
                     NNFQDLAYKTNLFLKKHNYFFKITKYQIKQLIIAKALIKEIQESSINQDVK"
     gene            487369..487779
                     /locus_tag="MGF_2908"
                     /db_xref="GeneID:12396739"
     CDS             487369..487779
                     /locus_tag="MGF_2908"
                     /note="MGF_2908"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880670.1"
                     /db_xref="GI:385326233"
                     /db_xref="GeneID:12396739"
                     /translation="MLNKLAEKLKMTKKELKERLNVSDDVSESQLLLALGFDKMAAYN
                     DLLNYTKNLVGSEQIDLNNLNANSFDGIFEKIQEDIVNDPRASDDVRKMAEFMEKLQS
                     MYGDAIFNHDYGAESDDEKEDKPISVPKDKKNLS"
     gene            complement(487849..488214)
                     /locus_tag="MGF_2915"
                     /db_xref="GeneID:12396740"
     CDS             complement(487849..488214)
                     /locus_tag="MGF_2915"
                     /note="MGF_2915"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880671.1"
                     /db_xref="GI:385326234"
                     /db_xref="GeneID:12396740"
                     /translation="MVFNKSKDLLISKPKIYINLKSNMISNLVGVDLSSVILQIEHNW
                     ATERKRKRNLIKKIDRLIDESWNNDLKKVISKFKRLHRWNRDEIDYFTSRIINLQNNE
                     LNLFLNNRRPDQLLARKKK"
     gene            488495..489334
                     /locus_tag="MGF_2916"
                     /db_xref="GeneID:12396741"
     CDS             488495..489334
                     /locus_tag="MGF_2916"
                     /note="MGF_2916"
                     /codon_start=1
                     /transl_table=4
                     /product="aldo/keto reductase family protein"
                     /protein_id="YP_005880672.1"
                     /db_xref="GI:385326235"
                     /db_xref="GeneID:12396741"
                     /translation="MKYNLLANNYKMPSIGFGTYKLEDGKQTVEAVKTALEVGYRHLD
                     CAEIYENQRSVSQGIKLSGVDRKEIFITSKIWNDDKGYESTKKAFDKILKDLDLEYLD
                     LLLIHWPIGKGFKDNWQEVNAQTWKAMEEFYLEGKIKAIGLSNFLVHHIEALKKSAKI
                     LPMVNQLEFHPGYLQPEIVEYCQKNNIVVQAWSPFSQSKVLENKTLVKLAKKYEVTVA
                     QLILNWIIQKDIVPLPKSKTPERIRSNFDVFNFGINQADLKVIDQLNDCGGLGLHPDQ
                     VDF"
     misc_feature    488516..489286
                     /locus_tag="MGF_2916"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(488546..488554,488624..488626,488639..488641,
                     488714..488716,488813..488818,488924..488929,
                     488990..488992,489068..489085,489146..489148,
                     489191..489202,489215..489217,489224..489229)
                     /locus_tag="MGF_2916"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(488624..488626,488639..488641,488714..488716,
                     488813..488815)
                     /locus_tag="MGF_2916"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            489428..490003
                     /locus_tag="MGF_2919"
                     /db_xref="GeneID:12396742"
     CDS             489428..490003
                     /locus_tag="MGF_2919"
                     /note="MGF_2919"
                     /codon_start=1
                     /transl_table=4
                     /product="putative phospholipid-binding protein"
                     /protein_id="YP_005880673.1"
                     /db_xref="GI:385326236"
                     /db_xref="GeneID:12396742"
                     /translation="MRWIINMDMKKKHAIWSNCFTETGDGVYLKSETVKLNNNRYESL
                     DLTWDKIEGAKSYAVVMVDYEASRVIGQSFIHWVVANVKENKLAYAANINDKSIVQGL
                     NSTAQGQTESSRGVIIECVPGAFKNTAEAASDYLPPLPPDDTHLYTLRVYGLDVDHVD
                     LPKHFSLTDLNQKIIHHTVGEHELHFWYKPN"
     misc_feature    489470..489991
                     /locus_tag="MGF_2919"
                     /note="PhosphatidylEthanolamine-Binding Protein (PEBP)
                     domain present in bacteria and archaea; Region:
                     PEBP_bact_arch; cd00865"
                     /db_xref="CDD:176643"
     misc_feature    order(489614..489619,489647..489649,489653..489655,
                     489836..489850,489860..489862,489866..489868)
                     /locus_tag="MGF_2919"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176643"
     gene            490025..490693
                     /locus_tag="MGF_2922"
                     /db_xref="GeneID:12396743"
     CDS             490025..490693
                     /locus_tag="MGF_2922"
                     /note="MGF_2922"
                     /codon_start=1
                     /transl_table=4
                     /product="putative phospholipid-binding protein"
                     /protein_id="YP_005880674.1"
                     /db_xref="GI:385326237"
                     /db_xref="GeneID:12396743"
                     /translation="MKKYSIGNNSKIWSKMVGADGYLALHGGGHKNENQTPFPSFSLD
                     LSWEKIPNAKSYAVIVEDFDAAAVIGFSFIHWIAVNIKTNHIAENQSYLDHKKWLESK
                     QSAYGENLLWQGHNSSVNKTLVANNKTNKDLGGILPEAFTSTSLENSLMYFGCYPPNA
                     DHTYTVVVYGLDVDASELTYHKNHRTQKYHLNKPYYVGDFMQAIHKHVVDKHTLHFKY
                     KKVG"
     misc_feature    490055..490678
                     /locus_tag="MGF_2922"
                     /note="PhosphatidylEthanolamine-Binding Protein (PEBP)
                     domain present in bacteria and archaea; Region:
                     PEBP_bact_arch; cd00865"
                     /db_xref="CDD:176643"
     misc_feature    order(490208..490213,490241..490243,490247..490249,
                     490484..490498,490502..490504,490508..490510,
                     490514..490516)
                     /locus_tag="MGF_2922"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176643"
     gene            complement(490783..493200)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /db_xref="GeneID:12396744"
     CDS             complement(490783..493200)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /EC_number="6.1.1.4"
                     /note="MGF_2941"
                     /codon_start=1
                     /transl_table=4
                     /product="leucyl-tRNA synthetase"
                     /protein_id="YP_005880675.1"
                     /db_xref="GI:385326238"
                     /db_xref="GeneID:12396744"
                     /translation="MYNHNLIEKKWAKIWNDQKVYSFQIDKNKPKYYILDMFPYPSGK
                     GLHVGHVKAYMATDVISRWKNALGFNVLHPIGWDAFGLPAEQYAIQTNNHPAKFTQEN
                     INNFRTQLKRLGFNYDYRLEVDTTNKNYFKWTQWIFKKLYEHDLAYQADIEVNWCEQL
                     GTVLANEEVLTDENGNKISERGSYPVIKKKMRQWVLKITAFADQLIDGLENLNWPNSI
                     KAMQVNWINKSVGASIKFEIDQLDNQTIEVFSSRVDTLFGASFIALSFDHPLVKQKLI
                     TDKNDAIERFIKDNSIDQTVRYQGINTNYFAIHPITKKKIPIYLADYILSDYGTGAVM
                     GVPAHDDRDYQFAKQYDLEIIPVIKADQYPYLLDGEHINSDFNNGLNNEQAIQKTIAY
                     LKKHNLGDQKINYKLRDWIFSRQRYWGEPFPVLFDEEDNIYLLKDSELPLELPQLSDF
                     SPNKDGLPPLANADDQWLHPIIDQKKYRREINTMPQWAGSCWYYLAYLLKLTDLNQAD
                     GDQNYLALNSEKAKELFDHFMPVDLYVGGQEHAVLHLLYARFWYKFLHQIKIVSSTEP
                     FSKLINQGMILGEDNTKMSKSKGNIINPDDLVLSHGADTIRTYVMFMGPLNASLAWNS
                     NALNGTRKFLERVYNLFDRVEINDSINQNLNYDYHNFLKKINKHLENFEFNLVVSEMM
                     IFINACYKQTQINKEMITNFLIVLSFFAPYLAEELNSKLNNPTLLYKMRLAQWDEAYL
                     VKNTTTISCSINGKFKLVHEFDLDSDEQEVANYFLNQDLIKRNLEDKKLVKTIFVKNK
                     VINFIIK"
     misc_feature    complement(490786..493200)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="leucyl-tRNA synthetase; Validated; Region: leuS;
                     PRK00390"
                     /db_xref="CDD:234743"
     misc_feature    complement(491335..493110)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="catalytic core domain of leucyl-tRNA synthetases;
                     Region: LeuRS_core; cd00812"
                     /db_xref="CDD:173906"
     misc_feature    complement(order(491443..491445,491449..491451,
                     491473..491475,491482..491484,491569..491571,
                     491581..491586,491590..491592,492943..492945,
                     492967..492969,493051..493053,493060..493062,
                     493081..493083,493087..493089))
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="active site"
                     /db_xref="CDD:173906"
     misc_feature    complement(493051..493062)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    complement(492022..492531)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    complement(491440..491454)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    complement(491038..491337)
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     misc_feature    complement(order(491134..491136,491143..491145,
                     491164..491166,491272..491277,491281..491286,
                     491296..491298,491305..491307,491314..491316,
                     491326..491328))
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153408"
     misc_feature    complement(order(491272..491277,491284..491289,
                     491296..491298))
                     /gene="leuS"
                     /locus_tag="MGF_2941"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153408"
     gene            complement(493214..493885)
                     /gene="trkA"
                     /locus_tag="MGF_2943"
                     /db_xref="GeneID:12396745"
     CDS             complement(493214..493885)
                     /gene="trkA"
                     /locus_tag="MGF_2943"
                     /note="MGF_2943"
                     /codon_start=1
                     /transl_table=4
                     /product="Trk system potassium uptake proteinTrkA"
                     /protein_id="YP_005880676.1"
                     /db_xref="GI:385326239"
                     /db_xref="GeneID:12396745"
                     /translation="MKRADYCVIGIGRFGIKVASKLKELGCKVLILDKSKEKINLEAK
                     RFDFAIHLDATDIMSLADVAINNFDTVILSVSSIEESIIIATNLRELKVKNIIARAKN
                     DVHKRVLKTFGVKEAVIPEEIVGENVAMRVVHSINSEIISIDEDISLVRVYASSKDVV
                     NKKLIDVDVRNKTKANIISITREYKSIYPITADTVILKNDLITAACNNADISKFLKLM
                     SSDNS"
     misc_feature    complement(493229..493873)
                     /gene="trkA"
                     /locus_tag="MGF_2943"
                     /note="K+ transport systems, NAD-binding component
                     [Inorganic ion transport and metabolism]; Region: TrkA;
                     COG0569"
                     /db_xref="CDD:223643"
     misc_feature    complement(493526..493870)
                     /gene="trkA"
                     /locus_tag="MGF_2943"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(493244..493447)
                     /gene="trkA"
                     /locus_tag="MGF_2943"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            494044..495108
                     /locus_tag="MGF_2944"
                     /db_xref="GeneID:12396746"
     CDS             494044..495108
                     /locus_tag="MGF_2944"
                     /note="MGF_2944"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880677.1"
                     /db_xref="GI:385326240"
                     /db_xref="GeneID:12396746"
                     /translation="MSIMFKRSANKKLRKNKIKRPVKVTLGLMGFLVVATTVPLANIP
                     LFGLYNNKKNNDKTRERIIKEKLFLAASKEKLLKDNPHAIIPNIVQDFHSPNQADGDK
                     NNEIVKTVYDNYPFKLVERLKSANIDPSDWVKFNEYIYKNMDRDLFLDLLNSFMSFYP
                     IYHQSWLSELTQRILLYRYQKIGITSGFFKQYHAEIDGAYYVDKNNFAFSSVTKADLI
                     AVHKLFGNVPTEVGITIRTAANSQLIIDPNTKGLVLTNASIFLESSAGALSPYTSIYV
                     KTNSPDTKNYYDYLGEEIPDQKAQEIPSFPITSILYSIINDKQLEKNDIKHYFYQWVI
                     PVLINFFNASYYEQQNVIKK"
     gene            495116..495811
                     /locus_tag="MGF_2949"
                     /db_xref="GeneID:12396747"
     CDS             495116..495811
                     /locus_tag="MGF_2949"
                     /note="MGF_2949"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880678.1"
                     /db_xref="GI:385326241"
                     /db_xref="GeneID:12396747"
                     /translation="MVPQRLIPINNRLPKIWQDNKLAKIKKADHLNWQQFFYYSANKQ
                     AKHYLRQTIFNWFFIVPIFGFFYFILKSEKANEKLVYNKLKNQYLKSGGDNWLIFLIL
                     YLSVWLSFVIWVTLLIFLTDNFYPISDLNNQKRFISLFMVGNFGILLFFSYLYLIYWY
                     SFVYRKFKQVVFNTIRITRNQINPFSFFSFVLQCDDGVYLKELEKKQKKLKKKNVSNN
                     QRLLAARSKSYFS"
     misc_feature    496378..496596
                     /note="MGF_2954f; Potential variably expressed lipoprotein
                     and hemagglutinin (VlhA) family protein gene region"
     gene            496378..496542
                     /locus_tag="MGF_2954"
                     /db_xref="GeneID:12396748"
     CDS             496378..496542
                     /locus_tag="MGF_2954"
                     /note="MGF_2954"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880679.1"
                     /db_xref="GI:385326242"
                     /db_xref="GeneID:12396748"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTTPVNPTWRKQHSYLFSW
                     IYWWSWSTNS"
     gene            496421..496681
                     /locus_tag="MGF_2955"
                     /db_xref="GeneID:12396749"
     CDS             496421..496681
                     /locus_tag="MGF_2955"
                     /note="MGF_2955"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880680.1"
                     /db_xref="GI:385326243"
                     /db_xref="GeneID:12396749"
                     /translation="MVHLWCWQLLVVLHRSTQPEENNTPTYLVGYIGGRGPRTVNSAG
                     KITTPWAIKENRTLTIYVNAPTQGEYYISGSYLTNINRELKF"
     misc_feature    <496466..496678
                     /locus_tag="MGF_2955"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            497266..499338
                     /locus_tag="MGF_2959"
                     /db_xref="GeneID:12396750"
     CDS             497266..499338
                     /locus_tag="MGF_2959"
                     /note="MGF_2959"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880681.1"
                     /db_xref="GI:385326244"
                     /db_xref="GeneID:12396750"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPTPNPEP
                     KPDPMPNPPSGGMMGDNPNPGNDGGMDNSAQQLSAAKTALTNLLNGQTEKVGLYNDYA
                     KIKDQLVKAYTAAKEISDKSDATLQEVNNAKTTLEIAITTAASSKTSFDEKNSELIKA
                     YNALKQTITSEEMQLNLLTGANFETIKNHISNLYKQGKDIITATLDPTTGDGPQTMVV
                     NQTNEAIVNATSKLDDWKNNASTLNTSFLKETLKSASLSAATGDGAATVQQQPGNYSF
                     VAYASDITSPNWNFAQRKVWVSTSGGRTSPFSNSDANNSPELTDVSWIYNLSGANSKY
                     TLKFNYYGPSTGHLYFPYKLVKSNDAQNVGLQYTLNNKPAQRIEFAPAQSTSPGETAP
                     ASSPQSPRAAATETDASGSAEGSQSQTDMNSSSMNKTPTVSDINVASVTLSDLNFGAN
                     TIEFSVPMGDSMVAPMIGNMYITSNPLNVNQIYDDIFGNSVSNSTDQNKAVTVDLLKG
                     YSLATNWSIYLARFTDLMEGTQTTPNPVYLVGYIGGSQGRNFTQGLQVQNNLRFPLAQ
                     NDKRTFTIYVNAPEAGEYYISGKYLTSQQRGLKLSADNINNSVTFTVQGKNNWTTLGS
                     FDTSKTNATDGNDATVSGNKMTLTLNKGLNKIILSGVNNGDTPFIGNLTFRLKSNEAS
                     SSSAESSK"
     misc_feature    497470..>497778
                     /locus_tag="MGF_2959"
                     /note="Protein of unknown function (DUF3347); Region:
                     DUF3347; pfam11827"
                     /db_xref="CDD:256651"
     misc_feature    497941..499296
                     /locus_tag="MGF_2959"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            499669..501783
                     /locus_tag="MGF_2969"
                     /db_xref="GeneID:12396751"
     CDS             499669..501783
                     /locus_tag="MGF_2969"
                     /note="MGF_2969"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880682.1"
                     /db_xref="GI:385326245"
                     /db_xref="GeneID:12396751"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPTPKPDSMP
                     NPGGGMNGGNTNRGNGGGMMGDNPNPGNTTPEQQLAAARKTLTDLLGTENTNVAFYAD
                     YAKIQSTLNAAYMTAKTASENTSASLENLRSASTTLQAAIDKAASDKRAFDSANQSLV
                     TAYNNLKTTLQFKTTSLEGLSENKYSGIKNHLSKLFDRGSAITAKTLDPTSGERPTLE
                     KVNEANNSIKMAISPESLKKWKDNADKFNEFEKNPLSKEKLSTGTDSAHNQEQPANWS
                     FAGYSVDLTTGSDSNSQNLPNWNFAQRKVWTSEGQQHGRTVLVSSPVSSTDVSWIYSL
                     AGEGTKYTLTFEYYGPDTAFLYFPYKLVKQADSSSVALQYSLNKTSSKLINFEPAETV
                     STNADESENEVATTSTTEARSSSENLVADEVATSNNEMNPTPTVSDINIAKVTLSGLT
                     FGENTIEFSVPTNKVAPMIGNMYLTSNSESQVKIYNEIFGNTSNSSDNSTSVTVDLLT
                     GYSLVSGWSTYIGEFKQLMDTQMGTSSDSQTRKPSYLVGFIGGPGRRQLVNNSNKIQS
                     PQTNSQQRTFTIYVNAPQDGDYYISGSYLTSDDRQLMFSSPTGDSTSSMNNVTLTIQG
                     KRNWTTLGAFNTQTNTNIVNPSNLSSGMQNAHTTLHLKKGLNKVVISGVSNGDTPYIG
                     NLTFTLNNNPSSNTESETRQST"
     misc_feature    500350..501738
                     /locus_tag="MGF_2969"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            502116..504104
                     /locus_tag="MGF_2981"
                     /db_xref="GeneID:12396752"
     CDS             502116..504104
                     /locus_tag="MGF_2981"
                     /note="MGF_2981"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880683.1"
                     /db_xref="GI:385326246"
                     /db_xref="GeneID:12396752"
                     /translation="MKRKNILKFVSLFGIGSFVMLAAASCTSPVNPTPNPTPELKPDP
                     MSNPPSGGMNGGDTNPGNSGVMDNAAQQLAAARTVLTSLLASKNANVEMYSDYAKIKN
                     DLTAAYTTAKSTSDNTSATLEQVKSATSTLQTAIDKAASDKKTFDDQNSDLVTAYKEL
                     KSNVNNKDNNLMGLDSTQYSAIRTNLEGYYTIGADVVKKTLVPVEGMSPTKDEVTNLN
                     TNINASVADLGSRKENADMYFNKFGKKVLVKSGVVAPKPMMADGVQTEHETPTDNSQP
                     VNYSFVGYSVDVNGSGSTPPAWDYVKRTVFNINGTLVDNQNGDANTAPLTDVSWIYSL
                     NNGSKYTVSFTYYGPTTAYLYFPYKLVQSSQSTTVGLNYSLNGTEAKSVEFTAPTTMN
                     PEGMDSPAGTTQTTPETTTPATPATTANLTPTVDTINVAKAILTNLKFGENTIDFTVP
                     AQKVAPMFGNFYITASEDNLDKVNDDIFGNKTTKSEESTSVTVDLLKGYNLAADYSTF
                     FAKYTGATLDGGNAGDYYLVGFIGSSNKRTYSGTGTQMNTPLNIGDKRNLIIYVNAPT
                     EGKYYVSGIYTTGSNRALRLWANNENNFMQFVNLNSGPGNTLKTFTTNMTDSRITNQT
                     ISLNKGLNKVVIRSTNGGKAPNLGNLTFTLMKPATPSA"
     misc_feature    502779..504080
                     /locus_tag="MGF_2981"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            504383..506416
                     /locus_tag="MGF_2992"
                     /db_xref="GeneID:12396753"
     CDS             504383..506416
                     /locus_tag="MGF_2992"
                     /note="MGF_2992"
                     /codon_start=1
                     /transl_table=4
                     /product="variably expressed lipoprotein and hemagglutinin
                     (VlhA) family protein"
                     /protein_id="YP_005880684.1"
                     /db_xref="GI:385326247"
                     /db_xref="GeneID:12396753"
                     /translation="MKRKNILKFVSLLGIGSFVMLAAASCTSATTPTPNPPSNGGGMM
                     GDNPNPRNTTPKQQLAAARKTLTDLLGTENTNVALYADYANIQSTLSTAYMTAKTASE
                     NTSATLENLRSASTTLQAAIDKAASDKRAFDSANQSLVAAYNNLKTTLQSKTNSLEGL
                     SENKYSGIKNHVSKLFDTGSAITARTLDPTSGERPTLEKVNEVNNGIKMAISSESLNK
                     WKTNADKFNDFEKNPLSKEKLESTNDTAHNQEQPANWSFAGYSVDITTGSASNSQNLP
                     NWNFAQRKVWTSEAARNNGSIDLVANPTVPTDVSWIYSLTGQGTKYTLEFTYYGPSTA
                     FLYFPYKLVKSADSSSVALQYNLNNTSPKLINFQPVRTEPANADSTTNETTTTGSSEN
                     RSSSETLVADEATSTNKEMNPTPTVDSINIAKVTLSNLNFGTNTIEFSVPTTAKEGTS
                     KVAPMIGNMYITSNDQNQRKIYNEIFGNTSNDSTSVTVDLLKGYSLASGWSTYVGEFK
                     RLTGANQTASDSQTSAPNYLVGFIAGHGQRTVDNVSNIIRNPSIEGQQRTLAIYINAP
                     VEGEYYISGSYLTNVARDLKFSTGETNNVLTITGLRQDNWQTLGKFDTSTMMTGITVT
                     QGSNNKTTLKLKSGLNKVVITGGTANNTDTPDIGNLTFKLMTTTSNSETNTPA"
     misc_feature    505004..506377
                     /locus_tag="MGF_2992"
                     /note="Mycoplasma haemagglutinin; Region: Myco_haema;
                     pfam05692"
                     /db_xref="CDD:253326"
     gene            complement(506663..506736)
                     /gene="trnT"
                     /locus_tag="MGF_tRNA25"
                     /db_xref="GeneID:12396754"
     tRNA            complement(506663..506736)
                     /gene="trnT"
                     /locus_tag="MGF_tRNA25"
                     /product="tRNA-Thr"
                     /note="MGF_tRNA25; anticodon:GGT; Thr-tRNA; predicted with
                     tRNAscan-SE v., cove score=60.62"
                     /db_xref="GeneID:12396754"
     gene            507099..509510
                     /locus_tag="MGF_3006"
                     /db_xref="GeneID:12396755"
     CDS             507099..509510
                     /locus_tag="MGF_3006"
                     /note="MGF_3006"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880685.1"
                     /db_xref="GI:385326248"
                     /db_xref="GeneID:12396755"
                     /translation="MITSMKIKKIAKSILLGSLATLPLIGVSAGLMVNKTSTNTNYNL
                     TNQAVSLVEDSTNQDQPLKKWSNDLSKYKKIDNDQTLFLGKNYIRLNNTVVFDHEQRK
                     LVQQTTVGVYDSLNNELQAITLTNDYKHLYFVDDNDPTKGFVATDDLHNAIYYPIDLN
                     TGLIDQEHGWAITTQRPASNVAAYLSTQGDEQNDLVKNARIVSFSVDNNQLKAVVYNQ
                     NGSFVVQNIPATNKAFNNIQIVKSYSINGSLFTGINFYDVDNQLVGSQIINIKNGTYV
                     PGGASFDINRQINAMVYDADHNAIYVQYYFSNDNTTRMWYYSVSPIDQFGQIGTIPNE
                     NYFSDLIFIKGEGIVGVNKQKSNLTLYPFEKDRILTAPTFKDVASSYTNDFFKQNNDK
                     ITNLVFDQKDQTFSVFYNSNIYTDGLVKFSLADFKNKSDLYTDVVPIYVDEVKLIDEM
                     NTSAYQSSFASVYAKTQSQHDFDQFLVIPDFYKKLENQSKINQDNYWNLSYQADENLG
                     TINLQIKLLYEQKQLNLLDRNLFGFEQVNASDIKVNYNKNSPLLDKTPTEIKRLLDDS
                     RTVLETKQAIFDLYGFDPKYKQLPYDVQIKDSSVLGNITFIFKFLTIKDNSIQANFKK
                     DDLVTQASIVSPTVSNNFLTFDQNFKLSIERWFIPVVIIALVVLILIASALIYFLLIQ
                     RKYPRLLATIKQKLTAQAIDQPQEELAKTVSINDHILMSAKAEQVQVEKVNLLNRFKK
                     FRLKKTNQEVSFSVQELTNQNELKDQPTSPTTKKQATIDLFHQKMAKDELSWNPEIKL
                     TKQIQ"
     gene            509540..509839
                     /gene="himA"
                     /locus_tag="MGF_3015"
                     /gene_synonym="hup_2"
                     /db_xref="GeneID:12396756"
     CDS             509540..509839
                     /gene="himA"
                     /locus_tag="MGF_3015"
                     /gene_synonym="hup_2"
                     /note="MGF_3015"
                     /codon_start=1
                     /transl_table=4
                     /product="histone-like DNA-binding superfamily protein
                     HimA/HU/Integration host factor"
                     /protein_id="YP_005880686.1"
                     /db_xref="GI:385326249"
                     /db_xref="GeneID:12396756"
                     /translation="MAKIKSLSAAEYLKEMADETNLKVQDIRLVVTSLQKVLAKELAT
                     TGEVRLFDIGKFKLVATKPRTGINPKTKQKIQIPAGKKIKLTVSKILTDAVDSHK"
     misc_feature    509567..509818
                     /gene="himA"
                     /locus_tag="MGF_3015"
                     /gene_synonym="hup_2"
                     /note="DNA sequence specific (IHF) and non-specific (HU)
                     domains; Region: HU_IHF; cd00591"
                     /db_xref="CDD:259852"
     misc_feature    order(509567..509569,509678..509680,509684..509692,
                     509696..509698,509702..509704,509714..509716,
                     509720..509725,509777..509779,509783..509785,
                     509789..509806,509813..509815)
                     /gene="himA"
                     /locus_tag="MGF_3015"
                     /gene_synonym="hup_2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259852"
     misc_feature    order(509573..509575,509582..509587,509594..509596,
                     509621..509632,509636..509644,509648..509656,
                     509660..509665,509675..509689,509696..509698,
                     509780..509788,509792..509794,509798..509800,
                     509810..509815)
                     /gene="himA"
                     /locus_tag="MGF_3015"
                     /gene_synonym="hup_2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259852"
     gene            509913..511814
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /db_xref="GeneID:12396757"
     CDS             509913..511814
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /EC_number="5.99.1.-"
                     /note="MGF_3016; potential translational start determined
                     by homology and predicted by Prodigal"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="YP_005880687.1"
                     /db_xref="GI:385326250"
                     /db_xref="GeneID:12396757"
                     /translation="MVSNYNEKHIKVLKGLEPVRKRPGMYIGSTDTRGLHHLVWELFD
                     NAVDEALNGSANKIEVVHKKDGSIIVTDNGRGIPVGKNLATNLSTVDTVYTVLHAGGK
                     FDDQAYKVSGGLHGVGASVVNALSRKLIVNVHRDGGMYESIYQDGGKIIQPLKKMGSS
                     TKHGTIIQFWPDPTIFKNIQFNPYMIKERLHESSFLFKGLKIVFVDENNPELSQTFIA
                     KDGILEYLKYVNENKKTISKIIPFKGDYEKIVVDGCFQYTDNESELIISFANSVKTSE
                     GGSHENGFKQAMLETINDYSKKYKLINNKDKGFDWSDLKEGLSVVLSVQVPEKIIAYE
                     GQTKNKLFTQEVKVAVAKILTQQLFYFLEENQADAKQLIERFKLIKEAKEAAKKAKEN
                     TKKLKSAKSERVLYGKLTPAQQKNPLQNEIFLVEGDSAGGTAKSGRDKRFQAILPLRG
                     KVVNVEKSRLQDLLKNEEILSIISCLGCGIGNNFNIKNLKYHKIIIMTDADTDGAHIQ
                     VLLLTFFYRYMKELIEQGKVYIALAPLYKISAKNSNKSAFAWDDYQLDELRVKYGSYE
                     VQRYKGLGEMNSEQLWTTTMDPSKRQLIQVSIQNAVQAERKVSILMGDDASIRKNWIN
                     ENVDFSIEE"
     misc_feature    509913..511811
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="DNA topoisomerase IV subunit B; Reviewed; Region:
                     PRK05559"
                     /db_xref="CDD:235501"
     misc_feature    510015..510326
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(510033..510035,510045..510047,510054..510056,
                     510120..510122,510126..510128,510132..510134,
                     510138..510143,510258..510269,510303..510305,
                     510309..510311,510324..510326)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    510045..510047
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(510132..510134,510138..510140,510258..510260,
                     510264..510266)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    510570..511046
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    510720..510722
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(510894..510896,510909..510914,510918..510920)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(510918..510920,510924..510926)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    511173..511505
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     misc_feature    order(511188..511193,511200..511202,511407..511409,
                     511413..511415,511419..511421)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="active site"
                     /db_xref="CDD:173773"
     misc_feature    order(511188..511190,511407..511409)
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173773"
     misc_feature    511593..511781
                     /gene="parE"
                     /locus_tag="MGF_3016"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            511814..514204
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /db_xref="GeneID:12396758"
     CDS             511814..514204
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /EC_number="5.99.1.-"
                     /note="MGF_3026"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="YP_005880688.1"
                     /db_xref="GI:385326251"
                     /db_xref="GeneID:12396758"
                     /translation="MDKKKVFQKDLDDIMSLSFGRYAKYIIQERALPDIRDGLKPVQR
                     RVLYGMYNLGLYYNKSYRKSAATVGEVIGKFHPHGDSSIYEALVRMTQTWKNNIPLID
                     MQGNNGSIDGDNAAAMRYTEARLSHYGNLMLENINKETVNFVNNFDDSEVEPTILPSL
                     LPNLLVNGSTGIAAGYATNIPPFNLKELIDVIIHRIDSPNCKLESILKLMPGPDFPTG
                     GIILDDDGIKNAYLTGKGKIVIRAKIVNENDQLVVTDIPFETNKASIIRSIEEILEAN
                     KLPQLEEVRDESDRFGIRVVLQTNTKDEKVLATIKNYLYKYTQLQINYSFNNVVIDQK
                     KPIQMSIFNYLDSYLNHAYTILRNAISFDLKKDQKRLEVINGLIKATSIIDQIILIIK
                     KSKDKQDAINNLINKYQFSAIQAEAIVSLRLYRLTNTDILALKEEKKSLDTNIKQYQL
                     LLKDQNALNDHLKEILRSYKKLFNTKRRSTIGGNIEKLVINEASIIEKKELYLVSSVD
                     GLIKTIAYDQNKQLNPTSLKIKQDDYLSDLIKVSSLNKVAFITNYGNVVVINAHKIKQ
                     AKPREIGMDINELTTIKDNEKIVKLVELSDQNDRIVLVSKYGMIKQISVNDLVNIKST
                     KPTTCMSLKDDDELVCANLISDPNAELIIITKNAYALRFFINEVNLTGLKSMGVRAIK
                     LKTNDEVIGFDQIKNSIDQLVLVKNKQIKKLKASLIENQSRATQGKNLGLGKDKKPLV
                     NGYLLNTKEAALYGFNRDNELVNLELNQIMVGNLSSEYHDWKDEFKCFFLNKLNYE"
     misc_feature    511826..514027
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="DNA topoisomerase IV subunit A; Validated; Region:
                     PRK05561"
                     /db_xref="CDD:235503"
     misc_feature    511895..513220
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    order(511895..511978,511991..512140,512144..512200,
                     512204..512275,512282..512284)
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    512171..512173
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    order(512957..512965,512972..512983,513005..513010,
                     513059..513109)
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     misc_feature    513608..513748
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    513761..513901
                     /gene="parC"
                     /locus_tag="MGF_3026"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     gene            514197..515294
                     /locus_tag="MGF_3044"
                     /db_xref="GeneID:12396759"
     CDS             514197..515294
                     /locus_tag="MGF_3044"
                     /note="MGF_3044"
                     /codon_start=1
                     /transl_table=4
                     /product="putative GTPase"
                     /protein_id="YP_005880689.1"
                     /db_xref="GI:385326252"
                     /db_xref="GeneID:12396759"
                     /translation="MNKKCVGCGNYLSTDPNDLGYCLDINMFELCKRCFQFKHYKKID
                     QKLTVKKADIENYLNSLILDNYCVFYLVDPTNFIFDLEMIKRSMNANQFYLIFNKIDY
                     LAKKNNLSVIKSRLVDNFKDHGINFSPNQILFNSIYLTYDLRKIDRLMKKAYEKRKKA
                     IFLGQSNVGKSSLINKLLKLNNIDKKLALTTSPYLNTTLQINQIKRRDFCLLDTPGYL
                     DETNGFFDLVPRRIKRLVSYQWKNPVTYQITSNQIFYCEDFFKLKVYLKKDTTKTSIT
                     FYCPTALRIHRTSSKNEQSIDQKLTQIFSDLKAFSYLNNDQTNTYQITLNQDNLLVNG
                     VCLIKFNKGIDKVELYQKDKVHTYLLKTALI"
     misc_feature    514209..515288
                     /locus_tag="MGF_3044"
                     /note="ribosome biogenesis GTPase YqeH; Region:
                     GTPase_YqeH; TIGR03597"
                     /db_xref="CDD:213834"
     misc_feature    514287..514847
                     /locus_tag="MGF_3044"
                     /note="Circularly permuted YlqF-related GTPases; Region:
                     YlqF_related_GTPase; cl17249"
                     /db_xref="CDD:247803"
     misc_feature    order(514488..514493,514497..514502,514602..514607,
                     514692..514712,514842..514844)
                     /locus_tag="MGF_3044"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206746"
     misc_feature    514488..514499
                     /locus_tag="MGF_3044"
                     /note="G4 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    514602..514610
                     /locus_tag="MGF_3044"
                     /note="G5 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    514686..514709
                     /locus_tag="MGF_3044"
                     /note="G1 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    514779..514802
                     /locus_tag="MGF_3044"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206746"
     misc_feature    514788..514790
                     /locus_tag="MGF_3044"
                     /note="G2 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    514833..514844
                     /locus_tag="MGF_3044"
                     /note="G3 box; other site"
                     /db_xref="CDD:206746"
     misc_feature    514839..514847
                     /locus_tag="MGF_3044"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206746"
     gene            515302..516396
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /db_xref="GeneID:12396760"
     CDS             515302..516396
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /EC_number="2.7.7.18"
                     /note="MGF_3048"
                     /codon_start=1
                     /transl_table=4
                     /product="nicotinate-nucleotide adenylyltransferase"
                     /protein_id="YP_005880690.1"
                     /db_xref="GI:385326253"
                     /db_xref="GeneID:12396760"
                     /translation="MKKIIIFGGSFNPIHNGHVNIATKALEQIKADRIYFVPTYKSTF
                     KQAFNISDIHRKKMIQNIIKLNDRFHFNWYELNIQNEKSYLTVKYFKNKFANAQIYFL
                     IGSDNLEKFHLWDEAEMIAKDCQMLYYLRDNQFSDHENIKKFNFLKIDGDNYQISSTK
                     IRNGTQVIGCVSDKNLAYINEHGLYINDRLKHFLRSDERFEHCLRVGQLAKKLAQYNY
                     PNLAQKAYIAGCYHDLAKELDEKTMLSYRDQFDPKLFPDPYKKDLNYRVLHGYVGAWI
                     LEHQFGYDDRELINSIYYHTIINDDPTPLDKIVYLADKLEPDRVKQEINRYFKINKAK
                     ALAFKNIHQAFKLTHDEIRKYLQLSQKQES"
     misc_feature    515305..516372
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="putative nicotinate-nucleotide adenylyltransferase;
                     Validated; Region: nadD; PRK07152"
                     /db_xref="CDD:235947"
     misc_feature    515311..515856
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="Nicotinamide/nicotinate mononucleotide
                     adenylyltransferase; Region: NMNAT; cd02165"
                     /db_xref="CDD:185680"
     misc_feature    order(515320..515334,515344..515346,515350..515355,
                     515362..515364,515425..515427,515548..515556,
                     515602..515604,515608..515613,515617..515622,
                     515641..515646,515689..515694,515767..515769)
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="active site"
                     /db_xref="CDD:185680"
     misc_feature    515344..515355
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:185680"
     misc_feature    515896..516258
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(515905..515907,515995..516000,516238..516240)
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    515998..516000
                     /gene="nadD"
                     /locus_tag="MGF_3048"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            516350..517135
                     /gene="mtn"
                     /locus_tag="MGF_3053"
                     /db_xref="GeneID:12396761"
     CDS             516350..517135
                     /gene="mtn"
                     /locus_tag="MGF_3053"
                     /note="MGF_3053"
                     /codon_start=1
                     /transl_table=4
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="YP_005880691.1"
                     /db_xref="GI:385326254"
                     /db_xref="GeneID:12396761"
                     /translation="MKLGNIFNLVKNKNHKPIKRYVVVAAMSQEVEAIIKKYHYQKER
                     DSIFIYSSPELTDVDLAISGIGKANAASCIQNILDQNCYKQIINIGIAGSLNPKLKPA
                     QLVEVNKLIYGDVDVTYFNYQFGQIPKLPESYSLKSGEFTCVSTDSFISKFNYQEIVQ
                     KLNQPIDLFEMEACAIAQVCHLNNFKNLKVYKVVSDYVQLNELPNPLSDEFSEYVLDK
                     VDFRFKVFDKKTNQEYLVNREELVNHAYQTIFNWFEDKFDHKS"
     misc_feature    516407..516943
                     /gene="mtn"
                     /locus_tag="MGF_3053"
                     /note="Phosphorylase superfamily; Region: PNP_UDP_1;
                     pfam01048"
                     /db_xref="CDD:250322"
     misc_feature    517441..518788
                     /note="MGF_3059f; Potential hypothetical membrane protein
                     gene region"
     gene            517441..517809
                     /locus_tag="MGF_3059"
                     /db_xref="GeneID:12396762"
     CDS             517441..517809
                     /locus_tag="MGF_3059"
                     /note="MGF_3059"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical membrane domain protein"
                     /protein_id="YP_005880692.1"
                     /db_xref="GI:385326255"
                     /db_xref="GeneID:12396762"
                     /translation="MILFLGTIIFASLSILGLMNQATANGQNNYIIYDENKFKISLFL
                     PLIFFILVSIIALFILASGKESYQFGDKLLSRKILIKGILLLIEIVQLFSWIIFLMFL
                     ITYFYPINKNLTQIYQEQVA"
     gene            518273..518788
                     /locus_tag="MGF_3062"
                     /db_xref="GeneID:12396763"
     CDS             518273..518788
                     /locus_tag="MGF_3062"
                     /note="MGF_3062"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical membrane domain protein"
                     /protein_id="YP_005880693.1"
                     /db_xref="GI:385326256"
                     /db_xref="GeneID:12396763"
                     /translation="MFGYLIKPSDTIDNAYSLIYQILSSNEHILLFDTMKNFVLALLV
                     AISVIFLIGIVVDNDPFIFANAIRKTKVRLVAVLIMIELVQALFIFFAWKYFSSFGYP
                     SDQFDIKDQVSTTGIQSTHNDGFYISMIPSAILWTNLLFASFYLNWLLLYLKSGIYSR
                     WSKILILIPFV"
     gene            519101..521698
                     /locus_tag="MGF_3064"
                     /db_xref="GeneID:12396764"
     CDS             519101..521698
                     /locus_tag="MGF_3064"
                     /note="MGF_3064"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880694.1"
                     /db_xref="GI:385326257"
                     /db_xref="GeneID:12396764"
                     /translation="MNKQFGSNNEQEDKFDLKTDQSNQINEQKENNHQADDYTFDYIQ
                     TNKSSSQSNLVNQQEEKNELLNKSAPIQKVETNLQELKADTPKVDDQKTSAPVEKNEI
                     KPQEQKVDSKLEAEPGAINLEDQKADAETQDQKAESKVEEQIEETQETKAFKEIPALD
                     EKTLLSIKKLLDQSNVALVPVPSAFNNYTSNTQQAADDKYHLNYANVTVDPINNFYQK
                     IVDSVNPLIDDYIKSLVNENHEPLKQQQVLITESENIEKNIKNLYKTQKILGRKVANV
                     FIIISFFLIFGLGLIPIFLKNKKIIKEFDSYRTIRQNELDQLWWASYSLSLQFASRLN
                     FNEMLKFITNKLNLGFSNYCSQDTYQFISHCMDNFLNLHSAFNFKYKNTEITDCVATY
                     KEWRMVTTSNAIQVPYIDFETYTTSNGQLATRRVTRYETLVGYHNEKTPFFDDKHFQI
                     LKTNFKPEFNFTTNLKTKSDKTKIKNFIMFENKEFSKKMRITNDKNEISAELLEFFTI
                     KSQEDYLKWAKELNHEFNITKNGRYLINDYIDSASELDSLTQPPKKTSKKDLENPLYD
                     YSSLDLNVAYHINKFSLKHLVSNKKQTVSELIEIFKQTTKYYLSDWAEQVTPFLLSPV
                     INREWYSSDHNYKIANSGTFDDHESTKVQPSYSYLLSKVYQNDLVYFNQNKASTKSWF
                     EINQLDLENHFLKYEITHKSYRAVKEIDYVVVVGVHVGAQTIPVPYTRYYPISEPKTV
                     YFLAKNRAKNNNFIISNKKWDGFFDLAQKANIPIINLDKIKLNPHTSIELQNPYQFLS
                     DPKNQAYLDLLEQIQNNCSNQIHVQANDDGYFIFVNSAKQEELEQENFVKSLAKLKNN
                     LLELRELEN"
     gene            521717..522391
                     /locus_tag="MGF_3075"
                     /db_xref="GeneID:12396765"
     CDS             521717..522391
                     /locus_tag="MGF_3075"
                     /note="MGF_3075"
                     /codon_start=1
                     /transl_table=4
                     /product="LemA-family protein"
                     /protein_id="YP_005880695.1"
                     /db_xref="GI:385326258"
                     /db_xref="GeneID:12396765"
                     /translation="MLVDPSKQTTEGFNPNVDNSTFSAQASSGDVALWWFLYCLSWLT
                     IIGGIILTVKWYQWGNMLRTKQTEINQAASGIDVNLVKRKDTLLKLLEQTKAYMKFEK
                     STLENITKLRSLPNGTTDVNKMNDAENIINSVSRDINLQFENYPNLKASSIVAELMSS
                     SQYIEAEISASRRLYNTKVTDFNQEIVSFPVSVKAKKMNCHSLPLFVASVEAKQDVKM
                     DSLSDL"
     misc_feature    521840..522364
                     /locus_tag="MGF_3075"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: LemA; COG1704"
                     /db_xref="CDD:224618"
     gene            522606..523475
                     /locus_tag="MGF_3081"
                     /db_xref="GeneID:12396766"
     CDS             522606..523475
                     /locus_tag="MGF_3081"
                     /note="MGF_3081"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880696.1"
                     /db_xref="GI:385326259"
                     /db_xref="GeneID:12396766"
                     /translation="MMRSLNILTKTWDYGTAITEFGANFVLAFLIMFVFMIIRSKKIE
                     NKLVISSFFVFVVFISIISTWAWARVLMNSFPIVYLNPINVIFDAIVQMVNLQNSSTS
                     HLTDSLKGLGYILPMQLVGILSGFVCFYIFYILITKSKQTYIKAVAFNQILFKTDNQK
                     TVYFAFKDFIFILIYTAVIPMISLINPVASGLRRIDYLIVSMIVLFVIIYLSSFFEFY
                     TFDILLSFAFAIFSTFFLLIDQNSDKQTIKTELKNTWLHFLISLIITLVIAIVLAIIV
                     YQIFIQGQHRVTI"
     gene            523462..525702
                     /locus_tag="MGF_3086"
                     /db_xref="GeneID:12396767"
     CDS             523462..525702
                     /locus_tag="MGF_3086"
                     /note="MGF_3086"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880697.1"
                     /db_xref="GI:385326260"
                     /db_xref="GeneID:12396767"
                     /translation="MLRSKKSKIIWTLFKSFAVVISPIAFTTLASCYAPKDNSKPVQD
                     NKKEPKIGINLASFDKLNNATDLLEWKDPESKTSEMEIGNILKNKFIKNNLQLKVDQI
                     KQILADDYKVSQNDLANYSFDIKYNEVFYDRNNPDQLVVPTEILRKVQLPNLTSSNLY
                     QGHVYNLILAGFKPDNKYARFDEYKNKIKDFKAAHPIQKVDLDNLDLGDLLGYSQAKL
                     KSLKIEFKDFNNSDLYQGLSNQEKIDQANTYSSKKTFTPKYSAFVKSVKISDDLKKLH
                     FTIRIAYGFSSYQWNNDFNSYGEDLQFDQDINKELKLTEQDYQKIALANLNIQLADFS
                     SITNYDFANFNVDDFYPFSKNENLIKFKIIQAINPSVQNKNATFKVKTSSDLQQLNNL
                     DLEQIYGVKKHLNLFSDPQVDQSTKIYDLHTGLLGQEQLSKISSDLFTYLNNTNAIAG
                     GYGQIRGFYASNKTPAQLHLGEDILVNANTLLKSPVDADVVSVFDRKSDNIGAGIGTS
                     VILRIKAKDLSNMIDQGVYEDYFASSEYVYLGIIHLDGQKTQNQLNQILNNQGNVNRQ
                     LNWISKNQKDSYLDITLDNPLSLKANDAFAVVGESDQNGGWLPHAHIALMADSSLITD
                     PNGYVYPDRNNYLSPRNLDRINNPAKRLFFQVPGVAFGIGSTTYYKTDPNANEIMQEV
                     DGKQTKVLVNNDPFIDQNINIQSYETRGLLDPNLLFQFRNQDTYIAKLIDYFKESFPN
                     EPKLQE"
     misc_feature    <525223..>525327
                     /locus_tag="MGF_3086"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06148"
                     /db_xref="CDD:180426"
     gene            complement(525862..526857)
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /db_xref="GeneID:12396768"
     CDS             complement(525862..526857)
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /EC_number="3.1.26.4"
                     /note="MGF_3095"
                     /codon_start=1
                     /transl_table=4
                     /product="Ribonuclease HIII"
                     /protein_id="YP_005880698.1"
                     /db_xref="GI:385326261"
                     /db_xref="GeneID:12396768"
                     /translation="MSNNTYSIKNLSNETIKRFVNQLKTYEIDNNIASIYKRFNYLDY
                     LIISVYKSNSILIQLTKLANSSHLDEFIDKYCFWTNNNQNKQVKKTTNNKKSKLTNNK
                     LNLSNVSLIGCDEVGVGEYLGPIVTCCALVSDDQIDQINRLGVKDSKLLTDDKIVNIA
                     NELRKFIKFQIFCFDPKKGALEFNQMYDQLKNINALKAYMHNAGLILFKQKYGINNMI
                     VLDQFVNEKKYYEHLNNYKVTPIIKIDVMEEKAESKYLSVAVASILARAYYLELCKKL
                     LDKINYQGDYKKMLGADNKTFELIKKHIKANPSYNWKKVFKVFFKPFQEFLESLK"
     misc_feature    complement(525865..526848)
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /note="ribonuclease HIII; Provisional; Region: PRK00996"
                     /db_xref="CDD:234886"
     misc_feature    complement(<526684..526848)
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /note="Domain of unknown function (DUF3378); Region:
                     DUF3378; pfam11858"
                     /db_xref="CDD:256678"
     misc_feature    complement(525880..526530)
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /note="Bacterial type 2 ribonuclease, HII and HIII-like;
                     Region: RNase_HII_bacteria_HIII_like; cd06590"
                     /db_xref="CDD:260000"
     misc_feature    complement(order(525892..525900,525979..525981,
                     526060..526062,526102..526104,526108..526110,
                     526189..526197,526276..526284,526411..526413,
                     526501..526518))
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260000"
     misc_feature    complement(order(526102..526104,526195..526197,
                     526513..526518))
                     /gene="rnhC"
                     /locus_tag="MGF_3095"
                     /note="active site"
                     /db_xref="CDD:260000"
     gene            526926..527354
                     /locus_tag="MGF_3096"
                     /db_xref="GeneID:12396769"
     CDS             526926..527354
                     /locus_tag="MGF_3096"
                     /note="MGF_3096"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880699.1"
                     /db_xref="GI:385326262"
                     /db_xref="GeneID:12396769"
                     /translation="MAQNNKKIDLITARELEKISFKYNNEGEYDSQEVDKVLDCVIDS
                     LKFYENQVKRLDQYEQHVKKLQDEIERLKQINGDQRVQIKEMSDNGYDRVAFMNKTTQ
                     LEKSLMSLSAIASQVTRMENMVSRIFSEVDMIKKILSHQR"
     misc_feature    526959..>527147
                     /locus_tag="MGF_3096"
                     /note="cell division protein GpsB; Provisional; Region:
                     PRK14127; cl19517"
                     /db_xref="CDD:267870"
     gene            527426..527761
                     /gene="acpS"
                     /locus_tag="MGF_3098"
                     /db_xref="GeneID:12396770"
     CDS             527426..527761
                     /gene="acpS"
                     /locus_tag="MGF_3098"
                     /EC_number="2.7.8.7"
                     /note="MGF_3098"
                     /codon_start=1
                     /transl_table=4
                     /product="Holo-[acyl-carrier-protein] synthase"
                     /protein_id="YP_005880700.1"
                     /db_xref="GI:385326263"
                     /db_xref="GeneID:12396770"
                     /translation="MIIGVGIDVVSIDRFQAKKSDEFIKKLLTEHEQNKYKTVIGESN
                     QNIFLAIRWSLKEAIFKALKTWDEFTQLEIRKIHGAYECSLNEKIKLHLSISHEGQRL
                     VAMAVAERI"
     misc_feature    527426..527755
                     /gene="acpS"
                     /locus_tag="MGF_3098"
                     /note="4'-phosphopantetheinyl transferase; Provisional;
                     Region: acpS; PRK00070"
                     /db_xref="CDD:234610"
     gene            527761..528558
                     /gene="plsC"
                     /locus_tag="MGF_3101"
                     /db_xref="GeneID:12396771"
     CDS             527761..528558
                     /gene="plsC"
                     /locus_tag="MGF_3101"
                     /EC_number="2.3.1.51"
                     /note="MGF_3101"
                     /codon_start=1
                     /transl_table=4
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_005880701.1"
                     /db_xref="GI:385326264"
                     /db_xref="GeneID:12396771"
                     /translation="MPLFLRLLSFLIFPFVGIEFIFRYLIALIKASIYKNNESFYTKE
                     NRFKTVYILACRVIFFKGVKIEIKNADLIPKKPVLFIGNHKSNIDPFVMIWLANHLKD
                     ITELTFVAKAELKNKSIGKIMSLIDVIFIDRNSIKQTAKATLNEIELLKNTSVCVFAE
                     GTRVFSHQLGEFKPGAIKAAYKAFCPIVPFSLFNTQGRMETISDRDRAVQPGFQKART
                     NKIYIEFLKPLKPIDYSRSESTFIINIIRELIQQTYQKQLTEFNNQR"
     misc_feature    527923..528522
                     /gene="plsC"
                     /locus_tag="MGF_3101"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    order(528010..528012,528019..528021,528025..528027,
                     528088..528099,528241..528249)
                     /gene="plsC"
                     /locus_tag="MGF_3101"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            528690..530462
                     /locus_tag="MGF_3104"
                     /note="scpA/dhfr"
                     /db_xref="GeneID:12396772"
     CDS             528690..530462
                     /locus_tag="MGF_3104"
                     /note="MGF_3104"
                     /codon_start=1
                     /transl_table=4
                     /product="Bifunctional protein including Segregation and
                     condensation protein A and dihydrofolate reductase"
                     /protein_id="YP_005880702.1"
                     /db_xref="GI:385326265"
                     /db_xref="GeneID:12396772"
                     /translation="MIKLIWCEDLNHGIAKNNQIPWRIDEELNHFHQTTTNHPIIMGY
                     NTYLAMNKILANQANIVISKKHQHELKNKNELFLYSDLKKALIDFSIVDLFIIGGKKT
                     IEQAIKYADQLVISKLNADYGCDLFVNLNYDDFSLVQTKEYDQFVVEYWERKPNTKKP
                     EDLIEELNINLNDDFLNLSFKHFSGPFDLLLHLIKDKKMDIMALDLFELTNQYFAYIN
                     KHMINLDLVSDYLYMACELLRIKSDLSIPNFEDETKIDLNNDDERDRIVKRIIEYKRY
                     SELLPSLQKMQLERFSLFAKEEDDWDVFKLTSNDLLEAPLPDYVNPKKLKKAMERVFE
                     KLRIKTITEHKIVIEELSIEDVKNEILSIIRKLLNNQYDRFIDLEKIFEQIDPKKLSL
                     RYFVTSFVCLLILVREQKIDLNQKNDDESISACLVDPTKIVNSQESIQEVIQRQQEDE
                     KALQESIKQIQEERKQSFFKQREEYLKKKYGEYYVSREQYQKLTPEEKINIRINQRKI
                     DEQEKLNKAKAQNLVDENNQIIDLKTKKPSAKQILYEADLIIKQLDDLINDQQEDYDS
                     QAKLEALHTGLIKLDDEQDLIKEE"
     misc_feature    528690..530183
                     /locus_tag="MGF_3104"
                     /note="segregation and condensation protein A/unknown
                     domain fusion protein; Provisional; Region: scpA;
                     PRK00478"
                     /db_xref="CDD:234776"
     misc_feature    528693..529145
                     /locus_tag="MGF_3104"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    order(528702..528704,528753..528755,528768..528770,
                     528858..528860,528978..528980,528996..528998,
                     529035..529037)
                     /locus_tag="MGF_3104"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    order(528708..528710,528729..528731,528819..528827,
                     528885..528887,528981..528992)
                     /locus_tag="MGF_3104"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    529209..529934
                     /locus_tag="MGF_3104"
                     /note="ScpA/B protein; Region: ScpA_ScpB; cl00598"
                     /db_xref="CDD:260520"
     misc_feature    <529884..>530177
                     /locus_tag="MGF_3104"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:148511"
     gene            530472..531347
                     /gene="scpB"
                     /locus_tag="MGF_3119"
                     /db_xref="GeneID:12396773"
     CDS             530472..531347
                     /gene="scpB"
                     /locus_tag="MGF_3119"
                     /note="MGF_3119"
                     /codon_start=1
                     /transl_table=4
                     /product="Segregation and condensation protein B"
                     /protein_id="YP_005880703.1"
                     /db_xref="GI:385326266"
                     /db_xref="GeneID:12396773"
                     /translation="MKTKIKKITKKFNLKKNTEVKPLSTQELIEEQKEFSQAVDKLMT
                     KKQKPTFEDIGSSTVDFETSDNDKFYESVRDAIEKTSEIVDDLDQSELTKNSSEQKEL
                     SAKAIIQAALYVAGRNGMTLQELNKIIPKIHQDQLFKELEEMIYSYDQNLNFGLTIKN
                     YGGRYKILTKTAVKKDMQRYVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVD
                     SLSLVDNLLEKGLIVEVGRADTPGRPFLYNVSEKFFDLFGIESIDDLPQIKHFDPDSY
                     QEGNFFDSNRYDENE"
     misc_feature    530784..531341
                     /gene="scpB"
                     /locus_tag="MGF_3119"
                     /note="Putative transcriptional regulators (Ypuh-like);
                     Region: DUF387; cl00612"
                     /db_xref="CDD:260531"
     gene            531561..531989
                     /gene="mraZ"
                     /locus_tag="MGF_3128"
                     /db_xref="GeneID:12396774"
     CDS             531561..531989
                     /gene="mraZ"
                     /locus_tag="MGF_3128"
                     /note="MGF_3128"
                     /codon_start=1
                     /transl_table=4
                     /product="cell division protein MraZ"
                     /protein_id="YP_005880704.1"
                     /db_xref="GI:385326267"
                     /db_xref="GeneID:12396774"
                     /translation="MFIGNYQHNIDPKGRLSIPSKLRSLIQDSVVLSRGLDGCLELRT
                     NQEFENYANKFLSQSNNKQQNRNYKRLLFANSLTVEIDSANRILIPANFKKMANLNKE
                     VVIIGMGDHIELWDVNAYEQFNEANFDKFNELAESMDDDH"
     misc_feature    531561..531947
                     /gene="mraZ"
                     /locus_tag="MGF_3128"
                     /note="cell division protein MraZ; Reviewed; Region:
                     PRK00326"
                     /db_xref="CDD:234728"
     misc_feature    531561..531773
                     /gene="mraZ"
                     /locus_tag="MGF_3128"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     misc_feature    531774..531950
                     /gene="mraZ"
                     /locus_tag="MGF_3128"
                     /note="MraZ protein; Region: MraZ; pfam02381"
                     /db_xref="CDD:111290"
     gene            531976..532917
                     /gene="mraW"
                     /locus_tag="MGF_3131"
                     /db_xref="GeneID:12396775"
     CDS             531976..532917
                     /gene="mraW"
                     /locus_tag="MGF_3131"
                     /EC_number="2.1.1.-"
                     /note="MGF_3131"
                     /codon_start=1
                     /transl_table=4
                     /product="S-adenosyl-L-methionine-dependent
                     methyltransferase mraW"
                     /protein_id="YP_005880705.1"
                     /db_xref="GI:385326268"
                     /db_xref="GeneID:12396775"
                     /translation="MMIINNQIHYPVLLKEVIENLITIKDGIYLDLTIGFGGHSYNII
                     KILDQKARLIGFDQDLQAIAHCKQLFSEFNNVSLINDNFVNLKKHLQLMQIDKIDGCL
                     IDLGVSSYQLDRADRGFSYHSLGRLDMRMDQNKEVDATKLIQNSTVSELVKIMKNYGE
                     IKDPYRVVVALKKAFEKKELNTLEVVELIKKHVNKAELYANKHPARRYFQALRIAVNN
                     ELEVLEKLLSYLPSYLNKGGKIAIITFHSLEEKIVKKVFRHLASTSSLNNLPINNELL
                     KKYHNHFNKGLSPTQSELETNRRSRSAKLFVLEKINN"
     misc_feature    531985..532914
                     /gene="mraW"
                     /locus_tag="MGF_3131"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            532921..534210
                     /locus_tag="MGF_3136"
                     /db_xref="GeneID:12396776"
     CDS             532921..534210
                     /locus_tag="MGF_3136"
                     /note="MGF_3136"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880706.1"
                     /db_xref="GI:385326269"
                     /db_xref="GeneID:12396776"
                     /translation="MYNLKQTYCTLNFSKQKIDLVLSTHNDQSMHLLRQVSIENNNLY
                     DNTKILNQRLLLEKIQNQIDQITQRHKLVIQKVILNFDTLINDLKSKQINSGAINYLN
                     AQQFDNEIKKFVLNHQKSRGNTEQLVNYQVYQTLDETTKKPVDELVADQNYYAVILIY
                     TTKSSLVKQISELLDQLNLTITNISTQELNYQTSQQLKDITDTLMVDILDDHTNIGVY
                     LNNRYIINKKINLGINQIKQNVVNKLNAKNRNEDLITIVDQYFNNNLLTLNEDSSYNL
                     LIKTNVQFLSYQYLSKQDLDSCIQKQLVQIIDYINKELELIKRDFKKTIKQIIVNTNR
                     NSAIANNLLNKESELVNDVEISKLYSPKLSCAKSSYMQAYWAIKKQYEVDSSINKIDN
                     YVITPHDYNYDHESDKKAMLLSINKELNNILAKISFK"
     gene            534210..535595
                     /gene="ftsZ"
                     /locus_tag="MGF_3144"
                     /db_xref="GeneID:12396777"
     CDS             534210..535595
                     /gene="ftsZ"
                     /locus_tag="MGF_3144"
                     /note="MGF_3144"
                     /codon_start=1
                     /transl_table=4
                     /product="cell division GTPase FtsZ"
                     /protein_id="YP_005880707.1"
                     /db_xref="GI:385326270"
                     /db_xref="GeneID:12396777"
                     /translation="MFDQRDKKPEKSLEEMQEELIKLQKEMQAVLMKDRAANQIRLGY
                     FDDQEFLIEPQAQPEEERIEYFVSKYKKNYKIKVIGIGGAGNNIVEDILRQYPDLVSE
                     NLMFYQLNTDSKHLNLLARNRSKAIRYLIDSPYTDGHGAGGDVQKARLAISQYFDKEV
                     DEILNECDICIVIAGLGKGTGSAGSTYIINKAATKKIITLAYVVIPPNTEGSLSYEKA
                     TDALYDLLKDANAISQLRMDDINKNLNYLSVVERNQEISNNIGLSIKTIVNLINEQTI
                     YNLDYADLITFFQKKDQLAYEFLVKEIKLSSSQENLVAQKLLSDDWLDVNQLIVIYQL
                     SKQLPGKLYDELNAKIKASVNRNAHIVFGSKYVDGDDNIITILGKKTSSLIHANNTLV
                     YDPYNLISRPDQKIKNVMTDHYLWNQAKLLEQKLAAINQDQTQNTFKNTNRADGKIET
                     SSILNLLDQDE"
     misc_feature    534396..535340
                     /gene="ftsZ"
                     /locus_tag="MGF_3144"
                     /note="Cell division GTPase [Cell division and chromosome
                     partitioning]; Region: FtsZ; COG0206"
                     /db_xref="CDD:223284"
     misc_feature    534429..535343
                     /gene="ftsZ"
                     /locus_tag="MGF_3144"
                     /note="Tubulin/FtsZ: Family includes tubulin alpha-,
                     beta-, gamma-, delta-, and epsilon-tubulins as well as
                     FtsZ, all of which are involved in polymer formation.
                     Tubulin is the major component of microtubules, but also
                     exists as a heterodimer and as a curved...; Region:
                     Tubulin_FtsZ; cl10017"
                     /db_xref="CDD:263945"
     misc_feature    order(534453..534461,534468..534473,534537..534545,
                     534552..534554,534630..534638,534732..534743,
                     534747..534752,534819..534821,534825..534830,
                     534849..534851,534918..534920,534930..534932,
                     534966..534968,534975..534980,534987..534989)
                     /gene="ftsZ"
                     /locus_tag="MGF_3144"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100014"
     gene            complement(536013..536567)
                     /locus_tag="MGF_3158"
                     /db_xref="GeneID:12396778"
     CDS             complement(536013..536567)
                     /locus_tag="MGF_3158"
                     /note="MGF_3158"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880708.1"
                     /db_xref="GI:385326271"
                     /db_xref="GeneID:12396778"
                     /translation="MSNNDSEILKNNNNNKQVSNNQPSQRAQNPRVNELKDFLNRYKR
                     RVHKPIIVFFILHIIAFLLLVITAALVSAGIVKAGSSGRGSGVAESFNRSVIAGISGG
                     SLSLVSFVLFGIISFAFVILFIMGAFYTANKKVDGLMGSMILFIIAIFFPFLGSILGL
                     ISSILAKKNIERQIAELEGNLSAL"
     gene            536943..538940
                     /locus_tag="MGF_3163"
                     /db_xref="GeneID:12396779"
     CDS             536943..538940
                     /locus_tag="MGF_3163"
                     /note="MGF_3163"
                     /codon_start=1
                     /transl_table=4
                     /product="putative ABC-type bacteriocin/lantibiotic
                     exporter"
                     /protein_id="YP_005880709.1"
                     /db_xref="GI:385326272"
                     /db_xref="GeneID:12396779"
                     /translation="MRLIKQTENNDCGIAVIRMLYNHYFYHDLNDFLIKANTHISSSG
                     ININQFEDIASKHHLLCESYQASFDELLKLNEKYLVCLLKAEDYNHFVIVKKKNSSFV
                     VFDPGSNNVQIITYEKFQERFAGIIIKVSPDYLNYTKPDYDTKFSFTRIISFKYIFIF
                     LLIELLITVTSIGLTFLFKILINDVINTSVINNILVIIVTFILIKVINLTGSGLLSIW
                     QQQLIKNQYQYWWSQLLSTFSLPKTIKLIKDDIGKIYKYDDFLLNCLEFYIKKIAAFI
                     NNILIVVVAIILLYRIHIFFLFITLFQSFVSLVYLILNLFWFKGYKQKSRELQIKQQT
                     YLYEFHKTIINTQHQSFYQQWTKDVKEVFSDNLNLNKKINQSANFSNAIFELIKYFIT
                     CITLVSGIALILNLNTIDLATLIYVSTLQGLLISSIDGLIKFINESYEFRIAKTNIHN
                     ILLLQKEPQFLINYSKKIKSIQFKNVYLFFDAKPIFNDLNLMINEPVFLSARNASGKS
                     TLIKSIIKRQLLSSGEIFINEMNINKYSNQWLLNNVIYLSDQKSNVELSNEWLIQFLK
                     KNKRPELLDIVEYFKLFDADKYNLSSGQNQVLKLLHSYNSRNKLFLLDEVLNNIDEAI
                     KHQVFQIVIKQIIKNNLTIMIEHDHSFSKYFKKQINLHEYQ"
     misc_feature    536943..538928
                     /locus_tag="MGF_3163"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     misc_feature    536943..537332
                     /locus_tag="MGF_3163"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region: Peptidase_C39E;
                     cd02424"
                     /db_xref="CDD:239104"
     misc_feature    order(536958..536960,536976..536978,537210..537212,
                     537255..537257)
                     /locus_tag="MGF_3163"
                     /note="putative active site [active]"
                     /db_xref="CDD:239104"
     misc_feature    538356..538907
                     /locus_tag="MGF_3163"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    538443..538466
                     /locus_tag="MGF_3163"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(538452..538457,538461..538469,538587..538589,
                     538782..538787,538881..538883)
                     /locus_tag="MGF_3163"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    538578..538589
                     /locus_tag="MGF_3163"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    538710..538739
                     /locus_tag="MGF_3163"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    538770..538787
                     /locus_tag="MGF_3163"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    538794..538805
                     /locus_tag="MGF_3163"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    538869..538889
                     /locus_tag="MGF_3163"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            538876..539301
                     /locus_tag="MGF_3171"
                     /db_xref="GeneID:12396780"
     CDS             538876..539301
                     /locus_tag="MGF_3171"
                     /note="MGF_3171"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="YP_005880710.1"
                     /db_xref="GI:385326273"
                     /db_xref="GeneID:12396780"
                     /translation="MNMIIALVNILKNRLTYMNTNKIINSTIISLFIVLLTFLAIVFL
                     VRINLYESYVFQKQDQKIQVNLTQDSQLAKFIQNNKAKYLIGYYKNDSSALKFMIDES
                     NENQAILLSNQAIDQNVGMISFYLGKSLLYHHLIKSINL"
     gene            539310..539804
                     /locus_tag="MGF_3173"
                     /db_xref="GeneID:12396781"
     CDS             539310..539804
                     /locus_tag="MGF_3173"
                     /EC_number="3.4.24.-"
                     /note="MGF_3173"
                     /codon_start=1
                     /transl_table=4
                     /product="putative metalloprotease ybeY"
                     /protein_id="YP_005880711.1"
                     /db_xref="GI:385326274"
                     /db_xref="GeneID:12396781"
                     /translation="MINHFDLKKVPPSIKEDFSEILKIINQCFSSHFKVKNDLLYELS
                     FVSEKQSLQLNSSLRNKEYVADVISVCLWENAEIITPLLGEIFICSKKIAKDAIKYDV
                     NFWYLLIRMIIHGLLHLLEFDHEQSDAYEYVTLTIQEQIVNKVIKTAKKKIWKNQELL
                     SLLG"
     misc_feature    539310..539744
                     /locus_tag="MGF_3173"
                     /note="Uncharacterized protein family UPF0054; Region:
                     UPF0054; pfam02130"
                     /db_xref="CDD:251107"
     gene            539768..540670
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /db_xref="GeneID:12396782"
     CDS             539768..540670
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="MGF_3176"
                     /codon_start=1
                     /transl_table=4
                     /product="GTP-binding protein Era"
                     /protein_id="YP_005880712.1"
                     /db_xref="GI:385326275"
                     /db_xref="GeneID:12396782"
                     /translation="MKKSGIVVITGLASVGKSTLINKIANSKVAIISKYDQTTRNVIA
                     HKIVHDKIDYLLLDTPGFHKSFNKLSLFLNSEIKQAYKHAHACILIVDSTKKPTDDFT
                     NLLKIMKSYEMNNLIVIYSKIDLIKNEDHINEAQQLINESFKVVKTIKANLLSDHLND
                     QIDEGLEQLLDENYQLPESELDENEKDNFEIKEIIREKILNNTFQEVPHSVAVIIEAK
                     KYDQEKKLFNIECAIVTERESQKKIIIGKQGSMIKKIGTQARNELLNIYDCKINLKLF
                     VKVEKEWRNDDYLIKSLGHKKWVL"
     misc_feature    539768..540655
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="GTPase [General function prediction only]; Region:
                     Era; COG1159"
                     /db_xref="CDD:224081"
     misc_feature    539789..540277
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="E. coli Ras-like protein (Era)-like GTPase; Region:
                     Era_like; cd00880"
                     /db_xref="CDD:206646"
     misc_feature    539798..539821
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="G1 box; other site"
                     /db_xref="CDD:206646"
     misc_feature    order(539807..539824,540128..540133,540137..540139,
                     540221..540226)
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206646"
     misc_feature    539879..539893
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206646"
     misc_feature    539882..539884
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="G2 box; other site"
                     /db_xref="CDD:206646"
     misc_feature    order(539936..539953,540014..540016)
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206646"
     misc_feature    539939..539950
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="G3 box; other site"
                     /db_xref="CDD:206646"
     misc_feature    540128..540139
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="G4 box; other site"
                     /db_xref="CDD:206646"
     misc_feature    540221..540229
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="G5 box; other site"
                     /db_xref="CDD:206646"
     misc_feature    540383..540619
                     /gene="era"
                     /locus_tag="MGF_3176"
                     /note="KH domain; Region: KH_2; pfam07650"
                     /db_xref="CDD:254331"
     gene            540658..541383
                     /locus_tag="MGF_3182"
                     /db_xref="GeneID:12396783"
     CDS             540658..541383
                     /locus_tag="MGF_3182"
                     /note="MGF_3182"
                     /codon_start=1
                     /transl_table=4
                     /product="putative recombinational DNA repair protein
                     RecO"
                     /protein_id="YP_005880713.1"
                     /db_xref="GI:385326276"
                     /db_xref="GeneID:12396783"
                     /translation="MSSITKKGYIIDYFDHNENDQIIKILFDDNTLTSLISVGSKKIL
                     SKNGRYITLGSLHDFEFFQARSIERLSKLKKIHKIDTKDATISESLPMVIMHYYLNKK
                     SGGLENNFFNFYDDVISYVIKQRYSNETIIIYILLNIINLEGIAFQLLNCGICNSKQV
                     ITLSFKKMYGLCEKCAYEQHEFLYDKNFMRNIFWLIYKNDYEVSTLESRKYISLIKGL
                     ASAIYHNAGIYLEPVFSYLIKLK"
     misc_feature    540658..540909
                     /locus_tag="MGF_3182"
                     /note="Recombination protein O N terminal; Region: RecO_N;
                     pfam11967"
                     /db_xref="CDD:256764"
     misc_feature    540664..>541215
                     /locus_tag="MGF_3182"
                     /note="Recombinational DNA repair protein (RecF pathway)
                     [DNA replication, recombination, and repair]; Region:
                     RecO; COG1381"
                     /db_xref="CDD:224299"
     gene            541391..542782
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /db_xref="GeneID:12396784"
     CDS             541391..542782
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /EC_number="6.1.1.14"
                     /note="MGF_3185"
                     /codon_start=1
                     /transl_table=4
                     /product="glycyl-tRNA synthetase"
                     /protein_id="YP_005880714.1"
                     /db_xref="GI:385326277"
                     /db_xref="GeneID:12396784"
                     /translation="MELKQDQIVNFLKNYGFVYQSSEIYNGLANSWDYGPLGALLKNN
                     IKQLLLKHFVFSQPNMKLLDSSIILNPLVWQASGHLDNFSDPLVDCKECKSRYRADKL
                     IEELNDDSIKITENTDPSYLEQILVDKKVECKKCEAANWTKIRKFNLMFKTFQGVVED
                     SLNTIYLRPETAQGIFINFKNILRTQRMKLPFGVAQIGKAFRNEITPGNFIFRTREFE
                     QFEIEYFLEPELVKEKFDWYINQIEDFLINKLLINKELIKRHEIAKDELAHYSSRTID
                     FQFNFPHGWSELWGLAHRGNFDLTAHSNQSGKTLDYHNEIEKTKIIPDVIEPSLGIER
                     ILYAIVCAHYHVEQLADNDSREVLRLPISLSPYQLAILPLVNKLKDQAYQLYLELLKI
                     SDTNLRFDFDSAGSIGKRYRRYDAIGTKYCLTYDFDSLEKGIVTIRERDSMEQIKLPI
                     SELKQWIRNNLHE"
     misc_feature    541400..542773
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="glycyl-tRNA synthetase; Provisional; Region:
                     PRK04173"
                     /db_xref="CDD:235240"
     misc_feature    541412..542407
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="Glycyl-tRNA synthetase (GlyRS)-like class II core
                     catalytic domain. GlyRS functions as a homodimer in
                     eukaryotes, archaea and some bacteria and as a
                     heterotetramer in the remainder of prokaryotes. It is
                     responsible for the attachment of glycine to the 3...;
                     Region: GlyRS-like_core; cd00774"
                     /db_xref="CDD:238397"
     misc_feature    order(541436..541438,541514..541516,541538..541540,
                     541556..541558,541574..541579,541586..541594,
                     541598..541600,541841..541852,541931..541933,
                     541943..541945,542036..542038,542291..542293)
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238397"
     misc_feature    541571..541594
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="motif 1; other site"
                     /db_xref="CDD:238397"
     misc_feature    order(541898..541900,541904..541906,541994..541996,
                     542000..542002,542024..542032,542039..542041,
                     542045..542047,542051..542053,542249..542254,
                     542270..542272,542369..542371,542375..542377,
                     542381..542383,542390..542392)
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="active site"
                     /db_xref="CDD:238397"
     misc_feature    541991..542002
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="motif 2; other site"
                     /db_xref="CDD:238397"
     misc_feature    542381..542392
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="motif 3; other site"
                     /db_xref="CDD:238397"
     misc_feature    542426..542776
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="HGTP anticodon binding domain, as found at the
                     C-terminus of histidyl, glycyl, threonyl and prolyl tRNA
                     synthetases, which are classified as a group of class II
                     aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon
                     binding domain is responsible for...; Region:
                     HGTP_anticodon; cl00266"
                     /db_xref="CDD:260312"
     misc_feature    order(542510..542515,542624..542626,542642..542644,
                     542666..542668,542696..542698,542702..542704)
                     /gene="glyS"
                     /locus_tag="MGF_3185"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238379"
     gene            542775..544763
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /db_xref="GeneID:12396785"
     CDS             542775..544763
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /EC_number="2.7.7.-"
                     /note="MGF_3193"
                     /codon_start=1
                     /transl_table=4
                     /product="DNA primase"
                     /protein_id="YP_005880715.1"
                     /db_xref="GI:385326278"
                     /db_xref="GeneID:12396785"
                     /translation="MSNDLNQLAKYLRKKISVSSIISKYLDLEKKGSNYKSLCPFHDD
                     NTPSFSVNDTKQVWKCFSCNESGGVIEFVQKKENLNFVEAVKKIVELEGIDLAAIGYS
                     LNFNKQKAVDESDQEFYKLNQFLAWRAHSNLRLEFSTNPKLNEFLNKRGLINEELLNN
                     FQIGFHPKSYSLNKLVEDLKVFYQKHLNKTYDDQIILSNLRYIKYISEKNVCYFSNRV
                     IFPIKNSDGQVVGFSGRAIDENNEIKYLNTPETDYFIKGHNLYNYSSLELDENNSTIY
                     LCEGYMDVIALYQIGIKNAVAIMGTALTDQQIELIKAKLNQIKRIVLALDNDESGKKA
                     TITCIKLLTRKRVHNLYQLDYSDLKQKDLDEIYHSPDGENQLKELIKKQLSTQKEQEN
                     VEYDDEKQLSTQLYQELNELKPEQDDQVDITTLIDYNLDKRITEQLRNFIQAVIKICR
                     YYLISFKYLTYKDLSNVRLKILSKINLYKPTRYLFNTMLQITLTNQVMKSLTTNEQLE
                     AILFCYNFTKRFLEGFTDLIFRKVNDLYLLNAKQNTLNDRIYNKIKLKLFDDTVYLMK
                     KHIENRLNLDLFHKLKNELLSHIKYSKYAALAHDQFVNEEELNAYLKSCTSGIDGFKE
                     LYDLKTKEQLVQWLAKGEIFKLAQIKNLNILEELLKRK"
     misc_feature    542808..544613
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="DNA primase (bacterial type) [DNA replication,
                     recombination, and repair]; Region: DnaG; COG0358"
                     /db_xref="CDD:223435"
     misc_feature    542808..543062
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     misc_feature    543174..543566
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:254701"
     misc_feature    543594..543803
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="TOPRIM_DnaG_primases: The topoisomerase-primase
                     (TORPIM) nucleotidyl transferase/hydrolase domain found in
                     the active site regions of proteins similar to Escherichia
                     coli DnaG. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_DnaG_primases; cd03364"
                     /db_xref="CDD:173784"
     misc_feature    order(543609..543614,543621..543623,543750..543752,
                     543756..543758,543762..543764)
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="active site"
                     /db_xref="CDD:173784"
     misc_feature    order(543609..543611,543750..543752)
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173784"
     misc_feature    order(543615..543620,543636..543641,543669..543671)
                     /gene="dnaG"
                     /locus_tag="MGF_3193"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173784"
     gene            544805..546745
                     /gene="rpoD"
                     /locus_tag="MGF_3203"
                     /db_xref="GeneID:12396786"
     CDS             544805..546745
                     /gene="rpoD"
                     /locus_tag="MGF_3203"
                     /note="MGF_3203"
                     /codon_start=1
                     /transl_table=4
                     /product="RNA polymerase sigma factor RpoD (Sigma-A)"
                     /protein_id="YP_005880716.1"
                     /db_xref="GI:385326279"
                     /db_xref="GeneID:12396786"
                     /translation="MLFIPLTFTRMAKNTNSTPKNKTVSKAKNISQLSLKQRLELAKK
                     QEKTPANKLVNKKIETVSKTKKTAKPTKVEKPVSEKKLSVATKAKKAKSEKVVVEQPE
                     AKTTVKKVKAAPIKKEVVLKDKKAKAEPKSVAKEEKKSKLSLKSAKKSTKKKVTSKKD
                     ENLDLNNEIDFADFDSKDEEIDFSDFKHENYSSAFKETDFSEQDELDDKEFNLSDFFS
                     DSKLDIDQPITAQKRQRGRKPKHAPSNEKNDLVYHEVLEASSKTKNNDQESIRAIKTL
                     LAKAKATKSLSNEEIIDVFKNYEFTEAEDLEILQELKDNKIKLEDNVEEKISLFRKNQ
                     DLSEIDKNLDDLISKGASTKDKVEDNVKAFLGTLGSSKILNFGEEIQIAKLLGSTDPE
                     TREYAINQLVTSNLRLVTSIAKKYLNRGLDFVDLIQEGSIGLMKAISKFNYKLGNKFS
                     TYATWWIRQAITRAIADQARTVRIPVHMVETINKLIKTERMLTQQLGRDPTLEELTEA
                     MGGQVNGFTPKKVAD