GenomeNet

Database: RefSeq
Entry: NC_017530
LinkDB: NC_017530
Original site: NC_017530 
LOCUS       NC_017530            5731541 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Pseudomonas putida BIRD-1 chromosome, complete genome.
ACCESSION   NC_017530
VERSION     NC_017530.1  GI:386009639
DBLINK      Project: 162055
            BioProject: PRJNA162055
KEYWORDS    RefSeq.
SOURCE      Pseudomonas putida BIRD-1
  ORGANISM  Pseudomonas putida BIRD-1
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro-Tobias,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., Wu,X., van der Lelie,D., Gomez,M.J., Segura,A. and
            Ramos,J.L.
  TITLE     Complete Genome of the Plant Growth-Promoting Rhizobacterium
            Pseudomonas putida BIRD-1
  JOURNAL   J. Bacteriol. 193 (5), 1290 (2011)
   PUBMED   21183676
REFERENCE   2  (bases 1 to 5731541)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., van der Lelie,D., Gomez,M.J. and Ramos,J.-L.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Estacion Experimental del Zaidin, CSIC, C/
            Profesor Albareda 1, Granada, Granada E-18008, Spain
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002290.
            Source DNA/bacterial strain available from Amalia Roca, Bioiliberis
            R&D, Pol gono Juncaril, c/ Capileira 7, 18220 Peligros, Granada,
            Spain; aroca@bio-iliberis.com.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5731541
                     /organism="Pseudomonas putida BIRD-1"
                     /mol_type="genomic DNA"
                     /strain="BIRD-1"
                     /db_xref="taxon:931281"
     gene            complement(54..623)
                     /locus_tag="PPUBIRD1_0001"
                     /db_xref="GeneID:12522557"
     CDS             complement(54..623)
                     /locus_tag="PPUBIRD1_0001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927917.1"
                     /db_xref="GI:386009640"
                     /db_xref="GeneID:12522557"
                     /translation="MLGNSFELPSIFMRAFFLFPLLLASTLAHAELPETDWLELMPKS
                     DQKALEQMPEIDHNSPEAMGTFTAKGGLKQSKGLPAVMYSTKTVAAMNGKDIRLGGYP
                     VPLESDAKGNSTLFFLVPYPGACIHVPPPPPNQLVLVRYPKGLKIDDIYTPLWVSGKL
                     KVEKVSNDLADAAYALDAGKVRVVEDADL"
     misc_feature    complement(123..518)
                     /locus_tag="PPUBIRD1_0001"
                     /note="Protein of unknown function (DUF3299); Region:
                     DUF3299; pfam11736"
                     /db_xref="CDD:256583"
     gene            complement(636..881)
                     /locus_tag="PPUBIRD1_0002"
                     /db_xref="GeneID:12522559"
     CDS             complement(636..881)
                     /locus_tag="PPUBIRD1_0002"
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="YP_005927918.1"
                     /db_xref="GI:386009641"
                     /db_xref="GeneID:12522559"
                     /translation="MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLAT
                     YGGQALGIYQAGQAAGFLGALIGAVVLLVIYGFIKKR"
     misc_feature    complement(639..881)
                     /locus_tag="PPUBIRD1_0002"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2261"
                     /db_xref="CDD:225170"
     gene            complement(990..2072)
                     /gene="purK"
                     /locus_tag="PPUBIRD1_0003"
                     /db_xref="GeneID:12522561"
     CDS             complement(990..2072)
                     /gene="purK"
                     /locus_tag="PPUBIRD1_0003"
                     /EC_number="4.1.1.21"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="PurK"
                     /protein_id="YP_005927919.1"
                     /db_xref="GI:386009642"
                     /db_xref="GeneID:12522561"
                     /translation="MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAPLGEHL
                     RADYGDQDHLRQLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAESLRIARDRLFEK
                     SMFRDLGIPTPAFADILSQADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTPEDVVG
                     TFAELGSVPCLLEGFVPFTGEVSLVAVRGRDGETRFYPLVHNTHESGILRLSVASQAH
                     PLQALAEDYVGRVLQKLDYVGVMAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQ
                     FENHLRAVAGLPLGSTAKVGESAMLNFIGEVPAVDKVVAIGDCHLHHYGKAFKVGRKV
                     GHATLRCHDMATLERKIAEVEALISN"
     misc_feature    complement(999..2072)
                     /gene="purK"
                     /locus_tag="PPUBIRD1_0003"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Reviewed; Region: PRK06019"
                     /db_xref="CDD:235674"
     misc_feature    complement(1257..1760)
                     /gene="purK"
                     /locus_tag="PPUBIRD1_0003"
                     /note="ATP-grasp domain; Region: ATP-grasp; pfam02222"
                     /db_xref="CDD:251165"
     gene            complement(2083..2574)
                     /locus_tag="PPUBIRD1_0004"
                     /db_xref="GeneID:12522563"
     CDS             complement(2083..2574)
                     /locus_tag="PPUBIRD1_0004"
                     /EC_number="4.1.1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoribosylaminoimidazole carboxylase,
                     catalytic subunit"
                     /protein_id="YP_005927920.1"
                     /db_xref="GI:386009643"
                     /db_xref="GeneID:12522563"
                     /translation="MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPD
                     LLFQYAEEAEGRGIEVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSI
                     VQMPAGVPVATLAIGRAGAVNAALLSASILGAKYPQYHAALKQFRTEQTDTVLDNPDP
                     RQA"
     misc_feature    complement(2086..2574)
                     /locus_tag="PPUBIRD1_0004"
                     /note="Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase
                     [Nucleotide transport and metabolism]; Region: PurE;
                     COG0041"
                     /db_xref="CDD:223119"
     gene            2844..3470
                     /locus_tag="PPUBIRD1_0005"
                     /db_xref="GeneID:12522606"
     CDS             2844..3470
                     /locus_tag="PPUBIRD1_0005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927921.1"
                     /db_xref="GI:386009644"
                     /db_xref="GeneID:12522606"
                     /translation="MKTPCFFALSFGLVLSLQLPSASAAHSLTVTVYVHDDLADMHDG
                     QLNEDFFQHWLNEMRRFSQHPIEVIFQRKVKHITDIAYAGMPSEKLLDAFSQQVYAQK
                     RHRLYSLMDKHLLLTGNSYDHSGLNYNAGLAYFKQKTAIASVAAYGAAAHEVGHLLGA
                     THEDAELKFNGWVCETYTHPRVPARSNCYRYSDRNRANITEYLKDNSN"
     gene            complement(3462..4379)
                     /locus_tag="PPUBIRD1_0006"
                     /db_xref="GeneID:12522608"
     CDS             complement(3462..4379)
                     /locus_tag="PPUBIRD1_0006"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005927922.1"
                     /db_xref="GI:386009645"
                     /db_xref="GeneID:12522608"
                     /translation="MNLESKWLEDFSALAATRSFSQAAERRFVTQPAFSRRIRSLEAA
                     LGLQLVNRSRTPIELTEAGQLFLVTARTVVDQLSEILRHLHHLEGGQGEVVQVAAAHS
                     LASGFFPRWVAQLRNDGLNIATRLVATNVGDAVHALREGGCDLMLAFYDPDAALQMDA
                     EIFPSLHMGTTEMLPVCAVDADGKPLFDLEGEGSVPLLAYTAGAFLGRSVNLLLRQRN
                     LRYTTVYETAMADSLKSMALEGMGIAWVPRLSMRGELERGELAICGGSQWHVPLEIRL
                     YRCALVRKANVRLLWRKLESSGAQGEASI"
     misc_feature    complement(3498..4376)
                     /locus_tag="PPUBIRD1_0006"
                     /note="cell density-dependent motility repressor;
                     Provisional; Region: PRK10082"
                     /db_xref="CDD:182228"
     misc_feature    complement(4188..4364)
                     /locus_tag="PPUBIRD1_0006"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(3591..4097)
                     /locus_tag="PPUBIRD1_0006"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(3663..3668,3672..3677,3693..3710,
                     3996..4016,4020..4022,4032..4034,4041..4046,4050..4055))
                     /locus_tag="PPUBIRD1_0006"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            4529..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /db_xref="GeneID:12522851"
     CDS             4529..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /EC_number="4.3.1.1"
                     /note="Aspartate ammonia-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AspA"
                     /protein_id="YP_005927923.1"
                     /db_xref="GI:386009646"
                     /db_xref="GeneID:12522851"
                     /translation="MCRVKIEMIYIMSSAASFRVEKDLLGTLEVPADAYYGIQTLRAA
                     NNFHLSGVPLSHYPKLVVALAMVKQAAADANRELGHLSDAKHAAISAACARLIKGDFH
                     DQFVVDMIQGGAGTSTNMNANEVIANVALEAMGHQKGEYQYLHPNNDVNMAQSTNDAY
                     PTAIRLGLLLGHDALLASLDSLIQAFAAKGKEFDHVLKMGRTQLQDAVPMTLGQEFRA
                     FATTMTEDLQRLRSLAPELLTEINLGGTAIGTGINADPGYQALAVQRLATISGHPLVP
                     AADLIEATSDMGAFVLFSGMLKRTAVKLSKICNDLRLLSSGPRTGINEINLPARQPGS
                     SIMPGKVNPVIPEAVNQVAFAIMGNDLALTVAAEGGQLQLNVMEPLIAYKIFDSIRLL
                     QRAMDMLREHCIVGITANEQRCRELVEHSIGLVTALNPYIGYENATRIARVALESGRG
                     VLELVREEKLLDDAMLDDILRPENMIAPRLVPLKA"
     misc_feature    4568..5965
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /note="aspartate ammonia-lyase; Provisional; Region: aspA;
                     PRK12273"
                     /db_xref="CDD:237031"
     misc_feature    4583..5938
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /note="Aspartase; Region: Aspartase; cd01357"
                     /db_xref="CDD:176462"
     misc_feature    order(4865..4876,4991..4999,5132..5137,5546..5548,
                     5552..5554,5567..5569)
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /note="active sites [active]"
                     /db_xref="CDD:176462"
     misc_feature    order(5129..5140,5150..5152,5168..5173,5189..5191,
                     5201..5203,5213..5215,5270..5272,5360..5365,5372..5374,
                     5381..5386,5390..5392,5399..5404,5411..5413,5420..5425,
                     5432..5437,5441..5446,5453..5458,5606..5608,5630..5632,
                     5639..5647,5804..5806)
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_0008"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176462"
     gene            6217..7209
                     /locus_tag="PPUBIRD1_0009"
                     /db_xref="GeneID:12522555"
     CDS             6217..7209
                     /locus_tag="PPUBIRD1_0009"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005927924.1"
                     /db_xref="GI:386009647"
                     /db_xref="GeneID:12522555"
                     /translation="MLHSHLTTLNAVSLILNVFQADGCEASALLAGSGIGPADLGHAD
                     ARITTQQELQVCANAVARREDIGLELGQRMRVSCYGMLGYALLSSATLGDALRLALQY
                     PALLGTVFKLRLLDDGQRVWFSASDYHDSPALSAFNAEFCLVSLKVICDDLLGRPLPL
                     LGARFEHPRPGYHALYAEAFQCPIGFAAEDNAFAFERRWLDMPLPLADPITHKAMSER
                     CRRLNLEFTGRQAWLGRIRQLLAQQLDAAPGLEGLARQMNCSSRTLRRHLQALGSSYQ
                     QLLDELRFERAKQLLADEQMPIYRIAETLGFSETASFRHAFQRWSGVAPSHFRG"
     misc_feature    6283..6828
                     /locus_tag="PPUBIRD1_0009"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    6964..7203
                     /locus_tag="PPUBIRD1_0009"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     gene            7506..8549
                     /locus_tag="PPUBIRD1_0010"
                     /db_xref="GeneID:12518242"
     CDS             7506..8549
                     /locus_tag="PPUBIRD1_0010"
                     /codon_start=1
                     /transl_table=11
                     /product="Histone deacetylase superfamily protein"
                     /protein_id="YP_005927925.1"
                     /db_xref="GI:386009648"
                     /db_xref="GeneID:12518242"
                     /translation="MLTIYSDDHRLHHGRCELIDGKLMPCFEMPSRADHVLDQVKKRN
                     LGDIQGPTDFGRAPLLRVHSADYLDFFEGAWARWAALGHEGDLLPFTWPARTLRQVKP
                     TGLHGELGYYSFDAGAPITAGTWQAAYSAAQVALTAQAAIQQGAHAAFALCRPPGHHA
                     AGEVMGGYCYLNNAAIAAQAFLDQGRRKVAILDVDYHHGNGTQDIFYSRDDVFFASIH
                     GDPQDEFPFFLGYADETGEGAGQGYNINYPLPAGSDWTAWSAALEDACKRIASYDADV
                     LVISLGVDTFKDDPISQFKLDSPDYLEMGKRIGQLGKPTLFVMEGGYAVEEIGINAVN
                     VLEGFQRAQPGAR"
     misc_feature    7509..8522
                     /locus_tag="PPUBIRD1_0010"
                     /note="Histone deacetylase class IIa; Region:
                     HDAC_classII_APAH; cd10001"
                     /db_xref="CDD:212525"
     misc_feature    order(7977..7982,8004..8009,8088..8090,8094..8096,
                     8355..8357,8466..8468)
                     /locus_tag="PPUBIRD1_0010"
                     /note="active site"
                     /db_xref="CDD:212525"
     misc_feature    order(8088..8090,8094..8096,8355..8357)
                     /locus_tag="PPUBIRD1_0010"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:212525"
     gene            8549..9652
                     /locus_tag="PPUBIRD1_0011"
                     /db_xref="GeneID:12518243"
     CDS             8549..9652
                     /locus_tag="PPUBIRD1_0011"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter, periplasmic polyamine-binding
                     protein, putative"
                     /protein_id="YP_005927926.1"
                     /db_xref="GI:386009649"
                     /db_xref="GeneID:12518243"
                     /translation="MVRLKRLLAPFIAATLFAGALHAQAEQRTLRVYNWFDYITPQTL
                     TAFQKDSGVKLVYDIFDTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRS
                     KLPNWQHLDPALMKLIEANDPGNKFAVPYMYGTVLIGFNPAKVKAALGDNAPVDSWDL
                     IFKEENIAKLKQCGVALLDSPSEILPLALQYLGLPPNSDKPADYKKAEELMLKIRPHI
                     TYFHSSKYMADIANGDICVAVGYSGSFSQAANRAREANNGVVVDMRLPKEGAPIWFDM
                     LAIPKGAANPEDAHTFINYLLRPEVIAPISDFVGYPNPNKDATDKVNPTIRNNPNLYP
                     TAEAMAKLYTLKPLTRDAERARTRAWTRIKSGT"
     misc_feature    8561..9646
                     /locus_tag="PPUBIRD1_0011"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; cl17199"
                     /db_xref="CDD:266549"
     gene            complement(9684..11213)
                     /locus_tag="PPUBIRD1_0012"
                     /db_xref="GeneID:12518244"
     CDS             complement(9684..11213)
                     /locus_tag="PPUBIRD1_0012"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005927927.1"
                     /db_xref="GI:386009650"
                     /db_xref="GeneID:12518244"
                     /translation="MRESPLILPFDPAGIALDRSRGLSQQLYQALRARVLDGRLSSGT
                     RLPATRDLAAMLALSRNSVVRAYDQLYAEGFIESRVGDGTYVSRLPKLSTQVSTGLSL
                     GLSTGLSTFREENTEDLSSGRLFSAPLQRLKNNHLPPPRIGAPRAFRVGIPAFDLFPF
                     DVWAKLQAGFWRNPSPAQLGYGDPAGEPALRDLIAAYLRRSRGLSCTAEQIVITSGAQ
                     QAISLCAQLLLQPGDGVAVENPGYRAAAHAFTLAGGRVFGVPVNEDGLDCSRLEQLTD
                     CRLTYVTPAHQYPTGVTMSLARRLALLAWAERSDGWIIEDDYDGEYRYSGAPLAPLAA
                     LDRHGRVLYVGTFGKIAFPALRLGYLVLPSKLVQAFSQGKALAVRHSEVSSQCVMAEF
                     MARGHFQRHIRRMRKAALKRRDVLKAGWPVDIPGLGAMPEVAAGLHVKVDVDNFAREQ
                     ELVAKAEAVGVEVTPLSNFWLADCEVPVDKRAGLVLGFAAVPEGEIAEALMKLRKVWR
                     K"
     misc_feature    complement(9687..11147)
                     /locus_tag="PPUBIRD1_0012"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    complement(10953..11147)
                     /locus_tag="PPUBIRD1_0012"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(10962..10973,10977..10982,11010..11012,
                     11019..11024,11028..11042,11064..11069,11073..11075,
                     11142..11144))
                     /locus_tag="PPUBIRD1_0012"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(9699..10772)
                     /locus_tag="PPUBIRD1_0012"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(10146..10148,10167..10172,10176..10178,
                     10257..10259,10350..10352,10488..10490,10560..10568))
                     /locus_tag="PPUBIRD1_0012"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(10050..10052,10059..10061,10146..10154,
                     10278..10280,10458..10460,10557..10559))
                     /locus_tag="PPUBIRD1_0012"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(10167..10169)
                     /locus_tag="PPUBIRD1_0012"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            11303..11932
                     /locus_tag="PPUBIRD1_0013"
                     /db_xref="GeneID:12518245"
     CDS             11303..11932
                     /locus_tag="PPUBIRD1_0013"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding negative transcriptional regulator"
                     /protein_id="YP_005927928.1"
                     /db_xref="GI:386009651"
                     /db_xref="GeneID:12518245"
                     /translation="MYNSKPHQEHDLTRLHQHMLDTRLAILVSQGEQGLLATHLPVLV
                     DTAEGDFGTVYAHLARANRQWEDLQHGGEALLVFPGADAYVSPGYYPSKAENPKVVPT
                     WNYLAVHAYGPAEVIHEAEPLLSIVSRLTDRHEQGRNEPWKVTDAPADYIEGMLRAIV
                     GIRLPIARLQGARKLSQNRSRQDIDGVREGLSASPDQRDNQLAAHMRQL"
     misc_feature    11306..11809
                     /locus_tag="PPUBIRD1_0013"
                     /note="Putative FMN-binding domain; Region: FMN_bind_2;
                     pfam04299"
                     /db_xref="CDD:252513"
     gene            11944..12390
                     /locus_tag="PPUBIRD1_0014"
                     /db_xref="GeneID:12518246"
     CDS             11944..12390
                     /locus_tag="PPUBIRD1_0014"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyltransferase"
                     /protein_id="YP_005927929.1"
                     /db_xref="GI:386009652"
                     /db_xref="GeneID:12518246"
                     /translation="MPNLTLRPVTAQDHAAWHALWQAYLHFYETELADAVSLSTWQRL
                     LDPSEPTHSALAWVDGKAVGMVNFIYHRSNWSIENSCYLQDLYVDSTQRGLGIGRQLI
                     EHVYTTAKADNCIKVHWLTHETNATAISLYQQVAERSGFIQFRKGL"
     misc_feature    11980..12366
                     /locus_tag="PPUBIRD1_0014"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; pfam13673"
                     /db_xref="CDD:257979"
     misc_feature    12106..12297
                     /locus_tag="PPUBIRD1_0014"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(12199..12207,12235..12240)
                     /locus_tag="PPUBIRD1_0014"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            12398..13069
                     /locus_tag="PPUBIRD1_0015"
                     /db_xref="GeneID:12518247"
     CDS             12398..13069
                     /locus_tag="PPUBIRD1_0015"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyltransferase"
                     /protein_id="YP_005927930.1"
                     /db_xref="GI:386009653"
                     /db_xref="GeneID:12518247"
                     /translation="MTDALNWKPAAPPKAEPIEGRFIRLEKLDPGRHGEDLWEALQGP
                     ASDPVLWDYLPYGPFAERAAFDRWLEGNAAGRDPLFYTVIDRASGQAQGILSLMSIVP
                     EHGRIEIGHIAFGAAMQRTPKGTEAVYLLGKLGFALGNRRLEWKCNNANARSKRAAER
                     FGFVYEGVFRKHLVVKDHNRDTAWYSITDDEWPAVAAGFERWLSEENQQPGGQVESLE
                     MCRKG"
     misc_feature    12458..12979
                     /locus_tag="PPUBIRD1_0015"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    12662..12889
                     /locus_tag="PPUBIRD1_0015"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     gene            complement(13190..14998)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /db_xref="GeneID:12518248"
     CDS             complement(13190..14998)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /EC_number="6.4.1.1"
                     /note="pyruvate carboxylase subunit B"
                     /codon_start=1
                     /transl_table=11
                     /product="OadA"
                     /protein_id="YP_005927931.1"
                     /db_xref="GI:386009654"
                     /db_xref="GeneID:12518248"
                     /translation="MSKKIHVTDTILRDAHQSLLATRMRTEDMLPICDKLDKVGYWSL
                     EVWGGATFDACVRFLKEDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAF
                     VAKAAVNGIDVFRIFDAMNDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTIEAFVNQ
                     AKQMEAMGCDSVAIKDMAGLLTPFATGELVKALKAEQSLPVFIHSHDTAGLAAMCQLK
                     AVENGADHIDTAISSFAWGTSHPGTESMVAALKGSEFDTGLDLELLQEIGLYFYAVRK
                     KYHQFESEFTAVDTRVQVNQVPGGMISNLANQLKEQGALNRMNEVLAEIPRVREDLGF
                     PPLVTPTSQIVGTQAFFNVLAGERYKTITNEVKLYLQGGYGKAPGVVNEQLRRQAIGS
                     EEVIDVRPADLLKPEMAKLRSDIGALARCEEDVLTFAMFPDIGRKFLEEREAGTLTPE
                     VLLPIPEAGAVAAPGGEGVPTEFVIDVHGETYRVDITGVGVKAEGKRHFYLSIDGMPE
                     EVVFEPLNEFVSGGGSKRKQATDPGHVSTTMPGNIVDVLVKEGDMVKAGQAVLITEAM
                     KMETEVQAAIAGKVVAIHVAKGDRVTPGEILIEIEG"
     misc_feature    complement(13193..14995)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="pyruvate carboxylase subunit B; Validated; Region:
                     PRK09282"
                     /db_xref="CDD:236449"
     misc_feature    complement(14156..14980)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="Pyruvate carboxylase and Transcarboxylase 5S,
                     carboxyltransferase domain; Region: DRE_TIM_PC_TC_5S;
                     cd07937"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(14279..14281,14381..14383,14387..14389,
                     14474..14476,14564..14566,14747..14749,14753..14755,
                     14852..14854,14864..14866,14948..14950,14957..14962))
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="active site"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(14864..14866,14957..14962))
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(14381..14383,14387..14389,14474..14476,
                     14957..14959))
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163675"
     misc_feature    complement(order(14204..14206,14246..14248,14264..14266,
                     14294..14296,14300..14305,14345..14350,14360..14362,
                     14366..14368,14372..14374,14447..14449,14453..14455))
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="homodimer binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163675"
     misc_feature    complement(13547..14125)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="Conserved carboxylase domain; Region: PYC_OADA;
                     pfam02436"
                     /db_xref="CDD:251291"
     misc_feature    complement(13199..13399)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(13274..13276,13295..13303,13328..13330))
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(13298..13300)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_0016"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            complement(15010..16425)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /db_xref="GeneID:12518249"
     CDS             complement(15010..16425)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /EC_number="6.4.1.2"
                     /note="acetyl-CoA carboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="AccC"
                     /protein_id="YP_005927932.1"
                     /db_xref="GI:386009655"
                     /db_xref="GeneID:12518249"
                     /translation="MIKKILIANRGEIAVRIVRACAEMGIRSVAIFSDADRHALHVKR
                     ADEAHSIGAEPLAGYLNPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFI
                     GPAADVIRRMGDKTEARRTMIAAGVPVTPGTEGNVADIHEALSEGDRIGYPVMLKATS
                     GGGGRGIRRCNSREELEQNFPRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFG
                     NVVHLFERDCSIQRRNQKLIEIAPSPQLTPEQRAYIGDLAVRAAKAVNYENAGTVEFL
                     LADGEVYFMEMNTRVQVEHTITEEITGIDIVREQIRIASGLPLSVKQEDIQHRGYALQ
                     FRINAEDPKNNFLPSFGKITRYYAPGGPGVRTDTAIYTGYTIPPFYDSMCLKLVVWAL
                     TWEEAMDRGLRALDDMRVQGVKTTAAYYQEILRNPEFRSGQFNTSFVESHPELTNYSI
                     KRKPEELALAIAAAIAAHAGL"
     misc_feature    complement(15058..16425)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /note="pyruvate carboxylase subunit A; Validated; Region:
                     PRK07178"
                     /db_xref="CDD:180865"
     misc_feature    complement(16102..16422)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(15466..16086)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(15106..15426)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_0017"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            16714..17577
                     /locus_tag="PPUBIRD1_0018"
                     /db_xref="GeneID:12518250"
     CDS             16714..17577
                     /locus_tag="PPUBIRD1_0018"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005927933.1"
                     /db_xref="GI:386009656"
                     /db_xref="GeneID:12518250"
                     /translation="MTQPAVSLQIRQLEELIGQPLFEYVGKKLYLTEAAEALQRASHD
                     IFGRLESLDMQLSDMQGSLQGQLKLAIESSAKYFVPHLFAAFKQRHPEVNLTLTVVNR
                     AQAIRRLSDNRDDLIIMSMVPQDMGLEFLPFLNNPIVAVAPPQHPLCKLEQLRMQDLE
                     PHTLLVREQGSGTRKACEEYFKDKRVHFAQTLEVASADAQRECVIAGLGIALLTRHAV
                     NLELATGMLKELPVEELPLYRSWCVVQAKAKRQSPVALAFLAFIRGERALISALVERF
                     SGKLPPTTAIP"
     misc_feature    16714..17499
                     /locus_tag="PPUBIRD1_0018"
                     /note="aminoethylphosphonate catabolism associated LysR
                     family transcriptional regulator; Region: phn_lysR;
                     TIGR03339"
                     /db_xref="CDD:132382"
     misc_feature    <16714..16821
                     /locus_tag="PPUBIRD1_0018"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    16909..17499
                     /locus_tag="PPUBIRD1_0018"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(16951..16956,16960..16965,16972..16974,16984..16986,
                     16990..17010,17284..17301,17317..17322,17326..17331)
                     /locus_tag="PPUBIRD1_0018"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(17947..18813)
                     /locus_tag="PPUBIRD1_0019"
                     /db_xref="GeneID:12518251"
     CDS             complement(17947..18813)
                     /locus_tag="PPUBIRD1_0019"
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="YP_005927934.1"
                     /db_xref="GI:386009657"
                     /db_xref="GeneID:12518251"
                     /translation="MNLLQHIAQSRHLLRKSELKVADHVLLDPAAVMHSSMADLAHSV
                     GISEPTIVRFCRAIGCSGFQDLKLKLAQSLAAGASFGQFAIHEDDSVADYSLKIFDTT
                     LHTLMEVREHLDPQALQQAVSAMAQAQRVEFYGFGASGAVAADAQHKFFRLLLSAAAY
                     SDPHMQAMSAVTLKPGDVAVCISQSGRSKDLLITANLVRESGANLITLCPSQTPLAEL
                     STVNLAIDVHEDTEIYTPLTSRIAHLVVIDVLAMGVAMARGPSLVNHLKSVKRSLRSL
                     RLSPKSIKATDD"
     misc_feature    complement(17983..18813)
                     /locus_tag="PPUBIRD1_0019"
                     /note="DNA-binding transcriptional regulator HexR;
                     Provisional; Region: PRK11302"
                     /db_xref="CDD:183082"
     misc_feature    complement(18583..18813)
                     /locus_tag="PPUBIRD1_0019"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    complement(18055..18468)
                     /locus_tag="PPUBIRD1_0019"
                     /note="RpiR-like protein. RpiR contains a SIS (Sugar
                     ISomerase) domain, which is found in many phosphosugar
                     isomerases and phosphosugar binding proteins. In E. coli,
                     rpiR negatively regulates the expression of rpiB gene.
                     Both rpiB and rpiA are ribose phosphate...; Region:
                     SIS_RpiR; cd05013"
                     /db_xref="CDD:240144"
     misc_feature    complement(order(18265..18267,18397..18399))
                     /locus_tag="PPUBIRD1_0019"
                     /note="putative active site [active]"
                     /db_xref="CDD:240144"
     gene            18917..20359
                     /locus_tag="PPUBIRD1_0020"
                     /db_xref="GeneID:12518252"
     CDS             18917..20359
                     /locus_tag="PPUBIRD1_0020"
                     /EC_number="1.1.1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="YP_005927935.1"
                     /db_xref="GI:386009658"
                     /db_xref="GeneID:12518252"
                     /translation="MTIPCDILVFGGTGDLALHKLLPALYHLFREARLNPAVRVIALA
                     RRNLPRIDYLKLAERHCRAQIARSDFDEEVWQRFSARVDYFPMDASQSADFGRLARYL
                     GEPGGLTRIFYLATAPNLFVPIANHLRIAGLADTEARIVLEKPIGHSLESATAINEAI
                     GTVFEERQVFRIDHYLGKETVQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVEN
                     RGAYYDRAGAIRDMLQNHLLQLLCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDV
                     QDKTVRGQYGAGRIGGQEVPAYYFEKDVDNDSDTETFVAIEAHIDNWRWAGVPFYLRT
                     GKRMARRASQIVIQFKPVPHELFSGGQVNQLLIQLQPDERISLRMMTKSPGKGMRLEP
                     VDLDLNLAQVFSQTRRWEAYERLLLDVLEGDSTLFMRRDEVEAAWAWVDPIIKGCEEH
                     FQAPRPYPAGSFGPEQANSLLARHGRHWHG"
     misc_feature    18917..20353
                     /locus_tag="PPUBIRD1_0020"
                     /note="glucose-6-phosphate 1-dehydrogenase; Validated;
                     Region: PRK05722"
                     /db_xref="CDD:235579"
     misc_feature    18941..19465
                     /locus_tag="PPUBIRD1_0020"
                     /note="Glucose-6-phosphate dehydrogenase, NAD binding
                     domain; Region: G6PD_N; pfam00479"
                     /db_xref="CDD:249890"
     misc_feature    19469..20356
                     /locus_tag="PPUBIRD1_0020"
                     /note="Glucose-6-phosphate dehydrogenase, C-terminal
                     domain; Region: G6PD_C; pfam02781"
                     /db_xref="CDD:251528"
     gene            20574..22760
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_0021"
                     /db_xref="GeneID:12518253"
     CDS             20574..22760
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_0021"
                     /note="DNA helicase II"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrD"
                     /protein_id="YP_005927936.1"
                     /db_xref="GI:386009659"
                     /db_xref="GeneID:12518253"
                     /translation="MRTDDLSLLLNSLNDAQRQAVAATLGRQLVLAGAGSGKTRVLVH
                     RIAWLIQVEQASPHSILSVTFTNKAAAEMRQRIEQLLGINPAGMWVGTFHGLAHRLLR
                     AHWQEARLVQNFQILDSDDQQRLIKRVMRELGLDEQKWPARQAQWFINGQKDEGLRPQ
                     HIQAGGDLFLATMREVYTAYEQACERAGVIDFSELLLRALDLWRDHPGLLEHYQRRFR
                     HVLVDEFQDTNAVQYAWLRLLARGGDSLMAVGDDDQSIYGWRGAKIENIHQYTADFPD
                     AEMIRLEQNYRSTGGILKAANALIANNSGRLGKELWTDMGEGEPLTLYAAYNEHDEAR
                     YVVETIESLVKQGNARNEIAILYRSNAQSRVLEEALLRERIPYRIYGGQRFFERAEIK
                     NAMAYLRLIEGRGNDAALERVINVPPRGIGEKTVEAIREHARHSQLSMWEAMCQLLAA
                     KALKGRAASALGAFIELIEGLAAKVVDMPLHTMTQTTIEQSGLITYHQEEKGEKGQAR
                     VENLEELVSAARNFESTDEDADLSPLSAFLGHASLEAGDTQADEHEDSIQLMTLHSAK
                     GLEFPYVFLVGMEEGLFPHKMSLEEPGRLEEERRLAYVGITRAMRQLVMTYAETRRLY
                     GSETYNKVSRFVREIPAGLVQEVRLSNSVSRPFGGAKTATNSNLFANASIPQTAFNLG
                     QRVQHAVFGEGVILNFEGSGAQARVQVNFAEGSKWLMLGYAKLEAV"
     misc_feature    20619..22757
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_0021"
                     /note="DNA-dependent helicase II; Provisional; Region:
                     uvrD; PRK11773"
                     /db_xref="CDD:236976"
     misc_feature    20628..20864
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_0021"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    <22251..22421
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_0021"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            22892..23746
                     /locus_tag="PPUBIRD1_0022"
                     /db_xref="GeneID:12518254"
     CDS             22892..23746
                     /locus_tag="PPUBIRD1_0022"
                     /codon_start=1
                     /transl_table=11
                     /product="Import inner membrane translocase"
                     /protein_id="YP_005927937.1"
                     /db_xref="GI:386009660"
                     /db_xref="GeneID:12518254"
                     /translation="MQRFLSIALALCVGLTLSLDASAKRFGGGKSSGSAPIHQTRQAT
                     PTTPAAAPTAPGRAPAAASGASRWLGPLAGLAAGGLLASMFMGDGFEGFQIMDFLIVA
                     LIAFLVFRFIAARRRQQQPQMAMPGHAPMQREAHAQPAQPSIFGGSAAPAATAAPVIN
                     APAWFNEQSFLAAARNHFQSLQQHWDANEMDKISEFVTPQMLEFLKRERAELGDGFQS
                     TYIDNLEVQLDGVDDRADRTDATLTFRGVSKNSRFDQGEVFSESWHMVRAQGENQPWL
                     VAGIRQNG"
     misc_feature    23183..>23317
                     /locus_tag="PPUBIRD1_0022"
                     /note="Chitin synthesis regulation, resistance to Congo
                     red; Region: RCR; pfam12273"
                     /db_xref="CDD:256946"
     misc_feature    23363..23737
                     /locus_tag="PPUBIRD1_0022"
                     /note="Tim44-like domain; Region: Tim44; pfam04280"
                     /db_xref="CDD:252500"
     gene            23860..24267
                     /locus_tag="PPUBIRD1_0023"
                     /db_xref="GeneID:12518255"
     CDS             23860..24267
                     /locus_tag="PPUBIRD1_0023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927938.1"
                     /db_xref="GI:386009661"
                     /db_xref="GeneID:12518255"
                     /translation="MEEVIEQLREANEPVPVPLELPDEDQLVEIEEQLFINIPFVFKE
                     FLLTVSDVVYGSLEPVTVTDPQSHTYLPDVASNAWDAGVPRDLIPLCQDGDNYYCVEE
                     DGTVVLWDAEEEIVGEDSWESVWHWARDVWLES"
     misc_feature    23860..24258
                     /locus_tag="PPUBIRD1_0023"
                     /note="SMI1-KNR4 cell-wall; Region: SUKH_5; pfam14567"
                     /db_xref="CDD:258705"
     gene            complement(24426..26186)
                     /locus_tag="PPUBIRD1_0024"
                     /db_xref="GeneID:12518256"
     CDS             complement(24426..26186)
                     /locus_tag="PPUBIRD1_0024"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium/hydrogen exchanger"
                     /protein_id="YP_005927939.1"
                     /db_xref="GI:386009662"
                     /db_xref="GeneID:12518256"
                     /translation="MHAISFIQDLAVIMLIAGVVTILFHRLKQPVVLGYIVAGFIIGP
                     HTPPFGLIHDEETIKILAELGVIFLMFCLGLEFSLRKLFKVGATAFIAAFLEIVLMIW
                     IGFEIGRWFGWSTMDSLFLGAILAISSTTIIVKALNDLKMKNERFAQLIFGVLIVEDI
                     LGIGIIALLSGIAVSGTVSSGEVFSTVGKLSLFMIVALVIGILLVPRLLAYVAKFESN
                     EMLLITVLGLCFGFCLLVVKLEYSMVLGAFLIGAIMAESRQLLKIERLIEPVRDLFSA
                     IFFVAIGLMIDPQVLIDYAWPIVVITLAVVLGKMLSCGMGAFIAGNDGRTSLRVGMGL
                     SQIGEFSFIIAALGMTLQVTSDFLYPVAVAVSAITTLLTPYLIRAADPLSQKLGNVVP
                     ARLARVLSLYGEWLRNIQPQGESAMLAAMIRRILLQVGVNLALVIAIFFSGGYFAGRI
                     GNWLSEWVSDVSQQKAVIWGAALLLSLPFLIAAYRKLKALSMLLAEMGVKPEMAGRHT
                     QRVRRVIAEVIPLLSLLVIFLLLSALSASILPTSELLLVIAVVAAVVVALLWRWFIRV
                     HTRMQIALLETLENSRENSH"
     misc_feature    complement(25053..26186)
                     /locus_tag="PPUBIRD1_0024"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     gene            26526..27011
                     /locus_tag="PPUBIRD1_0025"
                     /db_xref="GeneID:12518257"
     CDS             26526..27011
                     /locus_tag="PPUBIRD1_0025"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase superfamily protein"
                     /protein_id="YP_005927940.1"
                     /db_xref="GI:386009663"
                     /db_xref="GeneID:12518257"
                     /translation="MEPGNAQLSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASR
                     YAGSYVVTLSVDQVIFREPVHVGELVTFLASVNYTGNTSMEVGIKVVTENIRERSVRH
                     SNSCFFTMVAVDDNRRPVPVPPRQPHSSEEKRRFLQGQQRRQIRQELEKRYQDLKTDA
                     I"
     misc_feature    26544..26873
                     /locus_tag="PPUBIRD1_0025"
                     /note="Brown fat-inducible thioesterase (BFIT).  Brain
                     acyl-CoA hydrolase (BACH).  These enzymes deacylate
                     long-chain fatty acids by hydrolyzing acyl-CoA thioesters
                     to free fatty acids and CoA-SH. Eukaryotic members of this
                     family are expressed in brain, testis; Region: BFIT_BACH;
                     cd03442"
                     /db_xref="CDD:239526"
     gene            complement(27008..27880)
                     /locus_tag="PPUBIRD1_0026"
                     /db_xref="GeneID:12518258"
     CDS             complement(27008..27880)
                     /locus_tag="PPUBIRD1_0026"
                     /EC_number="2.7.1.35"
                     /codon_start=1
                     /transl_table=11
                     /product="Pyridoxamine kinase"
                     /protein_id="YP_005927941.1"
                     /db_xref="GI:386009664"
                     /db_xref="GeneID:12518258"
                     /translation="MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNAWPLNTVQFS
                     NHTQYGQWAGEVLAPAQIPALVEGISNIGELGHCDAVLSGYLGSAEQGRAILAGVERI
                     KAVNPKALYLCDPVMGHPEKGCIVPPEVSEFLLDEAAATADILCPNQLELDSFSGRRA
                     QSLEDCVNMARSLLERGPQVVLVKHLAYPGRAEEQFEMLLVTAEQSWHLRRPLLAFPR
                     QPVGVGDLTSGLFLARVLLGDSWVQAFEFTAAAVHEVLLETQACASYELQLVRAQDRI
                     AHPRVRFEAQLLAL"
     misc_feature    complement(27098..27862)
                     /locus_tag="PPUBIRD1_0026"
                     /note="Pyridoxal kinase plays a key role in the synthesis
                     of the active coenzyme pyridoxal-5'-phosphate  (PLP), by
                     catalyzing the phosphorylation of the precursor vitamin B6
                     in the presence of Zn2+ and ATP. Mammals are unable to
                     synthesize PLP de novo and...; Region:
                     pyridoxal_pyridoxamine_kinase; cd01173"
                     /db_xref="CDD:238578"
     misc_feature    complement(order(27206..27208,27215..27220,27620..27622,
                     27626..27628,27725..27727,27740..27745,27752..27754,
                     27821..27826,27845..27847))
                     /locus_tag="PPUBIRD1_0026"
                     /note="pyridoxal binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238578"
     misc_feature    complement(order(27665..27667,27686..27691,27710..27712,
                     27716..27721,27746..27748,27755..27757,27764..27781,
                     27794..27796,27803..27805,27815..27817,27827..27829,
                     27833..27838,27842..27844))
                     /locus_tag="PPUBIRD1_0026"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238578"
     misc_feature    complement(order(27113..27115,27125..27127,27200..27202,
                     27206..27214,27221..27223,27239..27244,27248..27250,
                     27293..27295,27326..27331,27428..27430,27437..27439,
                     27443..27445,27524..27526,27539..27541))
                     /locus_tag="PPUBIRD1_0026"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238578"
     gene            28001..28393
                     /locus_tag="PPUBIRD1_0027"
                     /db_xref="GeneID:12518259"
     CDS             28001..28393
                     /locus_tag="PPUBIRD1_0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927942.1"
                     /db_xref="GI:386009665"
                     /db_xref="GeneID:12518259"
                     /translation="MLTLENLFVLMLVATAGAWLWHNHGLREKALERVKQHCAKLDLE
                     LLDDAVALKRIAFVRDANGRKRLARVYAFEFTVTGEQRHPGTATQFGAHSVQIELAPY
                     PFEIKTPPRADNVIEMQQWRQEHNRWRN"
     misc_feature    28016..28306
                     /locus_tag="PPUBIRD1_0027"
                     /note="Protein of unknown function (DUF3301); Region:
                     DUF3301; pfam11743"
                     /db_xref="CDD:256589"
     gene            complement(28394..29365)
                     /locus_tag="PPUBIRD1_0028"
                     /db_xref="GeneID:12518260"
     CDS             complement(28394..29365)
                     /locus_tag="PPUBIRD1_0028"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin synthesis protein"
                     /protein_id="YP_005927943.1"
                     /db_xref="GI:386009666"
                     /db_xref="GeneID:12518260"
                     /translation="MLQNIPTHVIAGPLGAGKTTLIRHLLAQRPANERWAVLINEFGL
                     VGLDAAILSRDEDGIAIGEVAGGCLCCVNGMPFQVGLGRLLRKSRPDRLFIEPSGLGH
                     PLQLLAQLQQAPWVGVLTIQPLLMVVDAQAMARNEPLPEAQQQAFNASESVVFNKSEA
                     VDEIHKLLISNQFKEKRIMWTVQGQLPLSGLPTVSPQIVDSPFLKNRIVDNPGIAPAA
                     LWADPSLPICLVQQGEGGWSIGWRWHPGQQFYPQRLKAFLYAWPWRRAKGVIHSMEGW
                     WSFNGLNGDMPAWQPSDWRKDTRIELIFDQPQPQPALQAGLDECRVS"
     misc_feature    complement(28406..29353)
                     /locus_tag="PPUBIRD1_0028"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    complement(28877..29350)
                     /locus_tag="PPUBIRD1_0028"
                     /note="CobW/HypB/UreG, nucleotide-binding domain; Region:
                     cobW; pfam02492"
                     /db_xref="CDD:251330"
     misc_feature    complement(28406..28648)
                     /locus_tag="PPUBIRD1_0028"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; smart00833"
                     /db_xref="CDD:214844"
     gene            complement(29406..30032)
                     /locus_tag="PPUBIRD1_0029"
                     /db_xref="GeneID:12518261"
     CDS             complement(29406..30032)
                     /locus_tag="PPUBIRD1_0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927944.1"
                     /db_xref="GI:386009667"
                     /db_xref="GeneID:12518261"
                     /translation="MNLAHRPVDIFQVFGETPQVLAEVLQDGVNLAVWRRRLPAQLED
                     FAALVLSLGQPLADQRVIDVDEEQKPVLPDLLREAADLHGYEAFVADVTWLVAAYTCL
                     VGARRVGLRLRVLDSPMCPRFHVDNVPLRLLTTYVGPGSEWLQERVSGRGELHTAQPS
                     VDNIQQLQAGEVAILKGEKWQGNEGAGLVHRSPSAQQGRLLLSLDWLA"
     misc_feature    complement(29418..29996)
                     /locus_tag="PPUBIRD1_0029"
                     /note="Protein of unknown function (DUF1826); Region:
                     DUF1826; pfam08856"
                     /db_xref="CDD:255073"
     gene            complement(30029..31276)
                     /locus_tag="PPUBIRD1_0030"
                     /db_xref="GeneID:12518262"
     CDS             complement(30029..31276)
                     /locus_tag="PPUBIRD1_0030"
                     /codon_start=1
                     /transl_table=11
                     /product="Cobalamin synthesis protein"
                     /protein_id="YP_005927945.1"
                     /db_xref="GI:386009668"
                     /db_xref="GeneID:12518262"
                     /translation="MHRFECVCLKGFAMSNRLPVTVLSGFLGAGKSTLLNHVLRNRDK
                     LRVAVIVNDMSEINIDASEVQRNVSLNRAEEKLVEMSNGCICCTLREDLLEEVARLAE
                     EGRFDYLLIESTGISEPLPVAETFTFRDELGRSLSDMARLDTMVTVVDGLNFLRDYQA
                     ADSLASRGETLGEEDERSISDLLIEQVEFADVLLLSKIDLISQHEREELIAILRSLNA
                     RAQIVPMVMGQVPLARILDTGLFDFDQAAQAPGWLQELRGEHVPETEEYGIAAMTWQA
                     RRPLHPQRFYDFIHKNWENGRLLRSKGFFWLASKYQEAGSWSQAGGMMRHGLAGRWWR
                     FVPREQWPQDVDNTNAILKHWTAETGDCRQELVFIGQNIDVEKLSTALDACLLTDKEM
                     GLGHMGWLRLPDPFGPWHEEAAA"
     misc_feature    complement(30113..31225)
                     /locus_tag="PPUBIRD1_0030"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    complement(30605..31222)
                     /locus_tag="PPUBIRD1_0030"
                     /note="CobW/HypB/UreG, nucleotide-binding domain; Region:
                     cobW; pfam02492"
                     /db_xref="CDD:251330"
     misc_feature    complement(30119..30472)
                     /locus_tag="PPUBIRD1_0030"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; smart00833"
                     /db_xref="CDD:214844"
     gene            31345..31731
                     /locus_tag="PPUBIRD1_0031"
                     /db_xref="GeneID:12518263"
     CDS             31345..31731
                     /locus_tag="PPUBIRD1_0031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927946.1"
                     /db_xref="GI:386009669"
                     /db_xref="GeneID:12518263"
                     /translation="MKMNLPRVMALLVLTMPASLLAMPQNSALALCTRSATLLACQDG
                     KGNYYSVRTEGSTFYLRGYDFSSRRLWAQTNSRYGTLTFFSGLASNGEAWVGYSRRVG
                     WTTLNRVSSSSGERFKLHCSLIEGCR"
     gene            31771..31941
                     /locus_tag="PPUBIRD1_0032"
                     /db_xref="GeneID:12518264"
     CDS             31771..31941
                     /locus_tag="PPUBIRD1_0032"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative GTP cyclohydrolase"
                     /protein_id="YP_005927947.1"
                     /db_xref="GI:386009670"
                     /db_xref="GeneID:12518264"
                     /translation="MHISFERLLKTPALISRSQDEKLCRNRVEAMVENEMFHVELFVS
                     LPTSGTGHARLL"
     gene            complement(32000..32527)
                     /locus_tag="PPUBIRD1_0033"
                     /db_xref="GeneID:12518265"
     CDS             complement(32000..32527)
                     /locus_tag="PPUBIRD1_0033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927948.1"
                     /db_xref="GI:386009671"
                     /db_xref="GeneID:12518265"
                     /translation="MKIRLPLLALALGMSSPLVQAQMLQPGLWELTTSNMQVDGKPLP
                     DMEFMLGQLKNLPPEQRAMMEGVLAKQGVSVGGKGVRSCLTPEQVATNDIPLQDPKSG
                     CTQKITDRTGNVWKFQFSCPKAQGSGQATFLSDREFTTQVSGTFNASGVQQQGSMNTR
                     AVWLGNDCGTVKPRS"
     misc_feature    complement(32021..32521)
                     /locus_tag="PPUBIRD1_0033"
                     /note="Protein of unknown function (DUF3617); Region:
                     DUF3617; pfam12276"
                     /db_xref="CDD:256949"
     gene            32660..34099
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /db_xref="GeneID:12518266"
     CDS             32660..34099
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="Cardiolipin synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927949.1"
                     /db_xref="GI:386009672"
                     /db_xref="GeneID:12518266"
                     /translation="MDYHSPYFFGYLLGLIHLLGIVAALHALFTVRTAQGAIAWAMPL
                     LFIPYLTLIPYLIFGARSFYAYIKARRQANQEMHVAMANLNWRPWVEEALTARESESY
                     TALRAMPKLGRMPCLANNQVKLLINGKATFDAIFAAIEKARDVVLVQFFIIHDDTLGK
                     ALQQLLLRKAAEGVQVFVLYDRVGSHALPASYSQMLRDGGVQIHAFATRRGWFNRFQV
                     NFRNHRKIVVVDGLLGFIGGHNVGDEYLGEHPQLSPWRDTHVQISGPVLACLQESFAE
                     DWYWATRQLPPLILPDTYPDNGVLCQALASGPADPQETCSLFFLEAIHSATRRVWITS
                     PYFIPDEAVFAALRLAVLRGVDVRVLIPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQ
                     PGFLHQKVVLVDDDVSAIGSANLDNRSFRLNFEITLLTVDRGFADQVEHMLQEDFEHA
                     REITAEDTQDTHRLQQLGMRIARLISPIL"
     misc_feature    32723..34096
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="cardiolipin synthetase; Reviewed; Region: cls;
                     PRK01642"
                     /db_xref="CDD:234967"
     misc_feature    32723..32836
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="Phospholipase_D-nuclease N-terminal; Region:
                     PLDc_N; pfam13396"
                     /db_xref="CDD:257721"
     misc_feature    33035..33502
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="Putative catalytic domain, repeat 1, of Pseudomonas
                     aeruginosa cardiolipin synthase and similar proteins;
                     Region: PLDc_PaCLS_like_1; cd09155"
                     /db_xref="CDD:197252"
     misc_feature    order(33326..33328,33332..33334,33371..33373,33377..33379,
                     33428..33430)
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="putative active site [active]"
                     /db_xref="CDD:197252"
     misc_feature    33326..33328
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197252"
     misc_feature    33569..34096
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="Putative catalytic domain, repeat 2, of Pseudomonas
                     aeruginosa cardiolipin synthase and similar proteins;
                     Region: PLDc_PaCLS_like_2; cd09161"
                     /db_xref="CDD:197258"
     misc_feature    order(33848..33850,33854..33856,33893..33895,33899..33901,
                     33932..33934)
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="putative active site [active]"
                     /db_xref="CDD:197258"
     misc_feature    33848..33850
                     /gene="cls"
                     /locus_tag="PPUBIRD1_0034"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197258"
     gene            complement(34182..35366)
                     /locus_tag="PPUBIRD1_0035"
                     /db_xref="GeneID:12518267"
     CDS             complement(34182..35366)
                     /locus_tag="PPUBIRD1_0035"
                     /EC_number="2.1.1.79"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /protein_id="YP_005927950.1"
                     /db_xref="GI:386009673"
                     /db_xref="GeneID:12518267"
                     /translation="MLAQLPPALQSLHLPLRLKLWDGNQFDLGPSPQVTILVKEPQLI
                     SQLTHPSMDQLGTAFVEGKLELEGDIGEAIRVCDELSEALLADEDETPPPRVSHDKST
                     DAKAISYHYDVSNAFYQLWLDQDMAYSCAYFREPDNTLDQAQQDKFDHLCRKLRLDAG
                     DYLLDVGCGWGGLARFAAREYGAKVFGITLSKEQLKLGRKRVQAEGLADKVDLQILDY
                     RDLPQDGRFDKVVSVGMFEHVGHANLALYCQKLFGAVREGGVVMNHGITAKHVDGRPV
                     GRGAGEFIDRYVFPHGELPHLSMISASICEAGLEVVDVESLRLHYAKTLHHWSENLEN
                     QLHKAAALVPEKTLRIWRLYLAGCAYAFQKGWINLHQILAVKPYADGHHDLPWTREDL
                     YR"
     misc_feature    complement(34239..35075)
                     /locus_tag="PPUBIRD1_0035"
                     /note="Cyclopropane fatty acid synthase and related
                     methyltransferases [Cell envelope biogenesis, outer
                     membrane]; Region: Cfa; COG2230"
                     /db_xref="CDD:225139"
     misc_feature    complement(34581..34880)
                     /locus_tag="PPUBIRD1_0035"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(34668..34670,34713..34721,34797..34802,
                     34851..34871))
                     /locus_tag="PPUBIRD1_0035"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            35574..36974
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /db_xref="GeneID:12518268"
     CDS             35574..36974
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /EC_number="1.8.1.4"
                     /note="Dihydrolipoyl dehydrogenase 3"
                     /codon_start=1
                     /transl_table=11
                     /product="Lpd3"
                     /protein_id="YP_005927951.1"
                     /db_xref="GI:386009674"
                     /db_xref="GeneID:12518268"
                     /translation="MKSYDVVIIGGGPGGYNAAIRAGQLGLSVACVEGRSTLGGTCLN
                     VGCMPSKALLHASELYEAASGDEFAHLGIEVKPTLNLAQMMKQKDESVTGLTKGIEYL
                     FRKNKVEWIKGWGRLDGIGKVVVKAEDGSETALQAKDIVIATGSEPTPLPGVTVDNQR
                     IIDSTGALSLPQVPKHLVVIGAGVIGLELGSVWRRLGSQVTVIEYLDRICPGTDTETA
                     KTLQKALAKQGMVFKLGSKVTQATAGADGVSLTLEPAAGGTAESLQADYVLVAIGRRP
                     YTKGLNLESVGLEADKRGMLGNEHHRTSVPGVWVIGDVTSGPMLAHKAEDEAVACIER
                     IAGKPHEVNYNLIPGVIYTRPEMATVGKTEEQLKAEGRAYKVGKFPFTANSRAKINHE
                     TEGFAKVIADAETDEVLGVHLVGPSVSEMIGEFCVAMEFSASAEDIALTCHPHPTRSE
                     ALRQAAMNVDGMAMQI"
     misc_feature    35574..36971
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /note="dihydrolipoamide dehydrogenase; Reviewed; Region:
                     PRK06115"
                     /db_xref="CDD:180409"
     misc_feature    35934..>36143
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    36099..36332
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     misc_feature    36612..36941
                     /gene="lpd3"
                     /locus_tag="PPUBIRD1_0036"
                     /note="Pyridine nucleotide-disulphide oxidoreductase,
                     dimerization domain; Region: Pyr_redox_dim; pfam02852"
                     /db_xref="CDD:251571"
     gene            complement(37045..38052)
                     /locus_tag="PPUBIRD1_0037"
                     /db_xref="GeneID:12518269"
     CDS             complement(37045..38052)
                     /locus_tag="PPUBIRD1_0037"
                     /codon_start=1
                     /transl_table=11
                     /product="Transketolase family protein"
                     /protein_id="YP_005927952.1"
                     /db_xref="GI:386009675"
                     /db_xref="GeneID:12518269"
                     /translation="MSRVNTTETGKKRLTTSAMIASIAAEGQATRSAPFGHALAALAE
                     QRSDIVGLSADLSKYTDLHIFAKAHPERFYQMGMAEQLLMSAAAGMAREGCVPFATTY
                     AVFASRRAYDFICMAIAEENLNVKIVCGLPGLTTGYGPSHQATDDLAIFRAMPNLMIV
                     DPCDALEIEQAVPAIAAHQGPVYMRLLRGNVPLVLDEYGYKFEIGKAKTLRTGKDVLI
                     ISTGLMTMRSLEAAAHLQKDGVDVAVLHVPTIKPLDEQTILAEARKSGRLVVTAENHS
                     IIGGLGEAVAGLLLRNGVTPTFRQVALPDAFLDAGALPTLHDRYGISTDAVSAQIKAW
                     L"
     misc_feature    complement(37048..37986)
                     /locus_tag="PPUBIRD1_0037"
                     /note="Transketolase, C-terminal subunit [Carbohydrate
                     transport and metabolism]; Region: COG3958"
                     /db_xref="CDD:226467"
     misc_feature    complement(37489..37950)
                     /locus_tag="PPUBIRD1_0037"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(37516..37518,37579..37584,37630..37632,
                     37639..37641,37714..37719,37726..37728,37783..37791,
                     37795..37800,37807..37824,37828..37830,37837..37839,
                     37888..37890,37906..37908,37912..37914))
                     /locus_tag="PPUBIRD1_0037"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(37588..37590,37594..37599,37603..37608,
                     37633..37635,37639..37641,37720..37722,37726..37731,
                     37813..37821,37828..37830,37888..37890))
                     /locus_tag="PPUBIRD1_0037"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(37726..37728,37738..37740,37813..37815,
                     37819..37821))
                     /locus_tag="PPUBIRD1_0037"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(37072..37440)
                     /locus_tag="PPUBIRD1_0037"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            complement(38049..38897)
                     /locus_tag="PPUBIRD1_0038"
                     /db_xref="GeneID:12518270"
     CDS             complement(38049..38897)
                     /locus_tag="PPUBIRD1_0038"
                     /codon_start=1
                     /transl_table=11
                     /product="Transketolase family protein"
                     /protein_id="YP_005927953.1"
                     /db_xref="GI:386009676"
                     /db_xref="GeneID:12518270"
                     /translation="MTVNAPDTSLSALAERAYNIRRHALRMGQVQGQGYVGQALGAAD
                     LLAVSYFHALRYQPHNPEWEQRDRFYLSIGHYAIALYAALIEAGVIPLEELETYGSDD
                     SRLPMSGMAAYTPGMEITGGSLGHGLGIAVGACLGLKRKKSDSFVYNLLSDGELNEGS
                     TWEAAMSASHWKLNNLIAIIDVNNQQADGYSSEVLAFEPIVDRWQAFGWFTQRVDGND
                     IGALVAAFDAARNHQGAQPRVIICDTKMGKGVDFLESREKTHFIRVDENEWDLALQNL
                     QVGRIV"
     misc_feature    complement(38079..38846)
                     /locus_tag="PPUBIRD1_0038"
                     /note="Thiamine pyrophosphate (TPP) family, Transketolase
                     (TK) subfamily, TPP-binding module; TK catalyzes the
                     transfer of a two-carbon unit from ketose phosphates to
                     aldose phosphates. In heterotrophic organisms, TK provides
                     a link between glycolysis and the...; Region: TPP_TK;
                     cd02012"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(38118..38120,38337..38339,38343..38345,
                     38349..38351,38424..38426,38436..38441,38526..38528,
                     38532..38534,38673..38675))
                     /locus_tag="PPUBIRD1_0038"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(38289..38291,38337..38342,38388..38390,
                     38400..38402,38409..38414,38421..38432,38520..38522,
                     38526..38531,38568..38570,38574..38579,38601..38603))
                     /locus_tag="PPUBIRD1_0038"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238970"
     gene            complement(38916..40217)
                     /locus_tag="PPUBIRD1_0039"
                     /db_xref="GeneID:12518271"
     CDS             complement(38916..40217)
                     /locus_tag="PPUBIRD1_0039"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator transporter"
                     /protein_id="YP_005927954.1"
                     /db_xref="GI:386009677"
                     /db_xref="GeneID:12518271"
                     /translation="MITTLSLDAVSAVRSNAYRKTAWRLMPFLMLCYLCAYLDRVNVG
                     FAKLQMMSDLALSEAVYGLGAGMFFIGYFLCEVPSNLILHRVGARRWIARIMISWGII
                     SALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPSYRRAKMTVLWFVAIPLS
                     GMIGGPLSGWIMNQFAGFHGWAGWQWMFVIEAIPTVIVGLLVLTYLKDGVHQATWLTD
                     EEKELVTKELAEDNAHKVTHASPREFIRDRRLWLLACIYFCVVMGQYAITFWLPTLIR
                     NAGVSDPLHIGMLTSLPYMCAIVAMLLMGRSGDKHRERRWHLVVPMIAGAIGLTLAAL
                     LGGNLLLSVLSLCLAAAGVLSASSLFWMLPTTLLGGVSAAAGIAGINSFANLAGFCSP
                     YLIGWITTSTGSSAIGMYLITAVLLAGATLVLRIPAASVNR"
     misc_feature    complement(38937..40136)
                     /locus_tag="PPUBIRD1_0039"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(38940..40127)
                     /locus_tag="PPUBIRD1_0039"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    complement(order(39054..39056,39063..39068,39075..39080,
                     39087..39092,39123..39125,39132..39137,39147..39149,
                     39156..39161,39168..39170,39315..39317,39327..39329,
                     39336..39338,39348..39350,39360..39362,39402..39404,
                     39411..39416,39423..39428,39435..39437,39735..39737,
                     39753..39758,39765..39770,39804..39806,39813..39818,
                     39825..39830,39837..39842,39978..39983,39987..39992,
                     40002..40004,40011..40016,40023..40025,40074..40079,
                     40083..40091,40098..40100))
                     /locus_tag="PPUBIRD1_0039"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(40285..41034)
                     /locus_tag="PPUBIRD1_0040"
                     /db_xref="GeneID:12518272"
     CDS             complement(40285..41034)
                     /locus_tag="PPUBIRD1_0040"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_005927955.1"
                     /db_xref="GI:386009678"
                     /db_xref="GeneID:12518272"
                     /translation="MLLQGKVAIITGAASARGIGRATAATFAAQGARVVILDLDEAAA
                     RDAAASLGEGHLGLAANVADQAQVNQAVAQIIEHYGRIDVLVNNAGITQPLKTLDIKH
                     SDYDKVLDVSLRGTLLMSQAVIPLMREQRSGSIVCMSSVSAQRGGGIFGGPHYSAAKA
                     GVLGLAKAMARELGPDNVRVNAIAPGLIHTDITGGLMQDDRRHAIIDGIPLGRLGEAQ
                     DVANAALFLASDLSTYLTGITLDVNGGMLIH"
     misc_feature    complement(40294..41034)
                     /locus_tag="PPUBIRD1_0040"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(40297..41019)
                     /locus_tag="PPUBIRD1_0040"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(40471..40482,40558..40560,40570..40572,
                     40615..40623,40765..40773,40915..40923,40978..40980,
                     40984..40986,40993..40995,40999..41001))
                     /locus_tag="PPUBIRD1_0040"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(40558..40560,40570..40572,40615..40617,
                     40699..40701))
                     /locus_tag="PPUBIRD1_0040"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            41331..42146
                     /locus_tag="PPUBIRD1_0041"
                     /db_xref="GeneID:12518273"
     CDS             41331..42146
                     /locus_tag="PPUBIRD1_0041"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005927956.1"
                     /db_xref="GI:386009679"
                     /db_xref="GeneID:12518273"
                     /translation="MLDLTPSAVSHQLAKLEAMIGRQLFFRAARGVSLTPVGEQYLKD
                     VSGILHSLSVATERASSDVSLDCLRLHSSPSFGLLWLMPRLEAFRMAHPDIQINLSCS
                     YESLHFSRDKIDVDIRHGEPNWPSYEVRTLGNEAFAVLASPKLLARHRIDDASDLLRR
                     DLILSEATLLKWPAWFARHGLARPEKPYALSFDRSYMSLEAASHGLGFALESTLLAQK
                     YLASGTLVEVVPHIFSAPVAAHHLVFPKAHSGFERVRRFLAWMERELGHGFVF"
     misc_feature    41334..42122
                     /locus_tag="PPUBIRD1_0041"
                     /note="putative choline sulfate-utilization transcription
                     factor; Region: chol_sulf_TF; TIGR03418"
                     /db_xref="CDD:188320"
     misc_feature    <41334..41447
                     /locus_tag="PPUBIRD1_0041"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    41532..42113
                     /locus_tag="PPUBIRD1_0041"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    order(41532..41552,41556..41609,41613..41633)
                     /locus_tag="PPUBIRD1_0041"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    order(41547..41552,41556..41558,41907..41915,41973..41975)
                     /locus_tag="PPUBIRD1_0041"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            complement(42305..43342)
                     /locus_tag="PPUBIRD1_0042"
                     /db_xref="GeneID:12518274"
     CDS             complement(42305..43342)
                     /locus_tag="PPUBIRD1_0042"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005927957.1"
                     /db_xref="GI:386009680"
                     /db_xref="GeneID:12518274"
                     /translation="MSQPLYRRVVPETYVQLLYEYLEALGHEPESVLGQPWPTPAQEG
                     VGGVDVECWDRLLLTAAQALDDPLLGLHVGQTISARHIGVLGSVLLACGNFGTAMQRL
                     ERYIRLVYDVIPMTRRDGDGWFELVWDVSQYQPGPLVNETGMVAIVQFCRALVRGTAN
                     PLRIDFNHPSPLDTSPYEAFFGCPVRFGQAEAVLRFSAQLLELPFKSPDPALVSLLEQ
                     HADRLLAQLPQQDEFVEQLRKTITHALREGEPSIERISPQLGTSSRTLQRRLQEAGTS
                     FRYELNLVRHELALSYLRDPRLQIVDIAMLLGYSEHSAFTRAFKEWSGRSPHEARQLN
                     SESYWAGSPWN"
     misc_feature    complement(42728..43267)
                     /locus_tag="PPUBIRD1_0042"
                     /note="Arabinose-binding domain of AraC transcription
                     regulator, N-term; Region: Arabinose_bd; pfam12625"
                     /db_xref="CDD:257172"
     misc_feature    complement(42350..42598)
                     /locus_tag="PPUBIRD1_0042"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    complement(42347..42454)
                     /locus_tag="PPUBIRD1_0042"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            43440..44396
                     /locus_tag="PPUBIRD1_0043"
                     /db_xref="GeneID:12518275"
     CDS             43440..44396
                     /locus_tag="PPUBIRD1_0043"
                     /codon_start=1
                     /transl_table=11
                     /product="X-Pro dipeptidyl-peptidase family protein"
                     /protein_id="YP_005927958.1"
                     /db_xref="GI:386009681"
                     /db_xref="GeneID:12518275"
                     /translation="MMTLQPFQQMPFMNTITDLLAPATIQFFSNGSRCVADFYRPLGA
                     GPFPVVVMAHGLGGTRKMRLPAFATRFAAAGYACLVFDYRHFGDSDGEPRQLLDINRQ
                     LEDWKAAIDHARRHADVDSQRVVIWGTSFGGGHVLATAADDARVAAVISQCPFTDGLS
                     SSLATELLVSLRLTLLALADRIGSWFGAKPILVPLAGQPGDTAFMTSPDAWSGYNGLI
                     PSGAHIRKEAAARFALDIIRYYPGRSTPRIQAPVLFCVCDPDSVAPAKQTLRHARRAP
                     RHEIHRYAHGHFDIYVGKAFEQVVGDQLDFLKRNVPSTPTKR"
     misc_feature    43551..>43715
                     /locus_tag="PPUBIRD1_0043"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    43587..44303
                     /locus_tag="PPUBIRD1_0043"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    43638..>43823
                     /locus_tag="PPUBIRD1_0043"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            44401..45264
                     /locus_tag="PPUBIRD1_0044"
                     /db_xref="GeneID:12518276"
     CDS             44401..45264
                     /locus_tag="PPUBIRD1_0044"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_005927959.1"
                     /db_xref="GI:386009682"
                     /db_xref="GeneID:12518276"
                     /translation="MYDLQGKVVLITGAAGGIGAASARELYVQGASLVLTDTSQEAVD
                     KLAQEFNSQRVLPLAFDVTDAEAAKAVIRQAVERFGRLDVAFANAGISWRGVPATLRT
                     CDEAEFRRIIEVDLFGVWHAMRAALPEVVRNRGQVLVTSSTYAYLNGMANAPYAASKA
                     AVESLARSLRAELSATGASASVLYPGWTATAIAKVAFGGNAIATQMNETLLPAFLHRA
                     IAPEQVARGVVRGLQKRQPRIVVPARWAPISLLRGLFNVFTDWHLTRDAHLQRLLHQL
                     EEETVRTQSPS"
     misc_feature    44401..45240
                     /locus_tag="PPUBIRD1_0044"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK05872"
                     /db_xref="CDD:235633"
     misc_feature    44470..45087
                     /locus_tag="PPUBIRD1_0044"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(44509..44517,44578..44586,44662..44670,44740..44742,
                     44818..44826,44863..44865,44875..44877,44953..44964,
                     44968..44973)
                     /locus_tag="PPUBIRD1_0044"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(44743..44745,44824..44826,44863..44865,44875..44877)
                     /locus_tag="PPUBIRD1_0044"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            45293..46159
                     /locus_tag="PPUBIRD1_0045"
                     /db_xref="GeneID:12518277"
     CDS             45293..46159
                     /locus_tag="PPUBIRD1_0045"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_005927960.1"
                     /db_xref="GI:386009683"
                     /db_xref="GeneID:12518277"
                     /translation="MKSYSLNDRVIAITGATGGLGRAAAQALRDKGAKLVLLDLDLDS
                     LNAMAVTLGGPNVAVGWVANVRSIESLETALKEAAQHFGGIDVVVAGAGVSSVVALEH
                     IDPATFDRVIDINLNGVARTFRASLPHVKARQGYLLAISSMAAFVHSPLNTAYTASKA
                     GVWALCDSLRLELRQHGVSVGSLHPTFFQTPMMEAIVDGPSSTLVWNNHQGIWQFVAL
                     EQVVAALVDCIEQRHDLVTVPRSQMLVAKAPGLLRRLIEWIGFDAGKVAEAVRLSDEV
                     KASLGQGRSLNE"
     misc_feature    45308..45964
                     /locus_tag="PPUBIRD1_0045"
                     /note="oxidoreductase, SDR family; Region: SDR_subfam_1;
                     TIGR03971"
                     /db_xref="CDD:234422"
     misc_feature    45323..45892
                     /locus_tag="PPUBIRD1_0045"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(45335..45337,45341..45352,45407..45415,45479..45487,
                     45563..45571,45632..45634,45710..45718,45755..45757,
                     45767..45769,45845..45856,45860..45865)
                     /locus_tag="PPUBIRD1_0045"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(45635..45637,45716..45718,45755..45757,45767..45769)
                     /locus_tag="PPUBIRD1_0045"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            46425..47744
                     /locus_tag="PPUBIRD1_0046"
                     /db_xref="GeneID:12518278"
     CDS             46425..47744
                     /locus_tag="PPUBIRD1_0046"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein precursor"
                     /protein_id="YP_005927961.1"
                     /db_xref="GI:386009684"
                     /db_xref="GeneID:12518278"
                     /translation="MKINGCEIPCLSAQRKCAAWVKYTSVMALLSASTIAGANGIALN
                     EQSASSAGTAYAGRSSSALDASTIYGNPAGLTKLKRAEISGGAAIISGSDDISDAQSS
                     VAGTNRGDSVPLTILPFAYMSTPLDDRFSIGLGLYAPSGLINEYESTFQGRYQGSYSS
                     TKEVTLQPTIAYRINDYVSIGGGPTINHFDAELQNYLASGALNNGQDTEITLKGDDTA
                     IGYNVGLLVDLSDATSWGINYHSKVSYHLKGHTEVSGSPSVIPLDGKYDNKIDITMPE
                     SVDTSITHHFNSRWTGYLGTTWKRWSRLKKIEAINSDVSALGQSAGLERVDEPLNWHD
                     TWSTAVGTSFQLNQQWLLRAGYAYDPSPISNADRSVRVPVGNRQVVTLGGAYLPSPDL
                     TIDFAYGYLWESKASVNQANNSGLQPEYSANYENSANIFLVQASYRY"
     misc_feature    46506..47741
                     /locus_tag="PPUBIRD1_0046"
                     /note="Long-chain fatty acid transport protein [Lipid
                     metabolism]; Region: FadL; COG2067"
                     /db_xref="CDD:224978"
     gene            complement(48338..49579)
                     /locus_tag="PPUBIRD1_0047"
                     /db_xref="GeneID:12518279"
     CDS             complement(48338..49579)
                     /locus_tag="PPUBIRD1_0047"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane porin"
                     /protein_id="YP_005927962.1"
                     /db_xref="GI:386009685"
                     /db_xref="GeneID:12518279"
                     /translation="MNIHANRKSLVLVIPTLLLPINVWAEGFVEDTSATLTLRNFFFE
                     RNFTAPGVTQSHAREWTQGFIFDLKSGFTQGTVGFGVDVLGKYAVKLDGGAGEYGALL
                     LPKDGDGDPAGSFGRLGVALKAKLSNTEVKVGEWMPNFPIVTADDFRALPQTFRGAQI
                     ASQELKNWSFYAGEFTKTSLRNDSSMEDLSFGSAQSDSFTFLGADYRSSSKNTTVRLW
                     SGELEDIYKQHYLGLIQKWQLSQTVSLTSNLGYFWGKDTGVAKAGSLDNQTASALFSL
                     NIAQHSISIGLQNVSGDSGWMRIGGTGGIYLANNTFNHAFDNPRERSWQVRYDLNFVG
                     YGIPGLTLMTRYVHGDNVELRNVKDGSEWVRESELGYVFQSGKLRDLAVRWRNSSVRR
                     NFNASDYDENRLIVSYPLNIF"
     misc_feature    complement(48344..49504)
                     /locus_tag="PPUBIRD1_0047"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            complement(49794..50723)
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /db_xref="GeneID:12518280"
     CDS             complement(49794..50723)
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /EC_number="4.2.1.52"
                     /note="dihydrodipicolinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein DapA"
                     /protein_id="YP_005927963.1"
                     /db_xref="GI:386009686"
                     /db_xref="GeneID:12518280"
                     /translation="MSTKNTIDLKGLVPAPVTPFTRDGEVDYAAIQKLGAWLGSYEGV
                     KGLVVLGHAGEGTFLTQAEQGRVIQAFKESVGGRLPIIAGITGEGTQVAAEEAKRAVD
                     NGAAAGLVYPSHGWLRFGYQKGAAQDRYKAIYEESGLPLILFQYPDVTKATYDLETQL
                     EIAKQPGVFAMKNGVRNMRRWDTEIPVIRREVPDLQILTCHDEYLLHTMFDVDGALVG
                     YGGLTPEPLIELIAAGKRRDYPAARAIHDKLLPVTRNVYHRGSHMEGTVALKHGLVAR
                     GILDHATVRSPLLPLAEGADKEIADALRSAGLV"
     misc_feature    complement(49815..50690)
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(50208..50210,50292..50294,50565..50573,
                     50580..50582,50679..50681))
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(50076..50078,50208..50210,50292..50294,
                     50565..50573,50580..50582))
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(49863..49868,50337..50339,50352..50354,
                     50379..50384,50454..50459,50550..50555,50568..50570))
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(50208..50210)
                     /gene="dapA"
                     /locus_tag="PPUBIRD1_0048"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(50847..52238)
                     /locus_tag="PPUBIRD1_0049"
                     /db_xref="GeneID:12518281"
     CDS             complement(50847..52238)
                     /locus_tag="PPUBIRD1_0049"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator transporter"
                     /protein_id="YP_005927964.1"
                     /db_xref="GI:386009687"
                     /db_xref="GeneID:12518281"
                     /translation="MLMQQVETDPLPDKVKSQANISARLERLPITKQVFWARNIIGAA
                     TFFDGYTVIAIAYAMPVLAKEWSLSGAQIGMILSAGYLGQLFGALIFGWLAEKLGRMK
                     VLTFTILLFVSMDVACLFASSAAMMIAFRFIQGIGTGGEVPVASAYINELIGSKKRGK
                     FFLLYEVMFLLGLVGAGIIGYFLVPIYGWQAMFAVGIVPAMLLIPLRFFLFESPRWLA
                     SKGRLDEADRIVTRLENSALKAGKTLQPPVEVPQIQTDKNGLGWKELFKGMYFKRSLV
                     IWAMWFGAYMVANGLITWLPTLYRQHFNLPLETSLAYGFMTSAGGVVAAVICALLIDK
                     VGRRRWYMGALFLAAIPLAILATTGASAPLKILALAGLGYALVQTVTFSLYLYSAELY
                     PTRLRALGTGVGSAWLRMGSALGPIIVGFTVSGAGVQYVFGTFAVVLLITATITALFA
                     IETKGRILEELSP"
     misc_feature    complement(50976..52136)
                     /locus_tag="PPUBIRD1_0049"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    complement(50889..52121)
                     /locus_tag="PPUBIRD1_0049"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(51003..51005,51012..51017,51024..51029,
                     51036..51041,51072..51074,51081..51086,51105..51107,
                     51114..51119,51126..51128,51264..51266,51276..51278,
                     51285..51287,51297..51299,51309..51311,51351..51353,
                     51360..51365,51372..51377,51384..51386,51720..51722,
                     51738..51743,51750..51755,51789..51791,51798..51803,
                     51810..51815,51822..51827,51963..51968,51972..51977,
                     51987..51989,51996..52001,52008..52010,52059..52064,
                     52068..52076,52083..52085))
                     /locus_tag="PPUBIRD1_0049"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(53099..53218)
                     /locus_tag="PPUBIRD1_0050"
                     /db_xref="GeneID:12518282"
     CDS             complement(53099..53218)
                     /locus_tag="PPUBIRD1_0050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927965.1"
                     /db_xref="GI:386009688"
                     /db_xref="GeneID:12518282"
                     /translation="MAFSSSALSEAKIRDLALSSIRPQLSSIEGMVNHLKQQK"
     gene            54295..55695
                     /locus_tag="PPUBIRD1_0051"
                     /db_xref="GeneID:12518283"
     CDS             54295..55695
                     /locus_tag="PPUBIRD1_0051"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Histidine kinase"
                     /protein_id="YP_005927966.1"
                     /db_xref="GI:386009689"
                     /db_xref="GeneID:12518283"
                     /translation="MKLRNPNLAARFIGLMLLALIVSQALTLSIFWDERAGALREVAK
                     SDFLSRTSSLASLLDRMPVDERQMTLQVSSTAYERFWLFPASPSQPSEWWKFARRHLL
                     EPLSHGKPQGTLSIQFRSEDEVPPATIDATAAWSVPGEALWPSPRTARFIYLPQLNVM
                     GVATPLNNGTWLHAAYAKPVTDSPFSRRALVSLGITALALTLIAVLIARGISQPLRDL
                     ALAAQRLGRGHSGTELREHGPEDIRRTAKAFNQMQRRIQRFVDDRTRMLAAVGHDLRT
                     PLTSLRLRVEFIQDPEVQRKMLATLDEITAITEAAIGYGRDNAVTEPTRTMDIGTLVE
                     SLCEDLVTLGMAVSFSCNSKVILECRPDALRRAIRNLIENAVRYGECADVRVYSADKH
                     VHISVTDRGNGIPDSELEAVFTPFYRLEHSRNRNTGGVGLGLSIVRSIARQHGGEITL
                     INHNGGLEAIISLPEN"
     misc_feature    54448..55638
                     /locus_tag="PPUBIRD1_0051"
                     /note="heavy metal sensor kinase; Region: cztS_silS_copS;
                     TIGR01386"
                     /db_xref="CDD:233391"
     misc_feature    54925..55068
                     /locus_tag="PPUBIRD1_0051"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(54925..54930,54937..54942,54946..54951,54958..54963,
                     54967..54969,55015..55020,55024..55029,55036..55041,
                     55045..55050,55057..55062)
                     /locus_tag="PPUBIRD1_0051"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    55081..>55203
                     /locus_tag="PPUBIRD1_0051"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(55090..55092,55102..55104,55114..55116,55123..55125,
                     55135..55137,55144..55146,55183..55185,55195..55197)
                     /locus_tag="PPUBIRD1_0051"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    55108..55110
                     /locus_tag="PPUBIRD1_0051"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    55384..55683
                     /locus_tag="PPUBIRD1_0051"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(55402..55404,55414..55416,55423..55425,55483..55485,
                     55489..55491,55495..55497,55501..55506,55585..55596,
                     55642..55644,55648..55650,55660..55665,55669..55671)
                     /locus_tag="PPUBIRD1_0051"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    55414..55416
                     /locus_tag="PPUBIRD1_0051"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(55495..55497,55501..55503,55585..55587,55591..55593)
                     /locus_tag="PPUBIRD1_0051"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            55903..56640
                     /locus_tag="PPUBIRD1_0052"
                     /db_xref="GeneID:12518284"
     CDS             55903..56640
                     /locus_tag="PPUBIRD1_0052"
                     /codon_start=1
                     /transl_table=11
                     /product="Regulatory protein, IclR"
                     /protein_id="YP_005927967.1"
                     /db_xref="GI:386009690"
                     /db_xref="GeneID:12518284"
                     /translation="MEAFTAESDELTLSQIAAKAELDPGTTYRMLNTLVDLGYVSRIP
                     ESKRFSLTLKILNLGFHAIAHTDLRSLVRPVLRGLVSETSEAASFAVLQGADVLYLER
                     VRAGITRLGVDIRIGTTVPACQTAIGQSILAFLPDHEVERIKELSSSTSFMSKSLSRP
                     LSEVLEQIRKDGYIITESLFAEGLRILAVPVLDIDGYPVGAISIAAPAVRCTTEELER
                     RALSVTIAAAKNIGRALQASGSINSSL"
     misc_feature    55903..56613
                     /locus_tag="PPUBIRD1_0052"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    55906..56139
                     /locus_tag="PPUBIRD1_0052"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    56227..56604
                     /locus_tag="PPUBIRD1_0052"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            57087..57782
                     /locus_tag="PPUBIRD1_0053"
                     /db_xref="GeneID:12518285"
     CDS             57087..57782
                     /locus_tag="PPUBIRD1_0053"
                     /EC_number="2.8.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacid CoA-transferase subunit A"
                     /protein_id="YP_005927968.1"
                     /db_xref="GI:386009691"
                     /db_xref="GeneID:12518285"
                     /translation="MINKTFESIASAVEGIIDGSTIMVGGFGTAGMPSELIDGLIATG
                     ARDLTIISNNAGNGEIGLAALLKAGCVRKVVCSFPRQSDSYVFDELYRAGKIELEVVP
                     QGNLAERIRAAGSGIGAFFSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAH
                     KGDRWGNLVYRKAARNFGPIMAMAAKTAIAQVDQIVELGELDQEHIITPGIFVQRVVA
                     VSGAAASSIINAA"
     misc_feature    57087..57749
                     /locus_tag="PPUBIRD1_0053"
                     /note="3-oxoacid CoA-transferase, A subunit; Region:
                     pcaI_scoA_fam; TIGR02429"
                     /db_xref="CDD:131482"
     gene            57791..58432
                     /locus_tag="PPUBIRD1_0054"
                     /db_xref="GeneID:12518286"
     CDS             57791..58432
                     /locus_tag="PPUBIRD1_0054"
                     /EC_number="2.8.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacid CoA-transferase subunit B"
                     /protein_id="YP_005927969.1"
                     /db_xref="GI:386009692"
                     /db_xref="GeneID:12518286"
                     /translation="MSITKKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANFLGDKE
                     VFLHSENGLLGMGPSPAPEEEDDDLINASKEHVTMLPGGAFFHHADSFSMMRGGHLDI
                     AVLGAFQVSVKGDLANWHTGAEGSIPAVGGAMDLATGARQVFVMMNHLTKSGESKLVP
                     ECTYPPTGFGCVSRIYTDMAVLEVTSDGLRVVEICAEIDFEQLQALSGVPLIQ"
     misc_feature    57809..58426
                     /locus_tag="PPUBIRD1_0054"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            complement(58778..60613)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /db_xref="GeneID:12518287"
     CDS             complement(58778..60613)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /EC_number="2.6.1.16"
                     /note="Glucosamine--fructose-6-phosphate aminotransferase
                     [isomerizing]"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GlmS"
                     /protein_id="YP_005927970.1"
                     /db_xref="GI:386009693"
                     /db_xref="GeneID:12518287"
                     /translation="MCGIVGAIAERNITAILIEGLKRLEYRGYDSAGLAVLTQNGELQ
                     RRRRIGKVSELEVAVADDPLAGQLGIAHTRWATHGAPTEGNAHPHFSGNDVAVVHNGI
                     IENHEELREELKGLGYVFTSQTDTEVIVHLIHHTLKSLPNLTDALKAAVKRLHGAYGL
                     ALISAKQPDRLVAARSGSPLVIGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRR
                     DQVSIWDQQGNKVQRETVQYHEGAEAADKGAYRHFMLKEIHEQPSVVQRTLEGRLGKD
                     NVLVQAFGPQAADLFAKVRNVQIVACGTSYHAGMVARYWLESLAGIPCQVEVASEFRY
                     RKVVVQPDTLFVSISQSGETADTLAALRNAKELGFLGSLAICNVGISSLVRESDLTLL
                     TLAGPEIGVASTKAFTTQLVSLMLLTLALGQVRGTLEAGAEAELVEELRRLPTRLGEA
                     LAMDATVEKIAELFADKHHTLFLGRGAQYPVAMEGALKLKEISYIHAEAYPAGELKHG
                     PLALVDNDMPVVTVAPNNELLEKLKSNLQEVRARGGELVVFADEHAGMTNGEGTHVIK
                     VPHIADALAPILYTIPLQLLSYYVAVLKGTDVDQPRNLAKSVTVE"
     misc_feature    complement(58781..60613)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="glucosamine--fructose-6-phosphate aminotransferase;
                     Reviewed; Region: PRK00331"
                     /db_xref="CDD:234729"
     misc_feature    complement(59966..60610)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="Glutamine amidotransferases class-II
                     (Gn-AT)_GFAT-type. This domain is found at the N-terminus
                     of glucosamine-6P synthase (GlmS, or GFAT in humans).  The
                     glutaminase domain catalyzes amide nitrogen transfer from
                     glutamine to the appropriate substrate. In...; Region:
                     GFAT; cd00714"
                     /db_xref="CDD:238366"
     misc_feature    complement(order(60236..60241,60311..60316,60353..60355,
                     60380..60385,60389..60394,60533..60535,60608..60610))
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="glutaminase active site [active]"
                     /db_xref="CDD:238366"
     misc_feature    complement(59348..59728)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(59546..59548,59612..59614,59621..59623,
                     59633..59635,59639..59641,59660..59665,59672..59677,
                     59705..59710))
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(59561..59569,59699..59704))
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    complement(58787..59245)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(58790..58792,58805..58810,59000..59005,
                     59009..59011,59021..59026,59075..59086,59090..59098,
                     59102..59104,59114..59116,59120..59122,59126..59128,
                     59132..59134,59144..59146,59186..59188))
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(59141..59143,59150..59152))
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_0055"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            complement(60617..61393)
                     /locus_tag="PPUBIRD1_0056"
                     /db_xref="GeneID:12518288"
     CDS             complement(60617..61393)
                     /locus_tag="PPUBIRD1_0056"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_005927971.1"
                     /db_xref="GI:386009694"
                     /db_xref="GeneID:12518288"
                     /translation="MSKRNTPQRRHNILALLSEQGEVSVDALAKRFATSEVTIRKDLA
                     ALETNGLLLRRYGGAVPVPQELLGEPAQPVSSYKKAIARAAVGRIREHARIIIDSGST
                     TAAMIPELGRQPGLVVMTNSLNVARAICDLEHEPVLLMTGGTWDPHSESFQGQVAEQV
                     LRSYDFDQLFIGADGIDLGRGTTTFNELLGLSRVMAEVAREVIVMVESDKVGRKIPNL
                     ELPWGSVHTLITDERLPAAAREQIQARGVNLICAAISQEQ"
     misc_feature    complement(60644..61372)
                     /locus_tag="PPUBIRD1_0056"
                     /note="DNA-bindng transcriptional repressor SrlR;
                     Provisional; Region: srlR; PRK10434"
                     /db_xref="CDD:182457"
     misc_feature    complement(61214..61369)
                     /locus_tag="PPUBIRD1_0056"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(60698..61162)
                     /locus_tag="PPUBIRD1_0056"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /db_xref="GeneID:12518289"
     CDS             complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /EC_number="2.7.7.23"
                     /EC_number="2.3.1.157"
                     /note="UDP-N-acetylglucosamine pyrophosphorylase;
                     bifunctional"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GlmU"
                     /protein_id="YP_005927972.1"
                     /db_xref="GI:386009695"
                     /db_xref="GeneID:12518289"
                     /translation="MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLQ
                     PQGIHVVIGHGAELVRERLAADDLNFVMQDKQLGTGHAVAQALPALTADTVLVLYGDV
                     PLIEVETLQRLLAKANDQQLGLLTVTLDDPTGYGRIVRDEQGKVTAIVEHKDASDAQK
                     AIKEGNTGILALPAARLADWMGRLSNNNAQGEYYLTDVIAMAVADGLVVATEQPHDAM
                     EVQGANDRRQLSELERHYQLREGRRLMAQGVTLRDPARFDVRGEVSVGRDVLIDINVI
                     LEGKVVIEDDVQIGPNCVIKNTTLRKGAVVKANSHLEGAVMGEGSDAGPFARLRPGSV
                     LDAKAHVGNFVELKNTHLGEGAKAGHLTYLGDAEIGARTNIGAGTITCNYDGANKFKT
                     VMGEDVFIGSNNSLVAPVEIKAGATTAAGSTITQAVDAGDLAVARARQRNISGWKRPE
                     KIKKS"
     misc_feature    complement(61602..62951)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="UDP-N-acetylglucosamine
                     diphosphorylase/glucosamine-1-phosphate
                     N-acetyltransferase; Region: glmU; TIGR01173"
                     /db_xref="CDD:233299"
     misc_feature    complement(62271..62945)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="N-terminal domain of bacterial GlmU; Region:
                     GT2_GlmU_N_bac; cd02540"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(62655..62657,62661..62663,62712..62714,
                     62721..62723,62805..62807,62928..62936))
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    complement(order(62286..62288,62655..62657))
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="Mg++ binding site; other site"
                     /db_xref="CDD:133020"
     misc_feature    complement(61638..62216)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="N-acetyl-glucosamine-1-phosphate uridyltransferase
                     (GlmU), C-terminal left-handed beta-helix (LbH)
                     acetyltransferase domain: GlmU is also known as
                     UDP-N-acetylglucosamine pyrophosphorylase. It is a
                     bifunctional bacterial enzyme that catalyzes two...;
                     Region: LbH_GlmU_C; cd03353"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(61647..61649,61698..61703,61752..61757,
                     61761..61763,61791..61793,61806..61814,61827..61838,
                     61869..61871,61878..61880,61914..61916,61920..61922,
                     61968..61970))
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="active site"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(61791..61793,61809..61811,61830..61838,
                     61869..61871,61878..61880,61914..61916,61920..61922,
                     61968..61970))
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100044"
     misc_feature    complement(order(61647..61649,61698..61703,61752..61757,
                     61806..61808,61812..61814,61827..61829))
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_0057"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100044"
     gene            complement(63076..63489)
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /db_xref="GeneID:12518290"
     CDS             complement(63076..63489)
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="ATP synthase epsilon chain"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpC"
                     /protein_id="YP_005927973.1"
                     /db_xref="GI:386009696"
                     /db_xref="GeneID:12518290"
                     /translation="MTVHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLITNL
                     KPGPITLTKQGGAQEVFYISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAAEN
                     ALNLKGADFDYGAAAARLAEAAAQLRTVQQMRKGK"
     misc_feature    complement(63088..63489)
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="F0F1 ATP synthase subunit epsilon; Validated;
                     Region: atpC; PRK00571"
                     /db_xref="CDD:234796"
     misc_feature    complement(63151..63480)
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="mitochondrial ATP synthase delta subunit; Region:
                     F1-ATPase_delta; cd12152"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(63250..63258,63262..63264,63280..63297,
                     63364..63378,63442..63444,63451..63453,63457..63465,
                     63472..63474))
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(63202..63204,63223..63225,63229..63234,
                     63241..63243,63247..63252,63292..63300,63304..63306,
                     63352..63354,63358..63363,63409..63411,63457..63459))
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213395"
     misc_feature    complement(order(63334..63336,63376..63384,63388..63390,
                     63394..63396,63400..63405,63421..63423,63427..63429))
                     /gene="atpC"
                     /locus_tag="PPUBIRD1_0058"
                     /note="LBP interface [polypeptide binding]; other site"
                     /db_xref="CDD:213395"
     gene            complement(63539..64915)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /db_xref="GeneID:12518291"
     CDS             complement(63539..64915)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /EC_number="3.6.3.14"
                     /note="ATP synthase subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="AtpB"
                     /protein_id="YP_005927974.1"
                     /db_xref="GI:386009697"
                     /db_xref="GeneID:12518291"
                     /translation="MSSGRIVQIIGAVIDVEFPRDVVPSVYNALKVQGAETTLEVQQQ
                     LGDGVVRTIAMGSTEGLKRGLDVVDTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGE
                     EERRGIHQPAPSFADQAGGNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMME
                     LIRNIAMEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRV
                     ALTGLTMAEKFRDEGNDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGV
                     LQERITSTKEGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVD
                     PLDSTSRQLDPNVIGNEHYETARGVQYVLQRYKELKDIIAILGMDELSEADKQLVARA
                     RKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFSGILKGDYDHLPEQAFYMVGSIDE
                     AIEKAKKL"
     misc_feature    complement(63542..64915)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="F0F1 ATP synthase subunit beta; Validated; Region:
                     PRK09280"
                     /db_xref="CDD:236447"
     misc_feature    complement(64703..64900)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    complement(63881..64696)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="F1 ATP synthase beta subunit, nucleotide-binding
                     domain. The F-ATPase is found in bacterial plasma
                     membranes, mitochondrial inner membranes and in
                     chloroplast thylakoid membranes. It has also been found in
                     the archaea Methanosarcina barkeri. It uses a...; Region:
                     F1-ATPase_beta; cd01133"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(63893..63895,63899..63901,63905..63910,
                     63935..63940,63971..63979,63983..63985,64004..64006,
                     64016..64021,64028..64030,64079..64081,64100..64102,
                     64112..64114,64127..64132,64136..64144,64160..64162,
                     64172..64174,64181..64183,64271..64273,64286..64294,
                     64358..64360,64367..64375,64556..64558,64562..64564,
                     64568..64573,64577..64579,64628..64630))
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="alpha subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(64451..64471)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(63926..63931,64181..64183,64193..64195,
                     64364..64366,64373..64378,64448..64456,64463..64465))
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(64193..64207)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238553"
     misc_feature    complement(order(63908..63913,63929..63931,63935..63937))
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238553"
     misc_feature    complement(63542..63859)
                     /gene="atpB"
                     /locus_tag="PPUBIRD1_0059"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            complement(64943..65803)
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /db_xref="GeneID:12518292"
     CDS             complement(64943..65803)
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /note="ATP synthase gamma chain"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpG"
                     /protein_id="YP_005927975.1"
                     /db_xref="GI:386009698"
                     /db_xref="GeneID:12518292"
                     /translation="MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRP
                     YAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKD
                     MSANREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSINDLIGSVKVMLDAY
                     LDGRIDRLSVVSNKFINTMTQKPTVEQLVPLVATPDQDLKHHWDYLYEPDAKELLDGL
                     MVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAITQEI
                     SEIVGGAAAV"
     misc_feature    complement(64955..65800)
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /note="mitochondrial ATP synthase gamma subunit; Region:
                     F1-ATPase_gamma; cd12151"
                     /db_xref="CDD:213394"
     misc_feature    complement(order(64955..64972,64976..64978,64985..64990,
                     64997..65002,65006..65011,65018..65020,65036..65038,
                     65045..65050,65057..65059,65420..65422,65429..65434,
                     65441..65446,65534..65545,65549..65551,65711..65716,
                     65723..65728,65732..65737,65744..65746,65756..65758,
                     65774..65776,65789..65791))
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /note="core domain interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213394"
     misc_feature    complement(order(65141..65143,65150..65155,65162..65164,
                     65648..65653,65660..65662,65669..65674,65678..65683))
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /note="delta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     misc_feature    complement(order(65141..65146,65153..65155,65387..65404,
                     65435..65437))
                     /gene="atpG"
                     /locus_tag="PPUBIRD1_0060"
                     /note="epsilon subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213394"
     gene            complement(65852..67396)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /db_xref="GeneID:12518293"
     CDS             complement(65852..67396)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /EC_number="3.6.3.14"
                     /note="ATP synthase subunit alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AtpA"
                     /protein_id="YP_005927976.1"
                     /db_xref="GI:386009699"
                     /db_xref="GeneID:12518293"
                     /translation="MQQLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHG
                     LADVMYGEMIEFPGGVYGMALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGK
                     ELLGRVVDALGNPIDGKGPLGNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPV
                     GRGQRELIIGDRQIGKTAMAIDAIINQKDSGIFCVYVAVGQKRSTVANIVRKLEENGA
                     LANTIVVVASASESAALQFLAPYAGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISL
                     LLRRPPGREAYPGDVFYLHSRLLERASRVSEEYVEKFTNGAVTGKTGSLTALPIIETQ
                     AGDVSAFVPTNVISITDGQIFLESAMFNSGIRPAVNAGVSVSRVGGAAQTKIIKKLSG
                     GIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPMSIADMALSLY
                     AAERGFLIDVEVSKIGSFEQALIAFFNRDHAELMAKINVKGDFNDEIDAGLKAGIEKF
                     KATQTW"
     misc_feature    complement(65864..67390)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="F0F1 ATP synthase subunit alpha; Validated; Region:
                     PRK09281"
                     /db_xref="CDD:236448"
     misc_feature    complement(67118..67309)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    complement(66260..67114)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="F1 ATP synthase alpha, central domain. The F-ATPase
                     is found in bacterial plasma membranes, mitochondrial
                     inner membranes and in chloroplast thylakoid membranes. It
                     has also been found in the archaea Methanosarcina barkeri.
                     It uses a proton gradient to...; Region: F1_ATPase_alpha;
                     cd01132"
                     /db_xref="CDD:238552"
     misc_feature    complement(order(66266..66268,66299..66301,66308..66313,
                     66344..66346,66353..66355,66497..66499,66509..66511,
                     66518..66520,66530..66532,66545..66550,66554..66562,
                     66578..66583,66764..66766,66773..66778,66782..66793,
                     66878..66883,66971..66973,66977..66979,66986..66991,
                     66995..67000,67046..67051))
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="beta subunit interaction interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    complement(66866..66889)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    complement(order(66266..66268,66296..66301,66314..66316,
                     66353..66355,66401..66403,66599..66601,66608..66613,
                     66794..66796,66809..66811,66863..66871,66881..66883))
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238552"
     misc_feature    complement(66611..66625)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238552"
     misc_feature    complement(65966..66235)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_0061"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            complement(67418..67954)
                     /gene="atpH"
                     /locus_tag="PPUBIRD1_0062"
                     /db_xref="GeneID:12518294"
     CDS             complement(67418..67954)
                     /gene="atpH"
                     /locus_tag="PPUBIRD1_0062"
                     /note="ATP synthase subunit delta"
                     /codon_start=1
                     /transl_table=11
                     /product="AtpH"
                     /protein_id="YP_005927977.1"
                     /db_xref="GI:386009700"
                     /db_xref="GeneID:12518294"
                     /translation="MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTM
                     QRLLKAPRLTSAEKAATFIDVCGDKFNAQAQNFIHVAAENDRLLLLPEIAALFDLYKA
                     EQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDASLIGGVVIRAGDLV
                     IDGSVRGKIAKLAEALKS"
     misc_feature    complement(67421..67954)
                     /gene="atpH"
                     /locus_tag="PPUBIRD1_0062"
                     /note="F0F1 ATP synthase subunit delta; Validated; Region:
                     PRK05758"
                     /db_xref="CDD:235593"
     gene            complement(67967..68437)
                     /gene="atpF"
                     /locus_tag="PPUBIRD1_0063"
                     /db_xref="GeneID:12518295"
     CDS             complement(67967..68437)
                     /gene="atpF"
                     /locus_tag="PPUBIRD1_0063"
                     /note="ATP synthase subunit b"
                     /codon_start=1
                     /transl_table=11
                     /product="AtpF"
                     /protein_id="YP_005927978.1"
                     /db_xref="GI:386009701"
                     /db_xref="GeneID:12518295"
                     /translation="MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGL
                     DAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVK
                     AQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI"
     misc_feature    complement(67970..68437)
                     /gene="atpF"
                     /locus_tag="PPUBIRD1_0063"
                     /note="F0F1 ATP synthase subunit B; Validated; Region:
                     PRK05759"
                     /db_xref="CDD:180240"
     misc_feature    complement(67970..68407)
                     /gene="atpF"
                     /locus_tag="PPUBIRD1_0063"
                     /note="F0F1 ATP synthase subunit B; Provisional; Region:
                     PRK14471; cl17192"
                     /db_xref="CDD:266543"
     gene            complement(68896..69765)
                     /gene="atpB_2"
                     /locus_tag="PPUBIRD1_0064"
                     /db_xref="GeneID:12518296"
     CDS             complement(68896..69765)
                     /gene="atpB_2"
                     /locus_tag="PPUBIRD1_0064"
                     /note="ATP synthase subunit a"
                     /codon_start=1
                     /transl_table=11
                     /product="AtpB_2"
                     /protein_id="YP_005927979.1"
                     /db_xref="GI:386009702"
                     /db_xref="GeneID:12518296"
                     /translation="MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAF
                     HLDTLGWSVALGLIFLLIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSP
                     VIAPLALTIFVWVFLMNAVDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAF
                     CVFALIIFYSIKVKGLGGFIGELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISL
                     ALRLFGNMYAGELVFILIAVMFGSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMML
                     TIVYLSMAHEDNH"
     misc_feature    complement(68899..69651)
                     /gene="atpB_2"
                     /locus_tag="PPUBIRD1_0064"
                     /note="F0F1 ATP synthase subunit A; Validated; Region:
                     PRK05815"
                     /db_xref="CDD:235617"
     gene            complement(69782..70189)
                     /gene="atpI"
                     /locus_tag="PPUBIRD1_0065"
                     /db_xref="GeneID:12518297"
     CDS             complement(69782..70189)
                     /gene="atpI"
                     /locus_tag="PPUBIRD1_0065"
                     /note="ATP synthase protein I"
                     /codon_start=1
                     /transl_table=11
                     /product="AtpI protein"
                     /protein_id="YP_005927980.1"
                     /db_xref="GI:386009703"
                     /db_xref="GeneID:12518297"
                     /translation="MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGY
                     SGLCGGLIAWLPNVYFAWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGV
                     KPLAPLAVFGVFVLTLLVSWFAPLLMNKRLSRP"
     misc_feature    complement(69791..70177)
                     /gene="atpI"
                     /locus_tag="PPUBIRD1_0065"
                     /note="F0F1 ATP synthase subunit I; Validated; Region:
                     PRK05760"
                     /db_xref="CDD:180241"
     gene            complement(70339..71211)
                     /gene="parB"
                     /locus_tag="PPUBIRD1_0066"
                     /db_xref="GeneID:12518298"
     CDS             complement(70339..71211)
                     /gene="parB"
                     /locus_tag="PPUBIRD1_0066"
                     /note="parB-like partition protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ParB family partitioning protein"
                     /protein_id="YP_005927981.1"
                     /db_xref="GI:386009704"
                     /db_xref="GeneID:12518298"
                     /translation="MAVKKRGLGRGLDALLSGPSVSALEEQAVKIDQKELQHLPVELV
                     QRGKYQPRRDMDPEALEELAHSIRNHGVMQPIVVRPIGDNRYEIIAGERRWRATQQAG
                     LDTIPAMVREVPDEAAIAMALIENIQREDLNPLEEAMALQRLQQEFELTQQQVADAVG
                     KSRVTVANLLRLITLPDAIKTMLAHGDLEMGHARALLGLDENRQEEGARHVVARGLTV
                     RQTEALVRQWLSDKPDPVEPSKPDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRY
                     NSLDELQGVLAHIR"
     misc_feature    complement(70606..71109)
                     /gene="parB"
                     /locus_tag="PPUBIRD1_0066"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    complement(70831..71097)
                     /gene="parB"
                     /locus_tag="PPUBIRD1_0066"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     gene            complement(71221..71973)
                     /locus_tag="PPUBIRD1_0067"
                     /db_xref="GeneID:12518299"
     CDS             complement(71221..71973)
                     /locus_tag="PPUBIRD1_0067"
                     /codon_start=1
                     /transl_table=11
                     /product="ParA-like partition protein"
                     /protein_id="YP_005927982.1"
                     /db_xref="GI:386009705"
                     /db_xref="GeneID:12518299"
                     /translation="MGKTTTCINLAASLAATKRRVLLIDLDPQGNATMGSGVDKHELE
                     HSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQVKESRLRNALAPI
                     RDNYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSDLVDNIKRIAERLN
                     PELKIEGLLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIRLAEAPSFGMPALA
                     YDKQSRGALAYLALAGELVRRQRRPSRTAQTT"
     misc_feature    complement(71239..71970)
                     /locus_tag="PPUBIRD1_0067"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(71461..71970)
                     /locus_tag="PPUBIRD1_0067"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(71638..71640,71962..71964))
                     /locus_tag="PPUBIRD1_0067"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(72031..72681)
                     /gene="rsmG"
                     /locus_tag="PPUBIRD1_0068"
                     /db_xref="GeneID:12518300"
     CDS             complement(72031..72681)
                     /gene="rsmG"
                     /locus_tag="PPUBIRD1_0068"
                     /note="Ribosomal RNA small subunit methyltransferase G"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RsmG"
                     /protein_id="YP_005927983.1"
                     /db_xref="GI:386009706"
                     /db_xref="GeneID:12518300"
                     /translation="MSSLVTPQHAEELSTGARQLGVELTAEQHEKLLGYLALLIKWNK
                     AYNLTAVRDPDEMVSRHLLDSLSVMSFIHNGRDNWLDVGSGGGMPGIPLAILHPHKRV
                     TVLDANGKKTRFLTQVKMELRLDNLMVIHSRVEAFQPAQPFDGIISRAFSSMENFTNW
                     TRHLGDTGTQWLAMKGLHPADELVALPADFTVESEQALTVPGCQGQRHLLILRRKA"
     misc_feature    complement(72037..72594)
                     /gene="rsmG"
                     /locus_tag="PPUBIRD1_0068"
                     /note="16S rRNA methyltransferase GidB; Reviewed; Region:
                     gidB; PRK00107"
                     /db_xref="CDD:234637"
     misc_feature    complement(<72232..72444)
                     /gene="rsmG"
                     /locus_tag="PPUBIRD1_0068"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(72235..72237,72280..72288,72361..72366,
                     72418..72438))
                     /gene="rsmG"
                     /locus_tag="PPUBIRD1_0068"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(72678..74570)
                     /gene="mnmG"
                     /locus_tag="PPUBIRD1_0069"
                     /db_xref="GeneID:12518301"
     CDS             complement(72678..74570)
                     /gene="mnmG"
                     /locus_tag="PPUBIRD1_0069"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme mnmG"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MnmG"
                     /protein_id="YP_005927984.1"
                     /db_xref="GI:386009707"
                     /db_xref="GeneID:12518301"
                     /translation="MDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGH
                     MSCNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRA
                     IYKAVVREILENQPNLWIFQQSCDDLIVEQDQVKGVVTQMGLRFFAESVVLTTGTFLG
                     GLIHIGLQNHSGGRAGDPPSIALAHRMRELPLRVGRLKTGTPPRIDGRSVDFSVMTEQ
                     PGDTPIPVMSFMGNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYSGVIEGVGPRY
                     CPSIEDKIHRFADKESHQVFIEPEGLNTHELYPNGISTSLPFDVQLELVRSIRGMENA
                     HIVRPGYAIEYDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAA
                     LRAQGRDSWCPRRDEAYIGVLVDDLITLGTQEPYRMFTSRAEYRLILREDNADLRLTE
                     KGRELGLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTEQGQAIVDKFGTPLSHEYS
                     LLNLLARPEIDYAGLIEATGGEAIDPQVAEQVEIRTKYAGYIDRQQDEIARLRASEDT
                     RLPVDIDYTTISGLSKEIQGKLSQTRPETLGQASRIPGVTPAAISLLLIHLKKRGAGR
                     ELEQSA"
     misc_feature    complement(72696..74564)
                     /gene="mnmG"
                     /locus_tag="PPUBIRD1_0069"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA; Validated; Region: PRK05192"
                     /db_xref="CDD:235362"
     misc_feature    complement(73314..74546)
                     /gene="mnmG"
                     /locus_tag="PPUBIRD1_0069"
                     /note="NAD(FAD)-utilizing enzyme possibly involved in
                     translation [Translation, ribosomal structure and
                     biogenesis]; Region: Gid; COG1206"
                     /db_xref="CDD:224127"
     misc_feature    complement(72726..72938)
                     /gene="mnmG"
                     /locus_tag="PPUBIRD1_0069"
                     /note="GidA associated domain 3; Region: GIDA_assoc_3;
                     pfam13932"
                     /db_xref="CDD:258194"
     gene            complement(75203..76573)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /db_xref="GeneID:12518302"
     CDS             complement(75203..76573)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="tRNA modification GTPase mnmE"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MnmE"
                     /protein_id="YP_005927985.1"
                     /db_xref="GI:386009708"
                     /db_xref="GeneID:12518302"
                     /translation="MNTVRETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRTLTP
                     RHAHYGPFRDDEGLVLDEGIALFFPGPNSFTGEDVLELQGHGGPVVLDMLLQRCVQVG
                     CRLARPGEFSERAFLNDKLDLAQAEAIADLIEASSSQAARNALRSLQGEFSRRVHSLT
                     EALIALRIYVEAAIDFPEEEIDFLADGHVLSMLDAVRSELSTVQREAGQGALLRDGMT
                     VVIAGRPNAGKSSLLNQLAGREAAIVTDIAGTTRDILREHIHIDGMPLHVVDTAGLRD
                     TDDHVEKIGVERALKAIGEADRVLLVVDSTAPEASDPFALWPEFLAQRPDPAKVTLIR
                     NKADLSGERVALEQCDDGHVTITLSAKGDDTGLQLLRDHLKGCMGYEQTAESGFSARR
                     RHLDALRQASEHLEHGRAQLTLAGAGELLAEDLRQAQHALGEITGAFSSDDLLGRIFS
                     SFCIGK"
     misc_feature    complement(75206..76558)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="tRNA modification GTPase TrmE; Reviewed; Region:
                     trmE; PRK05291"
                     /db_xref="CDD:235392"
     misc_feature    complement(76214..76555)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="GTP-binding protein TrmE N-terminus; Region:
                     TrmE_N; pfam10396"
                     /db_xref="CDD:204472"
     misc_feature    complement(75437..75934)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="trmE is a tRNA modification GTPase; Region: trmE;
                     cd04164"
                     /db_xref="CDD:206727"
     misc_feature    complement(75884..75907)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="G1 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(75491..75499,75560..75562,75566..75571,
                     75881..75892,75896..75898))
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75812..75862)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75821..75823)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="G2 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(75689..75733,75737..75769))
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75755..75766)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="G3 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75560..75571)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="G4 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75491..75499)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="G5 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(75215..75433)
                     /gene="mnmE"
                     /locus_tag="PPUBIRD1_0070"
                     /note="Catalytic cysteine-containing C-terminus of GTPase,
                     MnmE; Region: GTPase_Cys_C; pfam12631"
                     /db_xref="CDD:257176"
     gene            complement(76662..78344)
                     /gene="oxaA"
                     /locus_tag="PPUBIRD1_0071"
                     /db_xref="GeneID:12518303"
     CDS             complement(76662..78344)
                     /gene="oxaA"
                     /locus_tag="PPUBIRD1_0071"
                     /note="Inner membrane protein oxaA"
                     /codon_start=1
                     /transl_table=11
                     /product="OxaA"
                     /protein_id="YP_005927986.1"
                     /db_xref="GI:386009709"
                     /db_xref="GeneID:12518303"
                     /translation="MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAP
                     GLPDGVPAGNNGASADVPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIV
                     QLNLPKYPRRQDHPNIPFQLFDNGGERVYLAQSGLTGTDGPDARASGRPLYAAEQKSY
                     QLADGQEQLVVDLKFSDNGVNYIKRFSFKRGEYDLNVSYLIDNQSGQAWNGNMFAQLK
                     RDASGDPSSSTATGTATYLGAALWTASEPYKKVSMKDIDKGSLKENVSGGWVAWLQHY
                     FVTAWIPAKSDNNVVQTRKDSQGNYIIGYTGPVISVPAGGKVETSALLYAGPKIQSKL
                     KELSPGLELTVDYGFLWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAA
                     SYRSMARMRAVAPKLAALKERFGDDRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF
                     LALYWVLLESVEMRQAPWILWITDLSIKDPFFILPIIMGATMFIQQRLNPTPPDPMQA
                     KVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEAATKKAAA"
     misc_feature    complement(76665..78344)
                     /gene="oxaA"
                     /locus_tag="PPUBIRD1_0071"
                     /note="membrane protein insertase; Provisional; Region:
                     PRK01318"
                     /db_xref="CDD:234942"
     misc_feature    complement(77265..78101)
                     /gene="oxaA"
                     /locus_tag="PPUBIRD1_0071"
                     /note="YidC periplasmic domain; Region: YidC_periplas;
                     pfam14849"
                     /db_xref="CDD:258986"
     misc_feature    complement(76665..77546)
                     /gene="oxaA"
                     /locus_tag="PPUBIRD1_0071"
                     /note="Preprotein translocase subunit YidC [Intracellular
                     trafficking and secretion]; Region: YidC; COG0706"
                     /db_xref="CDD:223778"
     gene            complement(78585..78989)
                     /gene="rnpA"
                     /locus_tag="PPUBIRD1_0072"
                     /db_xref="GeneID:12518304"
     CDS             complement(78585..78989)
                     /gene="rnpA"
                     /locus_tag="PPUBIRD1_0072"
                     /EC_number="3.1.26.5"
                     /note="Ribonuclease P protein component"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RnpA"
                     /protein_id="YP_005927987.1"
                     /db_xref="GI:386009710"
                     /db_xref="GeneID:12518304"
                     /translation="MVSQDFSREKRLLTPRHFKAVFDSPTGKVPGKNLLILARENGLD
                     HPRLGLVIGKKSVKLAVQRNRLKRLMRDSFRLNQQLLAGLDIVIVARKGLGEIENPEL
                     HQHFGKLWKRLARSRPTPAVTANSAGVDSQDA"
     misc_feature    complement(78600..78989)
                     /gene="rnpA"
                     /locus_tag="PPUBIRD1_0072"
                     /note="ribonuclease P; Reviewed; Region: rnpA; PRK00396"
                     /db_xref="CDD:179002"
     gene            complement(79003..79137)
                     /locus_tag="PPUBIRD1_0073"
                     /db_xref="GeneID:12518305"
     CDS             complement(79003..79137)
                     /locus_tag="PPUBIRD1_0073"
                     /codon_start=1
                     /transl_table=11
                     /product="Structural constituent of ribosome"
                     /protein_id="YP_005927988.1"
                     /db_xref="GI:386009711"
                     /db_xref="GeneID:12518305"
                     /translation="MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLAI
                     "
     misc_feature    complement(79009..79137)
                     /locus_tag="PPUBIRD1_0073"
                     /note="Ribosomal protein L34; Region: Ribosomal_L34;
                     pfam00468"
                     /db_xref="CDD:249883"
     gene            79739..81253
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /db_xref="GeneID:12518306"
     CDS             79739..81253
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="Chromosomal replication initiator protein dnaA"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase DnaA"
                     /protein_id="YP_005927989.1"
                     /db_xref="GI:386009712"
                     /db_xref="GeneID:12518306"
                     /translation="MELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRF
                     VLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASLAQ
                     TQAHKTAPAAAVEPVAVAAAEPVLVETSSRDSFDAMAEPAAAPPSGGGRAEQRTVQVE
                     GALKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHL
                     MHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQF
                     FARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPP
                     ELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDIT
                     IELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMAL
                     SKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
     misc_feature    79739..81244
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    79739..79897
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    80288..80719
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    80363..80386
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(80366..80389,80552..80554,80654..80656)
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    80540..80557
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    80690..80692
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    80975..81244
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(81044..81046,81068..81073,81092..81094,81110..81118,
                     81143..81157,81164..81166,81173..81178)
                     /gene="dnaA"
                     /locus_tag="PPUBIRD1_0074"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            81294..82397
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /db_xref="GeneID:12518307"
     CDS             81294..82397
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /EC_number="2.7.7.7"
                     /note="DNA polymerase III subunit beta"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaN protein"
                     /protein_id="YP_005927990.1"
                     /db_xref="GI:386009713"
                     /db_xref="GeneID:12518307"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSL
                     TGTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLL
                     EVSRNTLRAVSTDGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSN
                     EKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTT
                     EQVRLILSDSNSSALLQEAGNDDSSYVVMPMRL"
     misc_feature    81294..82394
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    81294..82391
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(81363..81365,81510..81512,81531..81533,81888..81890)
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(81513..81515,81522..81524,81600..81602,81606..81608,
                     82110..82112,82203..82208)
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(81807..81809,81813..81824,82254..82256,82380..82391)
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(81807..81809,81813..81818,82035..82037,82140..82142,
                     82179..82184,82263..82265,82380..82391)
                     /gene="dnaN"
                     /locus_tag="PPUBIRD1_0075"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            82413..83516
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /db_xref="GeneID:12518308"
     CDS             82413..83516
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="DNA replication and repair protein recF"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RecF"
                     /protein_id="YP_005927991.1"
                     /db_xref="GI:386009714"
                     /db_xref="GeneID:12518308"
                     /translation="MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVH
                     LLGLARSFRSTRLNPVIQYEQAACTVFGEVQLTEGGTSNLGVSRERQGEFTIRIDGQN
                     ARSAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALR
                     QRNSWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGL
                     TLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQ
                     KLVVCALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELHCQVFITCV
                     DHELLREGWQTETPVALFHVEQGRITQTHDHRE"
     misc_feature    82413..83495
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    82419..83492
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    82500..82523
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(82509..82514,82518..82526,82770..82772,83322..83327,
                     83415..83417)
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    82761..82772
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    83223..83252
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    83310..83327
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    83334..83345
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    83403..83423
                     /gene="recF"
                     /locus_tag="PPUBIRD1_0076"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /db_xref="GeneID:12518309"
     CDS             83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /EC_number="5.99.1.3"
                     /note="DNA gyrase subunit B"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GyrB"
                     /protein_id="YP_005927992.1"
                     /db_xref="GI:386009715"
                     /db_xref="GeneID:12518309"
                     /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFE
                     VVDNSIDEALAGHCDDITVIIHPDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHA
                     GGKFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVG
                     DSETTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFK
                     YEGGLRAFVEYLNTNKTPVNSQVFHFNVQRDDGVGVEVALQWNDSFNENLLCFTNNIP
                     QRDGGTHLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQLPELVERGYIYIAQPPLYKVKRGKQEQYIKDDEAMEEYMTQSALEDA
                     SLHLDESAPAVSGVQLEALVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQLGD
                     HAVMQAWLAQFQARLNSSQKSGLAYNASLREDKERNVWLPEVEITSHGLASYITFNRD
                     FFGSNDYRTVVNIGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQR
                     YKGLGEMNPDQLWETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LSVSNLDF"
     misc_feature    83521..85938
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     misc_feature    83632..83931
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(83650..83652,83662..83664,83671..83673,83737..83739,
                     83743..83745,83749..83751,83755..83760,83875..83886)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    83662..83664
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(83749..83751,83755..83757,83875..83877,83881..83883)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    84181..84657
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    84337..84339
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(84511..84513,84520..84525,84529..84531)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(84529..84531,84535..84537)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    84778..85122
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(84796..84801,84808..84810,85018..85020,85024..85026,
                     85030..85032)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(84796..84798,85018..85020)
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    85720..85905
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_0077"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(86006..86206)
                     /locus_tag="PPUBIRD1_0078"
                     /db_xref="GeneID:12518310"
     CDS             complement(86006..86206)
                     /locus_tag="PPUBIRD1_0078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927993.1"
                     /db_xref="GI:386009716"
                     /db_xref="GeneID:12518310"
                     /translation="MPIPHKQWQRGHAVDPHYRGDRYWVTDWQARHLYAPPRDHRWLY
                     VNGDYVLVAIASGVIVNILAGY"
     misc_feature    complement(86009..>86194)
                     /locus_tag="PPUBIRD1_0078"
                     /note="Domain of unknown function (DUF3315); Region:
                     DUF3315; cl02275"
                     /db_xref="CDD:261232"
     gene            complement(86544..87836)
                     /locus_tag="PPUBIRD1_0080"
                     /db_xref="GeneID:12518311"
     CDS             complement(86544..87836)
                     /locus_tag="PPUBIRD1_0080"
                     /codon_start=1
                     /transl_table=11
                     /product="Sigma-54 dependent transcriptional regulator"
                     /protein_id="YP_005927994.1"
                     /db_xref="GI:386009717"
                     /db_xref="GeneID:12518311"
                     /translation="MPEAHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGR
                     HDQAPLGEKCHRVSHHYAVPCDQAGEHCPMRKAWDSKVPERVLHIHHTPRGPEHVDVE
                     LRPILDEQGKVVAFVERLTTITLASAQPQEQGLVGRAPTFKAALASLQRAAPAQIPVL
                     LQGESGTGKELFARAVHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQR
                     KIGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLISATH
                     KPLKQMVADGSFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMVGQPTPRLSE
                     DALQQLALHPFPGNIRELRNILERARLFADDGVIRPEHLPEDTGLTGAPKGSGRRNDL
                     GELAQALELFKGSRSELASHLGMSERTLYRRLKALGLN"
     misc_feature    complement(87465..87794)
                     /locus_tag="PPUBIRD1_0080"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    complement(86946..87431)
                     /locus_tag="PPUBIRD1_0080"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(86952..87365)
                     /locus_tag="PPUBIRD1_0080"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    complement(87327..87350)
                     /locus_tag="PPUBIRD1_0080"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(87009..87011,87135..87137,87324..87347))
                     /locus_tag="PPUBIRD1_0080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(87132..87149)
                     /locus_tag="PPUBIRD1_0080"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(86952..86954)
                     /locus_tag="PPUBIRD1_0080"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(86556..>86654)
                     /locus_tag="PPUBIRD1_0080"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            88047..88943
                     /locus_tag="PPUBIRD1_0081"
                     /db_xref="GeneID:12518312"
     CDS             88047..88943
                     /locus_tag="PPUBIRD1_0081"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-lactamase domain protein"
                     /protein_id="YP_005927995.1"
                     /db_xref="GI:386009718"
                     /db_xref="GeneID:12518312"
                     /translation="MENVMIIGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLD
                     YDPKSGRTCSASADRLIERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGA
                     HITQVQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSF
                     MIEDAGEIAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDY
                     LPGGRDMQYVTTVAEQRAHNIHIHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMR
                     SGQLPPPEANGVSYLKIPLNKL"
     misc_feature    88089..88850
                     /locus_tag="PPUBIRD1_0081"
                     /note="Zn-dependent hydrolases, including glyoxylases
                     [General function prediction only]; Region: GloB; COG0491"
                     /db_xref="CDD:223565"
     gene            88984..90252
                     /locus_tag="PPUBIRD1_0082"
                     /db_xref="GeneID:12518313"
     CDS             88984..90252
                     /locus_tag="PPUBIRD1_0082"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="YP_005927996.1"
                     /db_xref="GI:386009719"
                     /db_xref="GeneID:12518313"
                     /translation="MPALLSPANTDHHKVVIVGAGAAGIATASSLTSRDPSLDVALID
                     PAEVHYYQPGWTMVGAGVFKAPSTARTMASTIPRGVRWVKARVKGFDPLAQLVILDDG
                     RAISYEQLIVCPGLKLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRAL
                     FSQPPMPIKCAGAPQKALYLSCDHWLRHGHLGAVKASFYNAGAVLFGVADYVPALMKY
                     IEKYAVDLNFSHRLVAVDGPGKRATFLRTLPDGSSETRIEAFDMLHVVPPQVAPDFIR
                     ESPLADSSGWVDVDPHTLRHRKYTNVHALGDVANTSNAKTAAAARKQAPVVANNVLVA
                     LGRLATLAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPNWLLDGRKPTRLAWLLK
                     AQALPPLYWQGMLKGREWLARPQLVAEGGQ"
     misc_feature    89044..90084
                     /locus_tag="PPUBIRD1_0082"
                     /note="Uncharacterized NAD(FAD)-dependent dehydrogenases
                     [General function prediction only]; Region: HcaD; COG0446"
                     /db_xref="CDD:223523"
     gene            90249..91067
                     /locus_tag="PPUBIRD1_0083"
                     /db_xref="GeneID:12518314"
     CDS             90249..91067
                     /locus_tag="PPUBIRD1_0083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005927997.1"
                     /db_xref="GI:386009720"
                     /db_xref="GeneID:12518314"
                     /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVE
                     AAPVGLLAVGLAAAVGAVLGLRQGLVRYRAALFIALVGVAAAPFGLMLAHRLPNAPLQ
                     VVFAGVLVYACLRIWRKAAKELRGEANDAHRFIEPCVLNPLQGRLRWTLPCARALAFT
                     GALSGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGV
                     MHWQVGAPFAVGAVLGLLLARPLAARLAGPRLQQMFAVAGWAAALLLAGKALLG"
     misc_feature    90273..91010
                     /locus_tag="PPUBIRD1_0083"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            complement(91056..91943)
                     /locus_tag="PPUBIRD1_0084"
                     /db_xref="GeneID:12518315"
     CDS             complement(91056..91943)
                     /locus_tag="PPUBIRD1_0084"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005927998.1"
                     /db_xref="GI:386009721"
                     /db_xref="GeneID:12518315"
                     /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSL
                     GTALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIG
                     IMFFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDY
                     RLALYASQDYLDRAPPLRHREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVVFRST
                     SVIAQQAAARAGLGIAVLPNYMARHDPTLVRVLPGETIQRSYWICTRRELHKSVRLRV
                     VWDYLLALCAAEQSELLAE"
     misc_feature    complement(91071..91940)
                     /locus_tag="PPUBIRD1_0084"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(91755..91934)
                     /locus_tag="PPUBIRD1_0084"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(91101..91673)
                     /locus_tag="PPUBIRD1_0084"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(91257..91262,91266..91271,91287..91304,
                     91566..91586,91590..91592,91602..91604,91611..91616,
                     91620..91625))
                     /locus_tag="PPUBIRD1_0084"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            92178..93824
                     /locus_tag="PPUBIRD1_0085"
                     /db_xref="GeneID:12518316"
     CDS             92178..93824
                     /locus_tag="PPUBIRD1_0085"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-methanol-choline oxidoreductase"
                     /protein_id="YP_005927999.1"
                     /db_xref="GI:386009722"
                     /db_xref="GeneID:12518316"
                     /translation="MPSADSVFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDN
                     YPWIHIPVGYLYCIGNPRTDWCFKTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRG
                     QAADYDHWAAQGNDGWAWKDVLPLFKASENHFAGASEYHGAEGEWRVERQRYSWPILD
                     AFRDAAEQSGIGKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPIKDRANLTVLT
                     GVQVDQVLLDNTRARAVKALWQGAWHEFAARREIILCAGAVGSPGILQRSGIGPRQLL
                     ESLGIGVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRS
                     GPLAMAPSQLGVFVRSSPEQATANLQYHVQPLSLERFGEPLHQFPAFTASVCNLRPAS
                     RGRIDICSTDMNSTPLIDPNYLSAAQDLRVAADAIRLTRRIVQAPALAAFEPKEYLPG
                     PALQSEEELFEAAGKIGTTIFHPVGTCRMGNGAMDVVDNQLRVHGIPGLRVADASIMP
                     QITSGNTCSPTLMIAEKAAQLILKGAATQTYLNEDALPTP"
     misc_feature    92184..93770
                     /locus_tag="PPUBIRD1_0085"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    92202..>92318
                     /locus_tag="PPUBIRD1_0085"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    92403..93071
                     /locus_tag="PPUBIRD1_0085"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    93345..93749
                     /locus_tag="PPUBIRD1_0085"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            93922..95541
                     /locus_tag="PPUBIRD1_0086"
                     /db_xref="GeneID:12518317"
     CDS             93922..95541
                     /locus_tag="PPUBIRD1_0086"
                     /codon_start=1
                     /transl_table=11
                     /product="general substrate transporter"
                     /protein_id="YP_005928000.1"
                     /db_xref="GI:386009723"
                     /db_xref="GeneID:12518317"
                     /translation="MSDYIQEQGAAASSSSRREERKIIFASSLGTVFEWYDFFLYGAL
                     AAVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVL
                     MGLSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPPGKRGL
                     HTGFIQSTATLGLLLSLLVVLGSRYVSGDQFETWGWRLPFLLSIVLLAISTWIRMSMH
                     ESPAFVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFM
                     TQMLKMDSAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFK
                     ALSYYANPQIDAASRQAPIVVTADPQGCTFQFDPVGKARFDSPCDKVKTFLVKQGLPY
                     SSVSVAGSEVVVNIGDKTINGFDETAMRAAIEQAGYPAKAEPAQVNQVMVVVLIVAMI
                     LIATMTYGPLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFY
                     GLWYPVLVTGISLVVGIFCLRETKDVDIDKV"
     misc_feature    93991..>94941
                     /locus_tag="PPUBIRD1_0086"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    94009..95484
                     /locus_tag="PPUBIRD1_0086"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    order(94033..94035,94042..94050,94054..94059,94126..94128,
                     94135..94140,94147..94149,94159..94164,94168..94173,
                     94333..94338,94345..94350,94357..94362,94369..94371,
                     94405..94410,94417..94422,94438..94440,94705..94707,
                     94714..94719,94726..94731,94738..94740,94780..94782,
                     94792..94794,94804..94806,94813..94815,94825..94827)
                     /locus_tag="PPUBIRD1_0086"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    95047..95190
                     /locus_tag="PPUBIRD1_0086"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(95716..96486)
                     /locus_tag="PPUBIRD1_0087"
                     /db_xref="GeneID:12518318"
     CDS             complement(95716..96486)
                     /locus_tag="PPUBIRD1_0087"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_005928001.1"
                     /db_xref="GI:386009724"
                     /db_xref="GeneID:12518318"
                     /translation="MSILQAIRIFLFYLLLGTSSLLWCSLSFFVAPFLSFPKRYKFIN
                     VYWCRCALFLVRTILGIDYKITGAENVPAEPCVILSNHQSTWETFFLSQYFSPLSQVL
                     KRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPEGTRVP
                     FGTLGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPMYANGT
                     GPRAIAELNDRAAAWNEATQRAMGSLPPAAEKPQEQMA"
     misc_feature    complement(95800..96327)
                     /locus_tag="PPUBIRD1_0087"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(96013..96021,96172..96183,96226..96228,
                     96232..96234,96241..96243))
                     /locus_tag="PPUBIRD1_0087"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(96548..97075)
                     /locus_tag="PPUBIRD1_0088"
                     /db_xref="GeneID:12518319"
     CDS             complement(96548..97075)
                     /locus_tag="PPUBIRD1_0088"
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="YP_005928002.1"
                     /db_xref="GI:386009725"
                     /db_xref="GeneID:12518319"
                     /translation="MKLLILDRDGVINYDSDAYIKTLEEWVPIPGSVDAIAQLSKAGW
                     TVAVATNQSGIARGYYPLATLDAMHARLRALVAEQGGEVGHIVYCPHGPDEGCDCRKP
                     KPGMLRAIAEHYQIGLEGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPET
                     TLIFDDLAAIARELI"
     misc_feature    complement(96551..97075)
                     /locus_tag="PPUBIRD1_0088"
                     /note="D,D-heptose 1,7-bisphosphate phosphatase;
                     Validated; Region: PRK08942"
                     /db_xref="CDD:236354"
     misc_feature    complement(96644..97069)
                     /locus_tag="PPUBIRD1_0088"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(96923..96928,97049..97057))
                     /locus_tag="PPUBIRD1_0088"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(97040..97057)
                     /locus_tag="PPUBIRD1_0088"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(96926..96928)
                     /locus_tag="PPUBIRD1_0088"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(97079..99133)
                     /gene="glyS"
                     /locus_tag="PPUBIRD1_0089"
                     /db_xref="GeneID:12518320"
     CDS             complement(97079..99133)
                     /gene="glyS"
                     /locus_tag="PPUBIRD1_0089"
                     /EC_number="6.1.1.14"
                     /note="Glycyl-tRNA synthetase beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GlyS"
                     /protein_id="YP_005928003.1"
                     /db_xref="GI:386009726"
                     /db_xref="GeneID:12518320"
                     /translation="MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTG
                     KQVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGVEL
                     AEIDQSGPKLRFSQHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWL
                     VMLLGDQVVDCTILSQKAGRESRGHRFHHPENVLITTPANYVEDLRKAYVLADFAERR
                     ELISKRTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTM
                     QDNQKYFCLLDNEGKLLPRFITVANVESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKK
                     QPLETFNERLKNVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRAGRAGLLSKCDL
                     ATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQTLTGAAVAIA
                     DKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEFAVKQFGA
                     KVKAPGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFR
                     KLPEAEALAAVNKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMA
                     AARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISL
                     LG"
     misc_feature    complement(97085..99127)
                     /gene="glyS"
                     /locus_tag="PPUBIRD1_0089"
                     /note="glycyl-tRNA synthetase subunit beta; Validated;
                     Region: glyS; PRK01233"
                     /db_xref="CDD:234925"
     misc_feature    complement(97490..99118)
                     /gene="glyS"
                     /locus_tag="PPUBIRD1_0089"
                     /note="Glycyl-tRNA synthetase beta subunit; Region:
                     tRNA_synt_2f; pfam02092"
                     /db_xref="CDD:251082"
     misc_feature    complement(97121..97399)
                     /gene="glyS"
                     /locus_tag="PPUBIRD1_0089"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     gene            complement(99130..100077)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /db_xref="GeneID:12518321"
     CDS             complement(99130..100077)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /EC_number="6.1.1.14"
                     /note="Glycyl-tRNA synthetase alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="GlyQ"
                     /protein_id="YP_005928004.1"
                     /db_xref="GI:386009727"
                     /db_xref="GeneID:12518321"
                     /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHT
                     ATFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLG
                     SLKAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANV
                     DKLFELFDFYESEANRLIKLELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARDVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
     misc_feature    complement(99202..100050)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="Class II Glycyl-tRNA synthetase (GlyRS) alpha
                     subunit core catalytic domain. GlyRS functions as a
                     homodimer in eukaryotes, archaea and some bacteria and as
                     a heterotetramer in the remainder of prokaryotes and in
                     arabidopsis. It is responsible for the...; Region:
                     GlyRS_alpha_core; cd00733"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(99328..99330,99340..99342,99349..99360,
                     99364..99366,99376..99378,99385..99387,99394..99399,
                     99406..99411,99418..99420,99427..99429,99433..99435,
                     99454..99459,99466..99468,99517..99519,99835..99837,
                     99883..99885,99895..99897,99922..99924,99970..99981,
                     99985..99987,99991..99996,100018..100020,100030..100032,
                     100042..100044))
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(99976..99999)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(order(99565..99570,99574..99579,99583..99588,
                     99634..99636,99646..99651,99814..99822,99826..99828,
                     99832..99834,99880..99882,99955..99957,99961..99963))
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    complement(99874..99885)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    complement(99565..99576)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_0090"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            100227..100712
                     /gene="tag"
                     /locus_tag="PPUBIRD1_0091"
                     /db_xref="GeneID:12518322"
     CDS             100227..100712
                     /gene="tag"
                     /locus_tag="PPUBIRD1_0091"
                     /note="DNA-3-methyladenine glycosylase I"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928005.1"
                     /db_xref="GI:386009728"
                     /db_xref="GeneID:12518322"
                     /translation="MPQRDPALLFEMLLLEGFQAGLSWITVLRKRERYRQVMYGFDPV
                     KLAAMSDERIEELMQDAGIIRNRLKLKAARRNAQAWLAVDNPAEWLWSFIGGSPKINH
                     FKQRSDVPAVTDEAKAMSKALQKAGFTFVGPTICYAFMQATGMVMDHTTDCDRYAALL
                     R"
     misc_feature    100230..100697
                     /gene="tag"
                     /locus_tag="PPUBIRD1_0091"
                     /note="Methyladenine glycosylase; Region: Adenine_glyco;
                     pfam03352"
                     /db_xref="CDD:251892"
     gene            100754..101641
                     /locus_tag="PPUBIRD1_0092"
                     /db_xref="GeneID:12518323"
     CDS             100754..101641
                     /locus_tag="PPUBIRD1_0092"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="YP_005928006.1"
                     /db_xref="GI:386009729"
                     /db_xref="GeneID:12518323"
                     /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKIPNSSRN
                     VVRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLE
                     VLEQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQM
                     GNRVAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNML
                     AGGKAVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQ
                     YMWSMKRFKKRPAGEPRWY"
     misc_feature    100793..>101128
                     /locus_tag="PPUBIRD1_0092"
                     /note="Lysophospholipid acyltransferases (LPLATs) of
                     glycerophospholipid biosynthesis; Region: LPLAT; cl17185"
                     /db_xref="CDD:266537"
     misc_feature    101042..101608
                     /locus_tag="PPUBIRD1_0092"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    order(101111..101113,101120..101122,101126..101128,
                     101174..101185,101324..101332)
                     /locus_tag="PPUBIRD1_0092"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(101740..102054)
                     /locus_tag="PPUBIRD1_0093"
                     /db_xref="GeneID:12518324"
     CDS             complement(101740..102054)
                     /locus_tag="PPUBIRD1_0093"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide domain-containing protein"
                     /protein_id="YP_005928007.1"
                     /db_xref="GI:386009730"
                     /db_xref="GeneID:12518324"
                     /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVE
                     QDPKYSAAWKLLGKAYQLQGDLAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKA
                     AG"
     misc_feature    complement(101833..102048)
                     /locus_tag="PPUBIRD1_0093"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(101836..101838,101848..101850,
                     101884..101886,101929..101931,101938..101940,
                     101950..101952,101986..101988,102031..102033,
                     102040..102042))
                     /locus_tag="PPUBIRD1_0093"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(101833..102015)
                     /locus_tag="PPUBIRD1_0093"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(101866..101871,101878..101883,
                     101890..101895,101971..101976,101983..101988,
                     101992..101997))
                     /locus_tag="PPUBIRD1_0093"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(101758..>101871)
                     /locus_tag="PPUBIRD1_0093"
                     /note="K+ potassium transporter; Region: K_trans; cl15781"
                     /db_xref="CDD:265782"
     gene            complement(102066..103439)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /db_xref="GeneID:12518325"
     CDS             complement(102066..103439)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="potassium transporter peripheral membrane
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="TrkA family protein"
                     /protein_id="YP_005928008.1"
                     /db_xref="GI:386009731"
                     /db_xref="GeneID:12518325"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRES
                     SYLTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAY
                     YGGPLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIR
                     AVMGELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMSPARCRHLSDTLEST
                     VVLQGSASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAY
                     VDLVQGGDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSK
                     VVGKAIEDITLPPGTTIGAIIRDEEVMIAHDDTMIESGDHVILFVVDKKHIRDVEKLF
                     HVGLSFF"
     misc_feature    complement(102078..103439)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="potassium transporter peripheral membrane
                     component; Reviewed; Region: trkA; PRK09496"
                     /db_xref="CDD:236541"
     misc_feature    complement(103068..103433)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(102780..102980)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     misc_feature    complement(102393..102740)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     misc_feature    complement(102102..102275)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_0094"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            complement(103463..104773)
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /db_xref="GeneID:12518326"
     CDS             complement(103463..104773)
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /note="Ribosomal RNA small subunit methyltransferase B"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RsmB"
                     /protein_id="YP_005928009.1"
                     /db_xref="GI:386009732"
                     /db_xref="GeneID:12518326"
                     /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLA
                     FGTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCA
                     DKLKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKALKAFWPEQWEA
                     ICAANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLP
                     GFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAHVVAIDL
                     EAKRLTRVRENLDRLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLTRQADDIPALATLQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIKAFLARTP
                     GARELDLATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
     misc_feature    complement(103481..104773)
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /note="16S rRNA methyltransferase B; Provisional; Region:
                     PRK10901"
                     /db_xref="CDD:236790"
     misc_feature    complement(104399..104734)
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /note="RNA binding domain of NusB (N protein-Utilization
                     Substance B) and Sun (also known as RrmB or Fmu) proteins.
                     This family includes two orthologous groups exemplified by
                     the transcription termination factor NusB and the
                     N-terminal domain of the...; Region: NusB_Sun; cl00223"
                     /db_xref="CDD:260276"
     misc_feature    complement(<103799..104038)
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(103814..103816,103868..103876,
                     103946..103951,104006..104026))
                     /gene="rsmB"
                     /locus_tag="PPUBIRD1_0095"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(104770..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /db_xref="GeneID:12518327"
     CDS             complement(104770..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="Methionyl-tRNA formyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928010.1"
                     /db_xref="GI:386009733"
                     /db_xref="GeneID:12518327"
                     /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLM
                     PSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPSLG
                     CINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDT
                     GGTLHDRLAKMGPPAVVRAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTRPAV
                     ELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGQGAPGEILSASKDGLVVACGDQAL
                     SLTRLQLPGGKALSFSDLFNSRREKFAAGKVLGQ"
     misc_feature    complement(104776..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="methionyl-tRNA formyltransferase; Reviewed; Region:
                     fmt; PRK00005"
                     /db_xref="CDD:234567"
     misc_feature    complement(105091..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(105274..105279,105286..105291,
                     105295..105297,105355..105357,105379..105390,
                     105415..105417,105430..105453,105667..105672,
                     105682..105684))
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(105094..105096,105349..105357,
                     105379..105384,105388..105390,105439..105450,
                     105580..105591,105595..105597,105607..105609,
                     105670..105672,105676..105681))
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(105274..105279,105286..105291,
                     105388..105390,105415..105417,105430..105438,
                     105442..105444,105451..105453))
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(105274..105276,105382..105384,
                     105388..105390))
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(104833..105084)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(104836..104838,104842..104847,
                     104851..104853,104857..104859,104974..104976,
                     104980..104982,105013..105015))
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_0096"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(105763..106269)
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /db_xref="GeneID:12518328"
     CDS             complement(105763..106269)
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /note="Peptide deformylase 1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928011.1"
                     /db_xref="GI:386009734"
                     /db_xref="GeneID:12518328"
                     /translation="MAILNILEFPDPRLRTLAKPVTEFDDALRQLIDDMFETMYEAPG
                     IGLAATQVNVHKQVVVMDLSEDRSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENV
                     DRPLRVRVKAQDRDGKPFELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKL
                     EKQHRQQA"
     misc_feature    complement(105838..106254)
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(105856..105858,105865..105870,
                     105991..105999,106117..106119,106132..106140))
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(105865..105867,105991..105993,
                     106117..106119,106132..106134))
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(105856..105858,105868..105870,
                     105994..105996))
                     /gene="def"
                     /locus_tag="PPUBIRD1_0097"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            106476..107573
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_0098"
                     /db_xref="GeneID:12518329"
     CDS             106476..107573
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_0098"
                     /note="DNA protecting protein DprA"
                     /codon_start=1
                     /transl_table=11
                     /product="DprA-like protein"
                     /protein_id="YP_005928012.1"
                     /db_xref="GI:386009735"
                     /db_xref="GeneID:12518329"
                     /translation="MPSHHSSPCPPAELEARLRLHRLPEAGLRRFRTLLEAFGSASSA
                     LSAPASAWRALGIPQATIDARRSAEVRDGALAAMAWLERPGQHLLMWDGPGYPALLAE
                     IDDAPPLLFVAGEPALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAV
                     GVDGAAHRAALQAGGGTIAVLGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPLDAGPL
                     PGNFPRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGC
                     HQLIRDGALLVETVEQILESLQGWQNLPPAVMDRFDHPLLALLHAAPQTSESLAHCSE
                     QPLADVLAQLTELELEGRVSNEAGRWFARAG"
     misc_feature    106506..107567
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_0098"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    106713..107342
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_0098"
                     /note="DNA recombination-mediator protein A; Region:
                     DNA_processg_A; pfam02481"
                     /db_xref="CDD:251323"
     gene            107616..108173
                     /gene="rimN"
                     /locus_tag="PPUBIRD1_0099"
                     /db_xref="GeneID:12518330"
     CDS             107616..108173
                     /gene="rimN"
                     /locus_tag="PPUBIRD1_0099"
                     /note="Putative ribosome maturation factor"
                     /codon_start=1
                     /transl_table=11
                     /product="RimN"
                     /protein_id="YP_005928013.1"
                     /db_xref="GI:386009736"
                     /db_xref="GeneID:12518330"
                     /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKSRPVDKGLILVADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWV
                     TGQHDTVALRVSDHPVVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVL
                     GGALGGRKNPSVIRDLATGEVVRPG"
     misc_feature    107634..108170
                     /gene="rimN"
                     /locus_tag="PPUBIRD1_0099"
                     /note="Putative translation factor (SUA5) [Translation,
                     ribosomal structure and biogenesis]; Region: SUA5;
                     COG0009"
                     /db_xref="CDD:223088"
     gene            108621..108938
                     /locus_tag="PPUBIRD1_0100"
                     /db_xref="GeneID:12518331"
     CDS             108621..108938
                     /locus_tag="PPUBIRD1_0100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928014.1"
                     /db_xref="GI:386009737"
                     /db_xref="GeneID:12518331"
                     /translation="MMKKIVPDPPLQCTSTRPFGRCDAGHDPLFTVNPNISAEDALVH
                     VALYLRSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPPTNRP
                     SQA"
     misc_feature    108675..108899
                     /locus_tag="PPUBIRD1_0100"
                     /note="Protein of unknown function (DUF3077); Region:
                     DUF3077; pfam11275"
                     /db_xref="CDD:204621"
     gene            complement(109066..110043)
                     /locus_tag="PPUBIRD1_0101"
                     /db_xref="GeneID:12518332"
     CDS             complement(109066..110043)
                     /locus_tag="PPUBIRD1_0101"
                     /EC_number="1.6.5.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Alcohol dehydrogenase"
                     /protein_id="YP_005928015.1"
                     /db_xref="GI:386009738"
                     /db_xref="GeneID:12518332"
                     /translation="MAKRIQFSQHGGPEVLQFVEFEPTPPGPQQVRVRNHAIGLNFID
                     TYFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVSRLKVGDRVAHAGGPLGAYSEVHTLP
                     EANLVKLPDTISFEQAAAVMLKGLTVQYLLKQTYEVKAGDVILFHAAAGGVGSLACQW
                     AKALGAKLIGTVSSAEKAERAKALGAWATIDYSREDVVKRVLELTDGKKCPVVYDGVG
                     ADTWLTSLDCLRPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENT
                     QAMADDLFAMIASGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
     misc_feature    complement(109069..110043)
                     /locus_tag="PPUBIRD1_0101"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     misc_feature    complement(109069..110037)
                     /locus_tag="PPUBIRD1_0101"
                     /note="Quinone oxidoreductase (QOR); Region: QOR2;
                     cd05286"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(109099..109101,109105..109107,
                     109246..109257,109318..109332,109393..109398,
                     109468..109470,109513..109515,109525..109530,
                     109585..109593,109600..109602,109654..109656,
                     109663..109665,109675..109677,109906..109908,
                     109918..109923))
                     /locus_tag="PPUBIRD1_0101"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:176189"
     misc_feature    complement(order(109237..109242,109249..109272,
                     109294..109311,109348..109353,109639..109641))
                     /locus_tag="PPUBIRD1_0101"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176189"
     gene            110178..111089
                     /gene="hemF"
                     /locus_tag="PPUBIRD1_0102"
                     /db_xref="GeneID:12518333"
     CDS             110178..111089
                     /gene="hemF"
                     /locus_tag="PPUBIRD1_0102"
                     /EC_number="1.3.3.3"
                     /note="Coproporphyrinogen-III oxidase, aerobic"
                     /codon_start=1
                     /transl_table=11
                     /product="HemF"
                     /protein_id="YP_005928016.1"
                     /db_xref="GI:386009739"
                     /db_xref="GeneID:12518333"
                     /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGG
                     GRTRVIGEGKVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPH
                     VPTSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADV
                     YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAFVDAYLPIV
                     QRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKAEPGSEEARLTEYFLQDRDWLGQ"
     misc_feature    110178..111080
                     /gene="hemF"
                     /locus_tag="PPUBIRD1_0102"
                     /note="coproporphyrinogen III oxidase; Provisional;
                     Region: PRK05330"
                     /db_xref="CDD:235413"
     gene            111114..111938
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /db_xref="GeneID:12518334"
     CDS             111114..111938
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /EC_number="1.1.1.25"
                     /note="shikimate 5-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="AroE"
                     /protein_id="YP_005928017.1"
                     /db_xref="GI:386009740"
                     /db_xref="GeneID:12518334"
                     /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFS
                     DCARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDG
                     AGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVVANRTVEKAEQLA
                     REFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGK
                     EPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
     misc_feature    111114..111929
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region: aroE;
                     PRK00258"
                     /db_xref="CDD:234703"
     misc_feature    111129..111374
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    111411..111878
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    order(111414..111416,111759..111761,111837..111839,
                     111846..111848)
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    order(111492..111494,111501..111503,111561..111566,
                     111672..111680,111753..111755,111825..111827,
                     111834..111839)
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_0103"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            complement(111977..113542)
                     /locus_tag="PPUBIRD1_0104"
                     /db_xref="GeneID:12518335"
     CDS             complement(111977..113542)
                     /locus_tag="PPUBIRD1_0104"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="YP_005928018.1"
                     /db_xref="GI:386009741"
                     /db_xref="GeneID:12518335"
                     /translation="MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYA
                     LIAGLPAEYGLYAAIVPVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYI
                     TLVLLLTFLGGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMAL
                     PSQSTALKTVQDLASHAGEVDLPSLLLGLATVVIGVAFKLWRPRWPSLLISLILVSLL
                     AWLLPGFFGHVPRVAAFTGQLPPFSPLPLLDVELMLHLLPSAVAVGMLGLVTSLSIAR
                     SLSARSEQLINPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFS
                     ALWVALFAVSGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTT
                     AATLLLELQTAIYAGVLASLFFYLKRTSRPRIQQSREGDADVLRVGGSIFFGAAHYLQ
                     VRLQRCQGPHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQK
                     LEGVELCPIRFEE"
     misc_feature    complement(112016..113539)
                     /locus_tag="PPUBIRD1_0104"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    complement(113273..113521)
                     /locus_tag="PPUBIRD1_0104"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    complement(112382..113188)
                     /locus_tag="PPUBIRD1_0104"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     misc_feature    complement(112016..112243)
                     /locus_tag="PPUBIRD1_0104"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain of SulP-like sulfate transporters, plays
                     a role in the function and regulation of the transport
                     activity, proposed general NTP binding function; Region:
                     STAS_SulP_like_sulfate_transporter; cd07042"
                     /db_xref="CDD:132913"
     gene            complement(113687..114610)
                     /locus_tag="PPUBIRD1_0105"
                     /db_xref="GeneID:12518336"
     CDS             complement(113687..114610)
                     /locus_tag="PPUBIRD1_0105"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycine betaine-binding protein"
                     /protein_id="YP_005928019.1"
                     /db_xref="GI:386009742"
                     /db_xref="GeneID:12518336"
                     /translation="MHKFSAAVFVLALSTTTAHAADSDAQCSTVKMADPGWSDIASTN
                     AVARLLLESLGYQVKIDSLAVPIIYGGLKDGQVDAFLGNWMPAHQGFHDKFIANGDVQ
                     QLSRNLEGTEFTLAVPDYVWNAGVKDFADLQKHAGQFDKKLYGIGSGAPANLSLKAII
                     DKNEFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEK
                     WFGSKGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENSIMAEVVDKKISFDEAAKAW
                     VKAHPERLDGWLAGVTTKADGDALEAVKAKL"
     misc_feature    complement(113690..114553)
                     /locus_tag="PPUBIRD1_0105"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            complement(114625..116142)
                     /locus_tag="PPUBIRD1_0106"
                     /db_xref="GeneID:12518337"
     CDS             complement(114625..116142)
                     /locus_tag="PPUBIRD1_0106"
                     /EC_number="3.1.6.6"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_005928020.1"
                     /db_xref="GI:386009743"
                     /db_xref="GeneID:12518337"
                     /translation="MTRPNILFIMADQMAAPLLPIYGPSPIKMPHLGRLAEQAVVFDS
                     AYCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMH
                     FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLD
                     FDEEVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIAKRYWDRYEGVDIPMPRA
                     EFGQAALDPHSQRLLKVYDLWNKPLPVDKVRDARRAYFGACSYIDDNIGQLLQTLEEC
                     NLADDTLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLIHAPKRFAAGRVTASVSTC
                     DLLPTLVELAGGAVDKDLQLDGRSLLGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGP
                     YKFVYSEDDPCLLYDLSRDPHERENLTDSPDHQVLLQTFVDEAQQRWDIPSLRQQVLA
                     SQRRRRLVAEALAIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
     misc_feature    complement(114646..116139)
                     /locus_tag="PPUBIRD1_0106"
                     /note="choline-sulfatase; Region: chol_sulfatase;
                     TIGR03417"
                     /db_xref="CDD:234202"
     misc_feature    complement(115108..116133)
                     /locus_tag="PPUBIRD1_0106"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     misc_feature    complement(114799..114993)
                     /locus_tag="PPUBIRD1_0106"
                     /note="C-terminal region of aryl-sulfatase; Region:
                     Sulfatase_C; pfam14707"
                     /db_xref="CDD:258845"
     misc_feature    complement(114649..114810)
                     /locus_tag="PPUBIRD1_0106"
                     /note="Choline sulfatase enzyme C terminal; Region:
                     Choline_sulf_C; pfam12411"
                     /db_xref="CDD:257033"
     gene            116251..117150
                     /locus_tag="PPUBIRD1_0107"
                     /db_xref="GeneID:12518338"
     CDS             116251..117150
                     /locus_tag="PPUBIRD1_0107"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005928021.1"
                     /db_xref="GI:386009744"
                     /db_xref="GeneID:12518338"
                     /translation="MFEHLAGLSLDTLRVFEAAARLRGFTAAALELGTTQPAVSQQVK
                     RLEAQLGTRLFDRIYRGIELTEAGQVLFEQVHQGLQAMDDGIAQSGGRGQREVLQVAT
                     DFAFAAFWLMPRLQRFHEAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESR
                     WLFDEEVFPVCSPHLIHGKALSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVDSPP
                     PAGQLRFDNYTLLIQAAIAGQGVAIGWAHLVDGLVEQGLLCRPLEGSLRSERGYYAVL
                     PPRKRRGALIERFVDWLEQERSL"
     misc_feature    116272..117138
                     /locus_tag="PPUBIRD1_0107"
                     /note="putative choline sulfate-utilization transcription
                     factor; Region: chol_sulf_TF; TIGR03418"
                     /db_xref="CDD:188320"
     misc_feature    116278..116457
                     /locus_tag="PPUBIRD1_0107"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    116539..117129
                     /locus_tag="PPUBIRD1_0107"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    order(116539..116562,116566..116619,116623..116643)
                     /locus_tag="PPUBIRD1_0107"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    order(116557..116562,116566..116568,116926..116934,
                     116992..116994)
                     /locus_tag="PPUBIRD1_0107"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            complement(117262..117879)
                     /locus_tag="PPUBIRD1_0108"
                     /db_xref="GeneID:12518339"
     CDS             complement(117262..117879)
                     /locus_tag="PPUBIRD1_0108"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928022.1"
                     /db_xref="GI:386009745"
                     /db_xref="GeneID:12518339"
                     /translation="MKNAETPVFKLVLFGPESSLGNALMVELLSRQHEVTAVVDDLNR
                     HSPRPGLHFKIGGLGDAHQAEQGAAGGSAVIALLPALAPGDLPGQARLSEALVAGLAR
                     TTIRRLLLVGDFDVLDEPGKYSEVERECVAQVVDGLQRSALHWTLINAPQELAGLSME
                     HFRSTEGTLEPGLAEPLRRLARIAAGMVDMLELDLHRGEHLNFVV"
     misc_feature    complement(117274..117852)
                     /locus_tag="PPUBIRD1_0108"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(117421..117432,117478..117480,
                     117541..117549,117643..117651,117757..117765,
                     117820..117822,117826..117831,117835..117837))
                     /locus_tag="PPUBIRD1_0108"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(117478..117480,117541..117543,
                     117604..117606))
                     /locus_tag="PPUBIRD1_0108"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            117932..118264
                     /locus_tag="PPUBIRD1_0109"
                     /db_xref="GeneID:12518340"
     CDS             117932..118264
                     /locus_tag="PPUBIRD1_0109"
                     /codon_start=1
                     /transl_table=11
                     /product="DOPA 4,5-dioxygenase"
                     /protein_id="YP_005928023.1"
                     /db_xref="GI:386009746"
                     /db_xref="GeneID:12518340"
                     /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPV
                     GPHPDWSCQLAFGPEVVGVVLPWLALYRKGLVVFMHPETGDELADHRDHAIWMGAVRP
                     LNLAVFGG"
     misc_feature    117950..118255
                     /locus_tag="PPUBIRD1_0109"
                     /note="Dopa 4,5-dioxygenase family; Region: DOPA_dioxygen;
                     pfam08883"
                     /db_xref="CDD:255088"
     gene            complement(118382..119191)
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /db_xref="GeneID:12518341"
     CDS             complement(118382..119191)
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /EC_number="4.2.1.20"
                     /note="Tryptophan synthase alpha chain"
                     /codon_start=1
                     /transl_table=11
                     /product="TrpA"
                     /protein_id="YP_005928024.1"
                     /db_xref="GI:386009747"
                     /db_xref="GeneID:12518341"
                     /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAG
                     ADVIELGMPFTDPMADGVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGY
                     YNPIHRFGVDTFVAQAKEAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDD
                     ARLPRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPE
                     QAANIARLADGVVVGSALVDKIAQAKSADQAVSDVLSLCSALAEGVRGARR"
     misc_feature    complement(118412..119140)
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /note="Ttryptophan synthase (TRPS) alpha subunit (TSA).
                     TPRS is a bifunctional tetrameric enzyme (2 alpha and 2
                     beta subunits) that catalyzes the last two steps of
                     L-tryptophan biosynthesis. Alpha and beta subunit catalyze
                     two distinct reactions which are both...; Region:
                     Tryptophan_synthase_alpha; cd04724"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(118490..118495,118553..118558,
                     118640..118645,118667..118669,119000..119002,
                     119012..119014,119045..119047))
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(118643..118645,118886..118888,
                     119012..119014,119045..119047))
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /note="active site"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(118886..118888,119012..119014,
                     119045..119047))
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240075"
     misc_feature    complement(order(118706..118708,118715..118723,
                     118727..118729,118787..118789,118796..118798,
                     118802..118807,118871..118873,118880..118882,
                     118994..118999,119006..119008,119015..119017,
                     119021..119032))
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_0110"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240075"
     gene            complement(119188..120405)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_0111"
                     /db_xref="GeneID:12518342"
     CDS             complement(119188..120405)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_0111"
                     /EC_number="4.2.1.20"
                     /note="Tryptophan synthase beta chain"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TrpB"
                     /protein_id="YP_005928025.1"
                     /db_xref="GI:386009748"
                     /db_xref="GeneID:12518342"
                     /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKA
                     DPKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQ
                     VLLAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLL
                     GAEIVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGK
                     ETRAQLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHA
                     ASLNGGVPGVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVS
                     ITDDEALDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQ
                     TVMNHMAAQEKHA"
     misc_feature    complement(119224..120306)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_0111"
                     /note="Tryptophan synthase-beta:  Trptophan synthase is a
                     bifunctional enzyme that catalyses the last two steps in
                     the biosynthesis of L-tryptophan via its alpha and beta
                     reactions. In the alpha reaction, indole 3-glycerol
                     phosphate is cleaved reversibly to...; Region:
                     Trp-synth_B; cd06446"
                     /db_xref="CDD:107207"
     misc_feature    complement(order(119254..119256,119332..119334,
                     119674..119688,119812..119814,120040..120042,
                     120121..120126))
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_0111"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107207"
     misc_feature    complement(120121..120123)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_0111"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107207"
     gene            120516..121412
                     /locus_tag="PPUBIRD1_0112"
                     /db_xref="GeneID:12518343"
     CDS             120516..121412
                     /locus_tag="PPUBIRD1_0112"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005928026.1"
                     /db_xref="GI:386009749"
                     /db_xref="GeneID:12518343"
                     /translation="MAHDLPPLNALRAFEAAARLNSVSQAAEALHVTHGAVSRQIKVL
                     EEHLGVALFVKDGRGIKLTDAGMRLRDASGEAFDRLRSVCSELSRDVSEAPFVLGCSG
                     SLLARWFIPRLGRLQADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHV
                     LAEECIGPVLSPHFAGFQRLQGAPAKALLGEALLHTTSRPQAWPTWAVQQGLDPAAIH
                     YGQAFEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTQAALALWVPRR
                     AADGRAEQLAQWLRAELARQSA"
     misc_feature    120516..121409
                     /locus_tag="PPUBIRD1_0112"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    120537..120713
                     /locus_tag="PPUBIRD1_0112"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    120798..121382
                     /locus_tag="PPUBIRD1_0112"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator TrpI, which is
                     involved in control of tryptophan synthesis, contains type
                     2 periplasmic binding fold; Region: PBP2_TrpI; cd08482"
                     /db_xref="CDD:176171"
     misc_feature    order(120798..120821,120825..120878,120882..120902)
                     /locus_tag="PPUBIRD1_0112"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176171"
     misc_feature    order(120816..120821,120825..120827,121185..121193,
                     121251..121253)
                     /locus_tag="PPUBIRD1_0112"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176171"
     gene            complement(121409..121732)
                     /locus_tag="PPUBIRD1_0113"
                     /db_xref="GeneID:12518344"
     CDS             complement(121409..121732)
                     /locus_tag="PPUBIRD1_0113"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928027.1"
                     /db_xref="GI:386009750"
                     /db_xref="GeneID:12518344"
                     /translation="MHRNSLRKTSLESMEAEIESLLKSLENLKHDASEESQKSVKAIR
                     SNAESALRHSRSLLSDAYEEVKQRTRQTGKATRDYAQEHPYTTAGVAIGALGLLAAYL
                     ICKRN"
     misc_feature    complement(121415..121699)
                     /locus_tag="PPUBIRD1_0113"
                     /note="Bacterial protein of unknown function (DUF883);
                     Region: DUF883; pfam05957"
                     /db_xref="CDD:147874"
     gene            121883..122098
                     /locus_tag="PPUBIRD1_0114"
                     /db_xref="GeneID:12518345"
     CDS             121883..122098
                     /locus_tag="PPUBIRD1_0114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928028.1"
                     /db_xref="GI:386009751"
                     /db_xref="GeneID:12518345"
                     /translation="MTDHHTYKKIELVGSSPTSIEEAINNALAEAGKSIKHLEWFEVV
                     DTRGHIRDNKAAHFQVTLKVGFRIANS"
     misc_feature    121895..122086
                     /locus_tag="PPUBIRD1_0114"
                     /note="Dodecin; Region: Dodecin; pfam07311"
                     /db_xref="CDD:254151"
     gene            122199..122420
                     /locus_tag="PPUBIRD1_0115"
                     /db_xref="GeneID:12518346"
     CDS             122199..122420
                     /locus_tag="PPUBIRD1_0115"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928029.1"
                     /db_xref="GI:386009752"
                     /db_xref="GeneID:12518346"
                     /translation="MNKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYK
                     LEIVKKGDPAGKVIGSCEAGTKEIVYRRG"
     misc_feature    122268..122414
                     /locus_tag="PPUBIRD1_0115"
                     /note="Protein of unknown function (DUF1161); Region:
                     DUF1161; pfam06649"
                     /db_xref="CDD:253842"
     gene            complement(122493..123497)
                     /locus_tag="PPUBIRD1_0116"
                     /db_xref="GeneID:12518347"
     CDS             complement(122493..123497)
                     /locus_tag="PPUBIRD1_0116"
                     /codon_start=1
                     /transl_table=11
                     /product="Luciferase family protein"
                     /protein_id="YP_005928030.1"
                     /db_xref="GI:386009753"
                     /db_xref="GeneID:12518347"
                     /translation="MTQLRDLKISTLDLVPVRADAGPAQSLRNSLDLAQHVERFGYNR
                     FWVAEHHNMDGIASSATSVLIGYLAGGTSRIRVGSGGVMLPNHAPLVIAEQFGTLASL
                     YPGRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVP
                     GYDTDVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRYMHEAIRVYRNHFKPSTTLDK
                     PYVMLGIPMVVAQTDEKAEYLATSVYQRILALIRGQSLMQKPPVESMEGLWLPHERET
                     VGSFLGLAMIGSPQKVKAKVEVLLEQTGADELIFTCDLYEHADRIRSYELMAQALKTE
                     "
     misc_feature    complement(122520..123479)
                     /locus_tag="PPUBIRD1_0116"
                     /note="probable oxidoreductase, LLM family; Region:
                     LLM_2I7G; TIGR03858"
                     /db_xref="CDD:234374"
     misc_feature    complement(<123162..123440)
                     /locus_tag="PPUBIRD1_0116"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     misc_feature    complement(122859..>123017)
                     /locus_tag="PPUBIRD1_0116"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cd00347"
                     /db_xref="CDD:238209"
     gene            123650..124075
                     /gene="osmC"
                     /locus_tag="PPUBIRD1_0117"
                     /db_xref="GeneID:12518348"
     CDS             123650..124075
                     /gene="osmC"
                     /locus_tag="PPUBIRD1_0117"
                     /EC_number="1.11.1.15"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC family protein"
                     /protein_id="YP_005928031.1"
                     /db_xref="GI:386009754"
                     /db_xref="GeneID:12518348"
                     /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTAERIDTAAEVTLDKQADGFAITAVHLVLRA
                     KVPGASEAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
     misc_feature    123656..124057
                     /gene="osmC"
                     /locus_tag="PPUBIRD1_0117"
                     /note="peroxiredoxin, OsmC subfamily; Region:
                     osmo_induc_OsmC; TIGR03562"
                     /db_xref="CDD:234260"
     gene            124151..124384
                     /locus_tag="PPUBIRD1_0118"
                     /db_xref="GeneID:12518349"
     CDS             124151..124384
                     /locus_tag="PPUBIRD1_0118"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928032.1"
                     /db_xref="GI:386009755"
                     /db_xref="GeneID:12518349"
                     /translation="MIRVAIAVLASLVATSALAAVKPCEELKTEIEAKIQAQGVSSYT
                     LEIVPNSEVKDQNMVVGTCDGGTKKIIYQKNDR"
     misc_feature    124220..124372
                     /locus_tag="PPUBIRD1_0118"
                     /note="Protein of unknown function (DUF1161); Region:
                     DUF1161; pfam06649"
                     /db_xref="CDD:253842"
     gene            complement(124420..124833)
                     /locus_tag="PPUBIRD1_0119"
                     /db_xref="GeneID:12518350"
     CDS             complement(124420..124833)
                     /locus_tag="PPUBIRD1_0119"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative lipoprotein"
                     /protein_id="YP_005928033.1"
                     /db_xref="GI:386009756"
                     /db_xref="GeneID:12518350"
                     /translation="MRQPMMLIALSTLGACASPLPPVDPKQAWVDLYTMTPGRVIMAD
                     RLDGKRLDDGRYFQVTPGKHELVVRFDYEIYSGGLMSQPRDRTCYLTVRFDNFKAGER
                     YRLEARAPVMEPQVLLYDANRKVVVNEPSEVFCIP"
     gene            complement(124889..125302)
                     /locus_tag="PPUBIRD1_0120"
                     /db_xref="GeneID:12518351"
     CDS             complement(124889..125302)
                     /locus_tag="PPUBIRD1_0120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928034.1"
                     /db_xref="GI:386009757"
                     /db_xref="GeneID:12518351"
                     /translation="MRALLVAGSLLLISACSTLPDPDPNQAWIDLTRYDNTSLDAVQV
                     DERDWGDSRYFEVQPGSHELTVRYQFPVNPSNIGPVEEPLWRDCQVKLTFKDFSAGQR
                     YQLQAGSIGFRPWIKLYDHQQKLLGQGLPAGCQRT"
     gene            125388..126461
                     /locus_tag="PPUBIRD1_0121"
                     /db_xref="GeneID:12518352"
     CDS             125388..126461
                     /locus_tag="PPUBIRD1_0121"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928035.1"
                     /db_xref="GI:386009758"
                     /db_xref="GeneID:12518352"
                     /translation="MQRSGLGALDRIFTRLVPLVAALLLNGCSNVAYYGQLAQGQWQL
                     LRARQPVEQVLADPATPAPLRAHLQQAEQARAFASQQLKLPDNRSYRVYADLGRRYVV
                     WNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVEAYS
                     TLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYMQDDTEFNESFASFVEQEGTRQW
                     RAARGLAAVGGDQGKQRDQFIRLVLASRERLQAIYAGPLDDAHKRRAKQAEFERLRRE
                     YRQVRDGQWGGDKRYDAWMYGPMNNAKLLPFGLYDQWVPAFAALFREVGGDWVRFYER
                     VAHLGRLPIEERKAALQRLMVSL"
     misc_feature    125463..126440
                     /locus_tag="PPUBIRD1_0121"
                     /note="Predicted aminopeptidase (DUF2265); Region:
                     DUF2265; pfam10023"
                     /db_xref="CDD:204379"
     gene            complement(126571..127221)
                     /locus_tag="PPUBIRD1_0122"
                     /db_xref="GeneID:12518353"
     CDS             complement(126571..127221)
                     /locus_tag="PPUBIRD1_0122"
                     /EC_number="3.1.3.5"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_005928036.1"
                     /db_xref="GI:386009759"
                     /db_xref="GeneID:12518353"
                     /translation="MHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEPDLARLEH
                     FIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYENLVFEGVPELLEALNGQGR
                     TLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEGLDPAQ
                     TLMIGDRKHDLIGARSNGLQAVAVGYGFGSREELMAEEPAFHFATVADLHQAFSKA"
     misc_feature    complement(126592..127221)
                     /locus_tag="PPUBIRD1_0122"
                     /note="Predicted phosphatases [General function prediction
                     only]; Region: Gph; COG0546"
                     /db_xref="CDD:223620"
     misc_feature    complement(<127060..127221)
                     /locus_tag="PPUBIRD1_0122"
                     /note="Eukaryotic phosphomannomutase; Region: PMM;
                     cl17107"
                     /db_xref="CDD:266519"
     misc_feature    complement(126670..127206)
                     /locus_tag="PPUBIRD1_0122"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(126895..126900,127189..127197))
                     /locus_tag="PPUBIRD1_0122"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(127180..127197)
                     /locus_tag="PPUBIRD1_0122"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(126898..126900)
                     /locus_tag="PPUBIRD1_0122"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            complement(127343..127891)
                     /locus_tag="PPUBIRD1_0123"
                     /db_xref="GeneID:12518354"
     CDS             complement(127343..127891)
                     /locus_tag="PPUBIRD1_0123"
                     /codon_start=1
                     /transl_table=11
                     /product="Anhydrase family 3 protein"
                     /protein_id="YP_005928037.1"
                     /db_xref="GI:386009760"
                     /db_xref="GeneID:12518354"
                     /translation="MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVR
                     GDMHRIRIGARTSVQDGSVLHITHAGPFNTDGFPLIIGDEVTIGHKVMLHGCTLGNRI
                     LVGMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFS
                     YSAGNYVKLKDQHLAEGYDQPE"
     misc_feature    complement(127367..127891)
                     /locus_tag="PPUBIRD1_0123"
                     /note="Carbonic anhydrases/acetyltransferases, isoleucine
                     patch superfamily [General function prediction only];
                     Region: PaaY; COG0663"
                     /db_xref="CDD:223735"
     misc_feature    complement(127379..127858)
                     /locus_tag="PPUBIRD1_0123"
                     /note="Gamma carbonic anhydrase-like: This family is
                     composed of gamma carbonic anhydrase (CA), Ferripyochelin
                     Binding Protein (FBP), E. coli paaY protein, and similar
                     proteins. CAs are zinc-containing enzymes that catalyze
                     the reversible hydration of carbon...; Region:
                     LbH_gamma_CA_like; cd04645"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(127574..127576,127610..127612,
                     127616..127627,127697..127699,127709..127714,
                     127754..127756,127760..127762,127766..127771,
                     127778..127780,127814..127816,127823..127828,
                     127832..127834,127838..127840))
                     /locus_tag="PPUBIRD1_0123"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100051"
     misc_feature    complement(order(127610..127612,127625..127627,
                     127697..127699))
                     /locus_tag="PPUBIRD1_0123"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:100051"
     gene            127994..130045
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /db_xref="GeneID:12518355"
     CDS             127994..130045
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /EC_number="3.4.24.70"
                     /note="Oligopeptidase A"
                     /codon_start=1
                     /transl_table=11
                     /product="OpdA"
                     /protein_id="YP_005928038.1"
                     /db_xref="GI:386009761"
                     /db_xref="GeneID:12518355"
                     /translation="MTANNPLLQSHDLPPFSQIRAEHVLPAIEAILADNRKAIAEILE
                     KQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYESCLPALSAYSTE
                     LGQNRALFEAYQALIDSPEAAGFDVAQKTILEHALRDFRLSGIDLPADKQQRYAEVQS
                     KLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQAKGLDGWLITLE
                     FPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMREILDLRQELAELL
                     GYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAYAAEQGCPELASW
                     DAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEIAELKGFDSWHPD
                     VRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQLQSPVANLVCNFT
                     PAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAWDAVELPSQFMEN
                     WCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLEFSLFDFELHASH
                     GDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADAF
                     SRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDALLRHSGLTEDAA
                     A"
     misc_feature    128006..130024
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    128057..130024
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /note="Peptidase family M3 dipeptidyl carboxypeptidase
                     (DCP); Region: M3A_DCP; cd06456"
                     /db_xref="CDD:188995"
     misc_feature    order(129257..129265,129401..129406,129413..129415,
                     129491..129493,129500..129502,129647..129649,
                     129767..129772,129788..129793,129803..129811,
                     129821..129823,129830..129832)
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /note="active site"
                     /db_xref="CDD:188995"
     misc_feature    order(129401..129403,129413..129415,129491..129493)
                     /gene="opdA"
                     /locus_tag="PPUBIRD1_0124"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:188995"
     gene            130042..130323
                     /locus_tag="PPUBIRD1_0125"
                     /db_xref="GeneID:12518356"
     CDS             130042..130323
                     /locus_tag="PPUBIRD1_0125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928039.1"
                     /db_xref="GI:386009762"
                     /db_xref="GeneID:12518356"
                     /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNEDGVPHRECVAC
                     GFTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAE"
     misc_feature    130066..130290
                     /locus_tag="PPUBIRD1_0125"
                     /note="Probable metal-binding protein (DUF2387); Region:
                     DUF2387; pfam09526"
                     /db_xref="CDD:150261"
     gene            130447..132441
                     /locus_tag="PPUBIRD1_0126"
                     /db_xref="GeneID:12518357"
     CDS             130447..132441
                     /locus_tag="PPUBIRD1_0126"
                     /EC_number="3.4.24.70"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M3A and M3B, thimet/oligopeptidase F"
                     /protein_id="YP_005928040.1"
                     /db_xref="GI:386009763"
                     /db_xref="GeneID:12518357"
                     /translation="MDNPLLQNSHIPVDYSSITLENMQAAFDHVLLAHEKGVERIILD
                     QRAMPTWDDMVLAVDELDSRLLAVLYGASPLVGRDMDWANAITDVYGRATARFEQKFA
                     NSGLHDLYERLAKSDIGKQLDAGKRATLRWHLDKFVASGALLDTAGKARLADLQAQIG
                     TARKAFRSNIYRPGLSITDEAELSGIPQRVRDELAARAKEAGKQGWLIACDTVTTSEV
                     LKHADSRQLRERVYRAFHARGVSHDPQQDNRSHLQRLAQLLEEKALLLGFPSHLEQSL
                     QVKSAGSVAHVCGFLHDLADHVRPAMLQWRSQVEGRAAEQGLGKPQPWDFEYLQRASR
                     SEFPTAALRDYFPLNTVVSALQQLAQKLFGVVLQPKALAAWDDSVQPFEVWQDSAFIG
                     FLYLDAVQHAGKQPDAVFTTYVRNRRVDAEGIYHAASVVVFSDVPQAPPGFQPLLDHL
                     SLRKLFHEFGHALHHLLVRTTNHVMSNVTELGTDGVELFGKLFERWVWDADYLVAISA
                     HARDGSQLTRKQADKCLQQLRQRGVEEIARHLSLALFDMDLHATPNDGRSFEQRLGNA
                     RERCGYWPLADFEHPAHAFDHLVDGYDAGYYAYLWSDVHAFDLFTRFEAEGLLNRATG
                     RALQEALFAPGASRPLREGIEAFLGRQSNQAAYLRWHGLK"
     misc_feature    130447..132438
                     /locus_tag="PPUBIRD1_0126"
                     /note="Zn-dependent oligopeptidases [Amino acid transport
                     and metabolism]; Region: Dcp; COG0339"
                     /db_xref="CDD:223416"
     misc_feature    130507..132435
                     /locus_tag="PPUBIRD1_0126"
                     /note="Peptidase Gluzincin family (thermolysin-like
                     proteinases, TLPs) includes peptidases M1, M2, M3, M4,
                     M13, M32 and M36 (fungalysins); Region: GluZincin;
                     cl14813"
                     /db_xref="CDD:265459"
     misc_feature    order(131815..131817,131827..131829,131905..131907)
                     /locus_tag="PPUBIRD1_0126"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189001"
     gene            132512..133570
                     /locus_tag="PPUBIRD1_0127"
                     /db_xref="GeneID:12518358"
     CDS             132512..133570
                     /locus_tag="PPUBIRD1_0127"
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="YP_005928041.1"
                     /db_xref="GI:386009764"
                     /db_xref="GeneID:12518358"
                     /translation="MIPPAPQKGRGTAHNPHNRFASGRSVAEDDGWYQEVPQTQGTEV
                     RIETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLI
                     AKTNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTI
                     VTKGSLVLRDLDLLAEMARQRLARVMISLTTLDDDLKRVLEPRAASPGARLRAIRVLR
                     EAGVPVGVLCSPMIPMINDSELERLLEAAKEAGAQSAAYMMLRLPLEVAPLFEQWLQD
                     HYPQRAAHVLSLIRQSRGGELYDSRFGVRMRGEGVFAELLAQRFARAMKRLDFEGRDA
                     QALDCSAFCPPGGQMALF"
     misc_feature    132620..133492
                     /locus_tag="PPUBIRD1_0127"
                     /note="DNA repair photolyase [DNA replication,
                     recombination, and repair]; Region: SplB; COG1533"
                     /db_xref="CDD:224450"
     misc_feature    132710..133318
                     /locus_tag="PPUBIRD1_0127"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(132728..132730,132734..132736,132740..132742,
                     132746..132754,132887..132889,132893..132898,
                     132992..133000,133073..133075,133196..133198,
                     133289..133294)
                     /locus_tag="PPUBIRD1_0127"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            133874..134593
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /db_xref="GeneID:12518359"
     CDS             133874..134593
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /EC_number="4.2.1.1"
                     /note="carbonate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="CynT"
                     /protein_id="YP_005928042.1"
                     /db_xref="GI:386009765"
                     /db_xref="GeneID:12518359"
                     /translation="MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELF
                     KKLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAI
                     EYAVMALKVHHIIICGHSDCGAMRAVLNPQSLTKMPTVGAWLRHAEVARTVVENNCSC
                     GSEHETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAAS
                     DSFLPLAAGEPVPCATPRGRY"
     misc_feature    133955..134515
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeB; cd00884"
                     /db_xref="CDD:238449"
     misc_feature    order(134024..134026,134030..134032,134051..134053,
                     134057..134065,134099..134101,134108..134110,
                     134183..134185,134198..134200,134228..134230,
                     134237..134239,134483..134485)
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238449"
     misc_feature    order(134051..134053,134057..134059,134228..134230,
                     134237..134239)
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238449"
     misc_feature    order(134054..134065,134069..134071,134075..134086,
                     134099..134107,134111..134113,134117..134119,
                     134168..134173,134180..134185,134300..134302,
                     134483..134485,134489..134494,134498..134500,
                     134504..134506)
                     /gene="cynT"
                     /locus_tag="PPUBIRD1_0128"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238449"
     gene            134786..136318
                     /locus_tag="PPUBIRD1_0129"
                     /db_xref="GeneID:12518360"
     CDS             134786..136318
                     /locus_tag="PPUBIRD1_0129"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="YP_005928043.1"
                     /db_xref="GI:386009766"
                     /db_xref="GeneID:12518360"
                     /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLI
                     TGIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGR
                     LRLGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLEFPATLSAAL
                     PQESTGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVN
                     RVQVPADLSEAIDWLSPADLMQLADPALLVAAFALAFIASAETLLSAAAVDRMHSGQR
                     SDFDRELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVV
                     ALSSVLQQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLL
                     TGVLLGFALTLLKLAFKAARLKINLVSLDKDGHMELRLSGAATFLKVPALTQVLDTVP
                     PGTTLHVPLGNLSYIDHSCLELLEDWSRSNSANGSRLLIEQRRLKRRIEGRLRTTAGV
                     GA"
     misc_feature    134813..136288
                     /locus_tag="PPUBIRD1_0129"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    134813..135019
                     /locus_tag="PPUBIRD1_0129"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    135092..135907
                     /locus_tag="PPUBIRD1_0129"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            complement(136466..137107)
                     /locus_tag="PPUBIRD1_0130"
                     /db_xref="GeneID:12518361"
     CDS             complement(136466..137107)
                     /locus_tag="PPUBIRD1_0130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928044.1"
                     /db_xref="GI:386009767"
                     /db_xref="GeneID:12518361"
                     /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQD
                     AQGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHV
                     GLDCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEV
                     VHHSVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
     gene            137477..138604
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /db_xref="GeneID:12518362"
     CDS             137477..138604
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /EC_number="1.9.3.1"
                     /note="cytochrome c oxidase, subunit II"
                     /codon_start=1
                     /transl_table=11
                     /product="Cox2"
                     /protein_id="YP_005928045.1"
                     /db_xref="GI:386009768"
                     /db_xref="GeneID:12518362"
                     /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHM
                     TIFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVVMAI
                     PATKTLIDIYDASESDIDVQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDE
                     HYLLEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWARIEKPG
                     IYRGQCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVE
                     RGDKVYHTACVACHQAEGQGLPPMFPALKGSKIATGPKEDHLSIVFHGKPGTAMAAFG
                     KQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
     misc_feature    137498..138280
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 2 [Energy production and conversion]; Region:
                     CyoA; COG1622"
                     /db_xref="CDD:224537"
     misc_feature    137546..137785
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    137825..138226
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     misc_feature    <138257..138598
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    138293..138520
                     /gene="cox2"
                     /locus_tag="PPUBIRD1_0131"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            138648..140237
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /db_xref="GeneID:12518363"
     CDS             138648..140237
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /EC_number="1.9.3.1"
                     /note="cytochrome c oxidase, subunit I"
                     /codon_start=1
                     /transl_table=11
                     /product="Cox1"
                     /protein_id="YP_005928046.1"
                     /db_xref="GI:386009769"
                     /db_xref="GeneID:12518363"
                     /translation="MSAVIDDHAHGHDHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFI
                     MFLLGGSFAMVIRAELFQPGLQIVEPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIP
                     LMVGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASV
                     TFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPV
                     LAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIP
                     AFSRKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGV
                     KVFNWVSTMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAH
                     FHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNMAFFPMHFVGLA
                     GMPRRIPDYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEG
                     LEWSIPSPAPYHTFQTPPEVK"
     misc_feature    138705..140231
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    138732..140186
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Cytochrome C oxidase subunit I.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(138732..138734,138969..138971,138981..138983,
                     138987..138989,139008..139010,139128..139130,
                     139140..139142,139194..139196,139206..139208,
                     139266..139268,139287..139289,139296..139298,
                     139320..139322,139347..139355,139368..139373,
                     139377..139379,139407..139409,139518..139520,
                     139527..139529,139536..139541,139551..139553)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(138759..138761,138939..138941,138972..138974,
                     138993..138995,139002..139004,139164..139169,
                     139185..139187,139197..139199)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(138777..138779,138789..138791,138798..138800,
                     138810..138812,139047..139052,139893..139895,
                     140112..140114,140121..140123)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(138819..138821,138828..138833,139917..139919,
                     139926..139931,140028..140030,140082..140084)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(138867..138869,139377..139379,139488..139490,
                     139497..139502,139575..139583,139590..139592,
                     139599..139601,139623..139625,139647..139649,
                     139656..139658,139677..139685,139719..139721,
                     139773..139778,139782..139784,139788..139802,
                     139992..139997,140007..140015,140040..140045)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(138885..138887,139827..139829,139839..139841,
                     139965..139967,140076..140078)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139041..139043,139050..139052)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139107..139109,139335..139346)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139266..139268,139287..139289,139407..139409,
                     139518..139520,139527..139529,139536..139541,
                     139551..139553)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139377..139379,139392..139397,139785..139787,
                     139797..139802,140007..140009)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139416..139418,139563..139568,139821..139823)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(139416..139418,139428..139430,139461..139463,
                     139563..139568,139641..139643,139650..139652)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139491..139493,139503..139505,140181..140183)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(139566..139568,139797..139802,140007..140012)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    139581..139583
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    139680..139682
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139824..139826,140007..140012)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(139920..139922,140091..140093)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(140028..140030,140040..140042)
                     /gene="cox1"
                     /locus_tag="PPUBIRD1_0132"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            140247..140813
                     /gene="cox11"
                     /locus_tag="PPUBIRD1_0133"
                     /db_xref="GeneID:12518364"
     CDS             140247..140813
                     /gene="cox11"
                     /locus_tag="PPUBIRD1_0133"
                     /note="cytochrome C oxidase assembly protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Cox11"
                     /protein_id="YP_005928047.1"
                     /db_xref="GI:386009770"
                     /db_xref="GeneID:12518364"
                     /translation="MNGLSVKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKT
                     GGQYEGSQISDPTRAVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFIAHNPTD
                     RPMSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHL
                     TLAYTLFDITARHPPVAHVAAQDVQGAR"
     misc_feature    140247..140795
                     /gene="cox11"
                     /locus_tag="PPUBIRD1_0133"
                     /note="cytochrome C oxidase assembly protein; Provisional;
                     Region: PRK05089"
                     /db_xref="CDD:235341"
     gene            140830..141717
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /db_xref="GeneID:12518365"
     CDS             140830..141717
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /EC_number="1.9.3.1"
                     /note="cytochrome c oxidase, subunit III"
                     /codon_start=1
                     /transl_table=11
                     /product="Cox3"
                     /protein_id="YP_005928048.1"
                     /db_xref="GI:386009771"
                     /db_xref="GeneID:12518365"
                     /translation="MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDS
                     HGPLIFFVGALFLAYMLFGWFGAVVKESHAGLYSPQLDRSFRWGMSWFIFSEVMFFLA
                     FFGALFYVRVLAGPWLGGEGAKGVTHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWH
                     LPLINTILLVSSSVTITIAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYT
                     KLGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASW
                     YWHFVDVVWVGLFIFVYVL"
     misc_feature    140878..141711
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Cytochrome c oxidase subunit III.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_III; cd01665"
                     /db_xref="CDD:238834"
     misc_feature    order(141016..141018,141025..141030,141037..141039,
                     141046..141051)
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(141019..141024,141031..141036,141043..141045,
                     141058..141060,141091..141096,141103..141105,
                     141577..141579,141598..141600,141634..141639)
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(141067..141069,141076..141081,141112..141114,
                     141121..141123,141133..141138,141154..141156,
                     141508..141513,141520..141522,141532..141534)
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    141280..141282
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(141304..141312,141361..141363,141439..141441,
                     141469..141477,141502..141510)
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    141397..141399
                     /gene="cox3"
                     /locus_tag="PPUBIRD1_0134"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            142005..142742
                     /locus_tag="PPUBIRD1_0135"
                     /db_xref="GeneID:12518366"
     CDS             142005..142742
                     /locus_tag="PPUBIRD1_0135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928049.1"
                     /db_xref="GI:386009772"
                     /db_xref="GeneID:12518366"
                     /translation="MRPFRPGWVPTLAVLALLPGLIALGCWQLGRAEEKRVLLATYAE
                     RRIEAPIATAQLLSKEDNAFRRVHLYGRFDAEHSVLLDNRMRDGKPGVELLQPFHDQA
                     SGLWLLINRGWLPWLDRRVPVHFETPAQALALDASVYVAPGSTFQLHPDPIGGQWPHL
                     LTAIDAALLWQQLDREGFAQELRLEPGPASYRLDWPVVAMSPEKHVGYAVQWFALATA
                     LVLLYLYFGWHQNKEKRHGHRHSTGRA"
     misc_feature    142065..142670
                     /locus_tag="PPUBIRD1_0135"
                     /note="SURF1 superfamily. Surf1/Shy1 has been implicated
                     in the posttranslational steps of the biogenesis of the
                     mitochondrially-encoded Cox1 subunit of cytochrome c
                     oxidase (complex IV). Cytochrome c oxidase (complex IV),
                     the terminal electron-transferring...; Region: SURF1;
                     cd06662"
                     /db_xref="CDD:119401"
     gene            142711..143292
                     /locus_tag="PPUBIRD1_0136"
                     /db_xref="GeneID:12518367"
     CDS             142711..143292
                     /locus_tag="PPUBIRD1_0136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928050.1"
                     /db_xref="GI:386009773"
                     /db_xref="GeneID:12518367"
                     /translation="MATATPLDVPERSKPRARGRLQLLLILLVVLGPMVLATSMYKLK
                     FWVPEGRSYHGAMIGNGESRADLGVAGQGERWQLLVSAPQACTEDCQRLVYLARQIQI
                     GLGRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVVEPGPQLWIV
                     DPHGNLVLRYDGKVNGKHVLDDLRHLLKLSNIG"
     misc_feature    143131..>143286
                     /locus_tag="PPUBIRD1_0136"
                     /note="Nucleoside/nucleotide kinase (NK) is a protein
                     superfamily consisting of multiple families of enzymes
                     that share structural similarity and are functionally
                     related to the catalysis of the reversible phosphate group
                     transfer from nucleoside triphosphates...; Region: NK;
                     cl17190"
                     /db_xref="CDD:266541"
     gene            143302..144381
                     /locus_tag="PPUBIRD1_0137"
                     /db_xref="GeneID:12518368"
     CDS             143302..144381
                     /locus_tag="PPUBIRD1_0137"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome oxidase assembly"
                     /protein_id="YP_005928051.1"
                     /db_xref="GI:386009774"
                     /db_xref="GeneID:12518368"
                     /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGF
                     ISVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARD
                     GQPYRLPMLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRA
                     FAPLPKLPLSLRRIAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGRWWPAADFS
                     NGFHLTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLAR
                     LVLLALALQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDKVQVGVG
                     HGWRLRPVVGVGISHHMRNDSWRRF"
     misc_feature    143320..144252
                     /locus_tag="PPUBIRD1_0137"
                     /note="Cytochrome oxidase assembly protein; Region:
                     COX15-CtaA; pfam02628"
                     /db_xref="CDD:251431"
     gene            144366..145259
                     /locus_tag="PPUBIRD1_0138"
                     /db_xref="GeneID:12518369"
     CDS             144366..145259
                     /locus_tag="PPUBIRD1_0138"
                     /codon_start=1
                     /transl_table=11
                     /product="Protoheme IX farnesyltransferase 1"
                     /protein_id="YP_005928052.1"
                     /db_xref="GI:386009775"
                     /db_xref="GeneID:12518369"
                     /translation="MATLLSVRRARWRDYLELTKPKVVVLMLITSLAGMFLATRAGVS
                     WSVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALAL
                     ALLGMVLLLVFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGW
                     VAVSGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHI
                     LLYTLILLAVSLLPYAIHMSGPLYLACALGLGLRFLRWAWVLYRSSRPHAAIGTFKYS
                     IGYLFALFIALLLDHYLLLSL"
     misc_feature    144411..145202
                     /locus_tag="PPUBIRD1_0138"
                     /note="Protoheme IX farnesyltransferase; Region:
                     PT_UbiA_Cox10; cd13957"
                     /db_xref="CDD:260120"
     misc_feature    order(144573..144575,144585..144587,144951..144953)
                     /locus_tag="PPUBIRD1_0138"
                     /note="putative active site [active]"
                     /db_xref="CDD:260120"
     gene            145256..145888
                     /locus_tag="PPUBIRD1_0139"
                     /db_xref="GeneID:12518370"
     CDS             145256..145888
                     /locus_tag="PPUBIRD1_0139"
                     /codon_start=1
                     /transl_table=11
                     /product="Electron transport protein SCO1/SenC"
                     /protein_id="YP_005928053.1"
                     /db_xref="GI:386009776"
                     /db_xref="GeneID:12518370"
                     /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGII
                     LLPQSRAVADVTMTNQDGQPVQMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSEL
                     PKDAVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFI
                     PADTSKPGYTVDHSGNLAIVGPDGRQRGFIRAPFNNQKLGAQLPGLVKRD"
     misc_feature    145409..145831
                     /locus_tag="PPUBIRD1_0139"
                     /note="SCO (an acronym for Synthesis of Cytochrome c
                     Oxidase) family; composed of proteins similar to Sco1, a
                     membrane-anchored protein possessing a soluble domain with
                     a TRX fold. Members of this family are required for the
                     proper assembly of cytochrome c...; Region: SCO; cd02968"
                     /db_xref="CDD:239266"
     misc_feature    order(145505..145507,145517..145519,145772..145774)
                     /locus_tag="PPUBIRD1_0139"
                     /note="Cu(I) binding site [ion binding]; other site"
                     /db_xref="CDD:239266"
     gene            complement(145982..146752)
                     /locus_tag="PPUBIRD1_0140"
                     /db_xref="GeneID:12518371"
     CDS             complement(145982..146752)
                     /locus_tag="PPUBIRD1_0140"
                     /codon_start=1
                     /transl_table=11
                     /product="NLPA lipoprotein"
                     /protein_id="YP_005928054.1"
                     /db_xref="GI:386009777"
                     /db_xref="GeneID:12518371"
                     /translation="MKKLLAVAAAVAAFSAQADTLTVAATPVPHAEILNFVKPQLAKE
                     GVELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTQLVSVAGVHIEPLG
                     VYSTKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAEN
                     PKNVKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVA
                     RPDNKDSDDMKKLAAALHSPEVKQFIIDKYKGAVVPAF"
     misc_feature    complement(145985..146695)
                     /locus_tag="PPUBIRD1_0140"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface antigen [Inorganic ion transport and
                     metabolism]; Region: NlpA; COG1464"
                     /db_xref="CDD:224381"
     gene            complement(146817..147488)
                     /locus_tag="PPUBIRD1_0141"
                     /db_xref="GeneID:12518372"
     CDS             complement(146817..147488)
                     /locus_tag="PPUBIRD1_0141"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_005928055.1"
                     /db_xref="GI:386009778"
                     /db_xref="GeneID:12518372"
                     /translation="MDALNFFANVDWAEIWLATVDTMIMLFGSLFFTVLLGLPLGVLL
                     FLCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPL
                     VVGATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTA
                     ITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVV
                     HFSRK"
     misc_feature    complement(<146985..147323)
                     /locus_tag="PPUBIRD1_0141"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(146985..146996,147015..147017,
                     147024..147029,147069..147071,147120..147122,
                     147129..147134,147144..147146,147150..147155,
                     147162..147164,147168..147170,147174..147179,
                     147243..147245,147249..147254,147261..147290,
                     147294..147305))
                     /locus_tag="PPUBIRD1_0141"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(146985..146996,147243..147287))
                     /locus_tag="PPUBIRD1_0141"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(147048..147050,147060..147065,
                     147081..147119))
                     /locus_tag="PPUBIRD1_0141"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(147488..148495)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /db_xref="GeneID:12518373"
     CDS             complement(147488..148495)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="Methionine import ATP-binding protein metN1"
                     /codon_start=1
                     /transl_table=11
                     /product="MetN1"
                     /protein_id="YP_005928056.1"
                     /db_xref="GI:386009779"
                     /db_xref="GeneID:12518373"
                     /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGK
                     STMLRLINRLEEPSGGTIVVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADN
                     VALPLALAGELSRSEIDKRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNP
                     KILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAG
                     QIVEQGSVAEVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYA
                     PLLGTVARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVL
                     R"
     misc_feature    complement(147491..148495)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="DL-methionine transporter ATP-binding subunit;
                     Provisional; Region: metN; PRK11153"
                     /db_xref="CDD:236863"
     misc_feature    complement(147794..148495)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="ATP-binding cassette domain of methionine
                     transporter; Region: ABC_MetN_methionine_transporter;
                     cd03258"
                     /db_xref="CDD:213225"
     misc_feature    complement(148361..148384)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(order(147896..147898,147995..148000,
                     148229..148231,148358..148366,148370..148375))
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(148229..148240)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(148043..148072)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(147995..148012)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="Walker B; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(147977..147988)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="D-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(147890..147910)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(147494..147712)
                     /gene="metN1"
                     /locus_tag="PPUBIRD1_0142"
                     /note="This domain is found at the C-terminus of ABC
                     transporter proteins involved in D-methionine transport as
                     well as a number of ferredoxin-like proteins; Region: NIL;
                     smart00930"
                     /db_xref="CDD:197998"
     gene            148723..150858
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /db_xref="GeneID:12518374"
     CDS             148723..150858
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /EC_number="1.11.1.6"
                     /note="Catalase HPII"
                     /codon_start=1
                     /transl_table=11
                     /product="KatE"
                     /protein_id="YP_005928057.1"
                     /db_xref="GI:386009780"
                     /db_xref="GeneID:12518374"
                     /translation="MPSKKTDAPKHSEAAGTQTPDRANTNVKLQSLEADRSDATGQAL
                     RTNQGVRIADNQNSLKAGDRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFF
                     QSYGNHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNF
                     DLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVM
                     WAMSDRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPRQGVHSLLWDEAQKLAG
                     KDTDFQRRDLWEAIETGDYPEWELGVQIVPEADEHKFDFDLLDPTKIIPEELVPVTPL
                     GKMVLNRNPDNFFAEVEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNF
                     HQIPINRPVAPNHNNQRDALHQHVVHKGRASYEPNSIDGGWPKETPPAAQDGGFESYQ
                     ERIDAHKIRQRSESFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREHIRAREV
                     NEILANIDLKLAAAVAANLGLPAPKAGTVQVKGSQLAQSPALSQMNHPGSVGIKGRKI
                     AVLVADGVDAASVDKLVKALEAHSARPMLLGPTSAPVKAADGKQLPVAASMEGMPSIM
                     FDGIIVPAGKASTDALAASGLAKHFVLEGYKHLKALVLTKELAKALGLKEDKGLLLGD
                     EQKAVDAFVKAVEGHRVWEREAAAEAVPA"
     misc_feature    148723..150855
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="hydroperoxidase II; Provisional; Region: katE;
                     PRK11249"
                     /db_xref="CDD:236886"
     misc_feature    148966..150303
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="Clade 2 of the heme-binding enzyme catalase;
                     Region: catalase_clade_2; cd08155"
                     /db_xref="CDD:163711"
     misc_feature    order(148975..148977,148990..148992,149134..149139,
                     149194..149199,149242..149256,149260..149262,
                     149269..149271,149287..149304,149326..149328,
                     149335..149337,149527..149529,149536..149538,
                     149545..149550,149560..149562,149569..149574,
                     149581..149583,149650..149655,149668..149670,
                     149674..149676,149752..149754,149758..149763,
                     149767..149769,149776..149778,149797..149802,
                     149824..149826,149830..149832,149839..149841,
                     149848..149856,149863..149868,149875..149883,
                     149890..149895,149899..149910,149920..149922,
                     149932..149937,149941..149943,149950..149952,
                     149956..149964,149989..150006,150208..150213,
                     150220..150222,150226..150228,150238..150240)
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:163711"
     misc_feature    order(148996..148998,149113..149115,149215..149217,
                     149230..149232,149254..149256,149845..149847,
                     149857..149859)
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="heme binding pocket [chemical binding]; other site"
                     /db_xref="CDD:163711"
     misc_feature    150409..150816
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in at the C-terminal of several large
                     catalases; Region: GATase1_catalase; cd03132"
                     /db_xref="CDD:153226"
     misc_feature    order(150517..150525,150664..150666,150673..150675)
                     /gene="katE"
                     /locus_tag="PPUBIRD1_0143"
                     /note="domain interactions; other site"
                     /db_xref="CDD:153226"
     gene            complement(150919..151626)
                     /locus_tag="PPUBIRD1_0144"
                     /db_xref="GeneID:12518375"
     CDS             complement(150919..151626)
                     /locus_tag="PPUBIRD1_0144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928058.1"
                     /db_xref="GI:386009781"
                     /db_xref="GeneID:12518375"
                     /translation="MKPFASRYLLVAAFSLILAACSNAPVEQATAPAQADAWQQLQQN
                     IASNELATAEDQLAALQAQSPDDARLEQYQRQLAEAYLQRSQIVLQKGDVNAAATALA
                     RARALMPQAPAVTGGDAVTQARKAELEKAEAALKAAEAKPEARIIDPTAPSTVVALKT
                     TDSRALRRQLDDIAADVVSYQCEVVFQVPRTEDAPWLKTLLEKRVRKIDSGFELKQKH
                     EIQRSLPAQVVLVPHQQ"
     gene            complement(151753..152484)
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /db_xref="GeneID:12518376"
     CDS             complement(151753..152484)
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /codon_start=1
                     /transl_table=11
                     /product="ZnuB"
                     /protein_id="YP_005928059.1"
                     /db_xref="GI:386009782"
                     /db_xref="GeneID:12518376"
                     /translation="MQAHWAPSWYGGAWPIFGDTLSHAALLGVALGFALDVSPALAVT
                     VGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDL
                     LAISTSDLAWILGGSALVLLLLAVLWRPLLAVTVHEELAMVEGLPVAGLRLALMLLIA
                     VVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFK
                     DTPAGPSIVVCAAVLFLLSLALPKR"
     misc_feature    complement(151771..152436)
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(151771..151773,151780..151785,
                     151792..151794,151801..151806,151813..151815,
                     151960..151962,152188..152190,152197..152202,
                     152230..152232,152236..152241,152248..152250,
                     152257..152262,152269..152274,152281..152286,
                     152290..152292,152431..152433))
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(151822..151824,151837..151839,
                     151972..151974,151984..151986,152158..152160,
                     152230..152232))
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     misc_feature    complement(order(151906..151908,151927..151929,
                     152053..152061,152065..152082,152086..152091,
                     152095..152103,152107..152112))
                     /gene="znuB"
                     /locus_tag="PPUBIRD1_0145"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     gene            complement(152529..153302)
                     /gene="znuC"
                     /locus_tag="PPUBIRD1_0146"
                     /db_xref="GeneID:12518377"
     CDS             complement(152529..153302)
                     /gene="znuC"
                     /locus_tag="PPUBIRD1_0146"
                     /note="Zinc import ATP-binding protein znuC"
                     /codon_start=1
                     /transl_table=11
                     /product="ZnuC"
                     /protein_id="YP_005928060.1"
                     /db_xref="GI:386009783"
                     /db_xref="GeneID:12518377"
                     /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGK
                     TTLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAA
                     LSALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTEL
                     YNLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELF
                     GKTAPSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
     misc_feature    complement(152619..153302)
                     /gene="znuC"
                     /locus_tag="PPUBIRD1_0146"
                     /note="high-affinity zinc transporter ATPase; Reviewed;
                     Region: znuC; PRK09544"
                     /db_xref="CDD:181939"
     misc_feature    complement(152694..153284)
                     /gene="znuC"
                     /locus_tag="PPUBIRD1_0146"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            complement(153299..153784)
                     /locus_tag="PPUBIRD1_0147"
                     /db_xref="GeneID:12518378"
     CDS             complement(153299..153784)
                     /locus_tag="PPUBIRD1_0147"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferric uptake regulator family protein"
                     /protein_id="YP_005928061.1"
                     /db_xref="GI:386009784"
                     /db_xref="GeneID:12518378"
                     /translation="MSITPLANRPHDHSHCVHSALAEADALCTRQGLRLTALRRRVLE
                     LVWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSH
                     PEHVHQGQFLICRACHVAIELEQSSISEAIINSAKGVGFTVETQTVEVVGLCGNCRSA
                     A"
     misc_feature    complement(153323..153670)
                     /locus_tag="PPUBIRD1_0147"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(153419..153421,153464..153466,
                     153470..153472,153491..153493,153629..153631))
                     /locus_tag="PPUBIRD1_0147"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(153530..153574)
                     /locus_tag="PPUBIRD1_0147"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(153347..153349,153398..153400,
                     153467..153469,153473..153475))
                     /locus_tag="PPUBIRD1_0147"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(153326..153352,153356..153364,
                     153389..153394,153440..153448))
                     /locus_tag="PPUBIRD1_0147"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(153323..153325,153434..153436,
                     153443..153445))
                     /locus_tag="PPUBIRD1_0147"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            153914..154759
                     /locus_tag="PPUBIRD1_0148"
                     /db_xref="GeneID:12518379"
     CDS             153914..154759
                     /locus_tag="PPUBIRD1_0148"
                     /codon_start=1
                     /transl_table=11
                     /product="Periplasmic solute binding protein"
                     /protein_id="YP_005928062.1"
                     /db_xref="GI:386009785"
                     /db_xref="GeneID:12518379"
                     /translation="MLTTIKPLQQIAAAVQEGVGSPDVLLPPGASPHHYALRPSDVRR
                     VGDADLLYWIGPDMENFLARVLGSRSKATVAVQSLPGMKLRHFGEDSHSHNEEDHDDH
                     DHDHRPGSLDAHLWLSSVNARVIAAKMAADLAHVDPANAARYQSNLKAFDERLDALDG
                     RIKARVTGIAGKPYFVFHEAFDYFEAEYGLKHAGVFSVASEVQPGAQHVAAMRKRLQE
                     VGKTCVFSEPPLRPRLAETLTAGLPVRLAELDALGGTDPVDGKGYERLLEKLGGDLAG
                     CLEQL"
     misc_feature    153917..154747
                     /locus_tag="PPUBIRD1_0148"
                     /note="Zinc binding protein ZnuA. These proteins have been
                     shown to function as initial receptors in the ABC uptake
                     of Zn2+.  They belong to the TroA superfamily of
                     periplasmic metal binding proteins that share a distinct
                     fold and ligand binding mechanism; Region: ZnuA; cd01019"
                     /db_xref="CDD:238501"
     misc_feature    153917..154720
                     /locus_tag="PPUBIRD1_0148"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    order(154010..154012,154253..154255,154445..154447,
                     154661..154663)
                     /locus_tag="PPUBIRD1_0148"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238501"
     gene            complement(154869..155819)
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /db_xref="GeneID:12518380"
     CDS             complement(154869..155819)
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /EC_number="2.7.1.39"
                     /note="homoserine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="ThrB"
                     /protein_id="YP_005928063.1"
                     /db_xref="GI:386009786"
                     /db_xref="GeneID:12518380"
                     /translation="MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLE
                     QGEFVLTLIERGPSEDMPFFIELLDTLHGADMPVPYAIRDRDGNGLRELCGKPALLQP
                     RLSGKHIKAPNNQHCAQVGELLAHIHLATREHIIERRTDRGLDWMLASGAELLPRLTA
                     EQAALLQPALEEISAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPM
                     LYDIAITVNDWCLDEQGAVDVPRAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWL
                     SRLIAAESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
     misc_feature    complement(154905..155795)
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /note="Homoserine Kinase, type II. Homoserine kinase is
                     part of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs), RIO
                     kinases, actin-fragmin kinase (AFK), and...; Region:
                     HomoserineK_II; cd05153"
                     /db_xref="CDD:240174"
     misc_feature    complement(155106..155744)
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    complement(order(155136..155138,155193..155198,
                     155226..155228,155232..155237,155247..155249,
                     155508..155519,155583..155585,155667..155669,
                     155673..155675,155706..155708,155718..155720))
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /note="putative active site [active]"
                     /db_xref="CDD:240174"
     misc_feature    complement(order(155136..155138,155247..155249,
                     155718..155720))
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240174"
     misc_feature    complement(order(155193..155198,155226..155228,
                     155232..155237,155247..155249,155508..155519,
                     155583..155585,155667..155669,155673..155675,
                     155706..155708))
                     /gene="thrB"
                     /locus_tag="PPUBIRD1_0149"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240174"
     gene            complement(155889..156176)
                     /locus_tag="PPUBIRD1_0150"
                     /db_xref="GeneID:12518381"
     CDS             complement(155889..156176)
                     /locus_tag="PPUBIRD1_0150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928064.1"
                     /db_xref="GI:386009787"
                     /db_xref="GeneID:12518381"
                     /translation="MRTLNRLLLLGLLATMPVVTLAADDAPSADPEVTIRTEGDKTIQ
                     EYRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
     misc_feature    complement(155892..>156101)
                     /locus_tag="PPUBIRD1_0150"
                     /note="Protein of unknown function (DUF2782); Region:
                     DUF2782; pfam11191"
                     /db_xref="CDD:256344"
     gene            156252..158999
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /db_xref="GeneID:12518382"
     CDS             156252..158999
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /EC_number="2.7.7.7"
                     /note="DNA polymerase I"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PolA"
                     /protein_id="YP_005928065.1"
                     /db_xref="GI:386009788"
                     /db_xref="GeneID:12518382"
                     /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLK
                     SLRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQIEPLHASVKALGYP
                     LLCVEGVEADDVIGTLARSSAALGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVA
                     GVHEKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDK
                     VPTLAIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVEALVCGEPDREALLAL
                     YTEMEFKSWVAEVQRDAAKAGDDVAPAVEPAAKVEPKYETILDQARFDAWLEKLRQAP
                     LFAFDTETTGLDAQQAQLVGLSFAVEPHEAAYVPLAHDYEGAPAQLDREAVLLALKPL
                     LEDPAKAKVGQNAKYDINILANGSPAIEMRGVAYDTMLESYVLNSTATRHDMDSLAQK
                     YLDHTTIAFEDIAGKGAKQLTFNQINLDKAGPYAAEDADITLRLHDALQARLAQTPSV
                     QPVLMDIEMPLVPVLARIERQGALVDAELLKVQSGELGVKMAELELRAYELAGETFNL
                     GSPKQLGTILYDKLGMPVLSKTAKGQPSTAEAVLDELALQGYPLPEVLMQYRSLSKLK
                     STYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIA
                     SPGYKLLAADYSQIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALEDVTTDQ
                     RRSAKAINFGLIYGMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAE
                     QGFVETLFGRRLYLPDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVKVDNWLSE
                     SGLDARVILQVHDELVLEVREDLVQQVKDEIRQHMSQAAQLDVPLLVEAGVGANWDEA
                     H"
     misc_feature    156264..158996
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="DNA polymerase I; Provisional; Region: PRK05755"
                     /db_xref="CDD:235591"
     misc_feature    156267..156743
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="PIN domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: PIN_53EXO; cd09859"
                     /db_xref="CDD:189029"
     misc_feature    order(156279..156281,156429..156431,156579..156581,
                     156585..156590,156654..156656,156660..156662)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="active site"
                     /db_xref="CDD:189029"
     misc_feature    order(156279..156281,156585..156587,156654..156656)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    156447..156485
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="putative 5' ssDNA interaction site; other site"
                     /db_xref="CDD:189029"
     misc_feature    order(156579..156581,156588..156590)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="metal binding site 3; metal-binding site"
                     /db_xref="CDD:189029"
     misc_feature    order(156654..156656,156660..156662)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189029"
     misc_feature    156759..157001
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="H3TH domain of the 5'-3' exonuclease of Taq DNA
                     polymerase I and homologs; Region: H3TH_53EXO; cd09898"
                     /db_xref="CDD:188618"
     misc_feature    order(156789..156812,156816..156845,156882..156887)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:188618"
     misc_feature    order(156795..156797,156804..156806)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:188618"
     misc_feature    157236..157826
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="DEDDy 3'-5' exonuclease domain of Escherichia coli
                     DNA polymerase I and similar bacterial family-A DNA
                     polymerases; Region: DNA_polA_I_Ecoli_like_exo; cd06139"
                     /db_xref="CDD:176651"
     misc_feature    order(157266..157277,157284..157286,157458..157463,
                     157467..157475,157578..157583,157626..157631,
                     157698..157700,157710..157712)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="active site"
                     /db_xref="CDD:176651"
     misc_feature    order(157266..157268,157272..157274,157473..157475,
                     157698..157700,157710..157712)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176651"
     misc_feature    order(157269..157277,157284..157286,157458..157463,
                     157467..157472,157578..157583,157626..157631,
                     157698..157700,157710..157712)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176651"
     misc_feature    157851..158987
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="Polymerase I functions primarily to fill DNA gaps
                     that arise during DNA repair, recombination and
                     replication; Region: DNA_pol_A_pol_I_C; cd08637"
                     /db_xref="CDD:176474"
     misc_feature    order(158103..158105,158115..158117,158124..158129,
                     158202..158210,158214..158216,158220..158231,
                     158325..158330,158412..158414,158472..158474,
                     158484..158486,158736..158738,158757..158759,
                     158850..158858)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="active site"
                     /db_xref="CDD:176474"
     misc_feature    order(158103..158105,158115..158117,158124..158129,
                     158202..158210,158214..158216,158220..158231,
                     158508..158510,158733..158738,158745..158747,
                     158757..158759,158850..158858)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:176474"
     misc_feature    order(158325..158330,158334..158336,158412..158414,
                     158472..158474,158484..158486,158856..158858)
                     /gene="polA"
                     /locus_tag="PPUBIRD1_0151"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176474"
     gene            complement(159545..160177)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /db_xref="GeneID:12518383"
     CDS             complement(159545..160177)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="Probable GTP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein EngB"
                     /protein_id="YP_005928066.1"
                     /db_xref="GI:386009789"
                     /db_xref="GeneID:12518383"
                     /translation="MQVKNPILGLCQKAKFALSAAKVEQCPDDQGYEVAFAGRSNAGK
                     SSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKH
                     LEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGK
                     NTLLKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLADWMELEDKPVV"
     misc_feature    complement(159560..160150)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="Predicted GTPase [General function prediction
                     only]; Region: COG0218"
                     /db_xref="CDD:223296"
     misc_feature    complement(159572..160081)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="YihA (EngB) GTPase family; Region: YihA_EngB;
                     cd01876"
                     /db_xref="CDD:206665"
     misc_feature    complement(160043..160066)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="G1 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(159623..159628,159722..159724,
                     159728..159730,159932..159934,159980..159988,
                     159995..160003,160040..160060))
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206665"
     misc_feature    complement(159971..159991)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(159980..159982)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="G2 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(159923..159934)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="G3 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(order(159839..159844,159851..159895,
                     159914..159925))
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(159722..159733)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="G4 box; other site"
                     /db_xref="CDD:206665"
     misc_feature    complement(159620..159628)
                     /gene="engB"
                     /locus_tag="PPUBIRD1_0152"
                     /note="G5 box; other site"
                     /db_xref="CDD:206665"
     gene            160379..160681
                     /locus_tag="PPUBIRD1_0153"
                     /db_xref="GeneID:12518384"
     CDS             160379..160681
                     /locus_tag="PPUBIRD1_0153"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c-type protein"
                     /protein_id="YP_005928067.1"
                     /db_xref="GI:386009790"
                     /db_xref="GeneID:12518384"
                     /translation="MAKWLLAVGMFLPFFSAQATQDPEVLYNRTCAACHTGQLPQAPR
                     RGDRAAWEPRLAQGMDVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
     misc_feature    <160427..160675
                     /locus_tag="PPUBIRD1_0153"
                     /note="Cytochrome c5 [Energy production and conversion];
                     Region: CycB; COG3245"
                     /db_xref="CDD:225784"
     gene            160728..161330
                     /locus_tag="PPUBIRD1_0154"
                     /db_xref="GeneID:12518385"
     CDS             160728..161330
                     /locus_tag="PPUBIRD1_0154"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="YP_005928068.1"
                     /db_xref="GI:386009791"
                     /db_xref="GeneID:12518385"
                     /translation="MSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNPDGNSL
                     APNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLAAFSDQDLADIAAYFSSQKGSV
                     GAADPKLVERGRALFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQYVAKQL
                     TDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
     misc_feature    160728..161084
                     /locus_tag="PPUBIRD1_0154"
                     /note="Cytochrome c553 [Energy production and conversion];
                     Region: COG2863"
                     /db_xref="CDD:225418"
     misc_feature    161055..161324
                     /locus_tag="PPUBIRD1_0154"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            161482..162114
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /db_xref="GeneID:12518386"
     CDS             161482..162114
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /note="DSBA oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="DsbA family thiol:disulfide interchange protein"
                     /protein_id="YP_005928069.1"
                     /db_xref="GI:386009792"
                     /db_xref="GeneID:12518386"
                     /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYIELSNPVPVSVP
                     GKIEVVELFWYGCPHCYHFEPTINPWAEKLPKDVNFKRVPAMFGGPWDAHGQMFLTLE
                     AMGVEHKVHAAVFDAIQNQHKRLTDKNDMADFLATQGVDKDKFLATFDSFAIQGQVKQ
                     AKELAKKYEITGVPSMVVNGKYRFDLGTAGGPEGVLNVADQLIDKERAAK"
     misc_feature    161563..162105
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /note="DsbA family, DsbA subfamily; DsbA is a monomeric
                     thiol disulfide oxidoreductase protein containing a redox
                     active CXXC motif imbedded in a TRX fold. It is involved
                     in the oxidative protein folding pathway in prokaryotes,
                     and is the strongest thiol...; Region: DsbA_DsbA; cd03019"
                     /db_xref="CDD:239317"
     misc_feature    order(161650..161652,161656..161661,162001..162003)
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239317"
     misc_feature    161740..161748
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /note="hinge region; other site"
                     /db_xref="CDD:239317"
     misc_feature    order(161758..161784,161797..161856,161866..161892,
                     161908..161937)
                     /gene="dsbA"
                     /locus_tag="PPUBIRD1_0155"
                     /note="alpha helical domain; other site"
                     /db_xref="CDD:239317"
     gene            162127..162981
                     /locus_tag="PPUBIRD1_0156"
                     /db_xref="GeneID:12518387"
     CDS             162127..162981
                     /locus_tag="PPUBIRD1_0156"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease/exonuclease/phosphatase"
                     /protein_id="YP_005928070.1"
                     /db_xref="GI:386009793"
                     /db_xref="GeneID:12518387"
                     /translation="MPRFRATRGIGLHEPQVNEHHLQAPGLPEDGRLRLLSFNIQVGI
                     STERYRHYLTRSWQHLLPHNGRAVNLQKIGRLLGDFDLVALQEADGGSLRSGYVNQVE
                     HLAHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQLLEDHPLPGPAGRGAILVRFGE
                     GEDALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDL
                     GLVAPQVEATFPSWRPQRCLDHILLSSSLTLERVEVLAQPISDHLPVAVEIRLPDALT
                     VDTLPVLS"
     misc_feature    162232..162945
                     /locus_tag="PPUBIRD1_0156"
                     /note="Exonuclease-Endonuclease-Phosphatase (EEP) domain
                     superfamily; Region: EEP; cl00490"
                     /db_xref="CDD:260458"
     misc_feature    order(162241..162243,162385..162387,162637..162639,
                     162727..162729,162733..162735,162841..162843,
                     162907..162912)
                     /locus_tag="PPUBIRD1_0156"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197306"
     misc_feature    order(162385..162387,162907..162909)
                     /locus_tag="PPUBIRD1_0156"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:197306"
     misc_feature    order(162637..162639,162733..162735,162910..162912)
                     /locus_tag="PPUBIRD1_0156"
                     /note="putative phosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:197306"
     gene            163009..164946
                     /locus_tag="PPUBIRD1_0157"
                     /db_xref="GeneID:12518388"
     CDS             163009..164946
                     /locus_tag="PPUBIRD1_0157"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase"
                     /protein_id="YP_005928071.1"
                     /db_xref="GI:386009794"
                     /db_xref="GeneID:12518388"
                     /translation="MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAA
                     EGSDKVVDECMKEMRDVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMHQVSDALTA
                     LVGQLQSLPLPSDISRPLKKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKSGE
                     EARPGFLQRLFGSREEDAQAGAALAPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPA
                     PAAPAAEVAEAPELELEAFGPALIETAEMPPAPLPRDKSPLPEAAVSASEPLAEAEPL
                     QALEVTFGEDGPYALPYAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERV
                     ARGLNWYELIPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHAD
                     NSTAARELDSQLREHVDGLQSSMQGAADVDSLKHILENRLEGLLVTMDEHKHERDRRE
                     QELAGRLQGLSERVASMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSERVEREML
                     DWQENGGHLAMAILDLDHFKRINDNYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGE
                     EFVLLLPQTTPAVAAQVAEVLRATVEACPFHFKGERVVITTSIGLSAFRSGERSDQVL
                     KRADAALYRAKELGRNRVEHG"
     misc_feature    164470..164934
                     /locus_tag="PPUBIRD1_0157"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(164575..164577,164704..164706)
                     /locus_tag="PPUBIRD1_0157"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(164590..164592,164599..164604,164614..164616,
                     164626..164628,164692..164694,164698..164709)
                     /locus_tag="PPUBIRD1_0157"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(164680..164682,164764..164766)
                     /locus_tag="PPUBIRD1_0157"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            165020..165808
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /db_xref="GeneID:12518389"
     CDS             165020..165808
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /EC_number="3.5.1.28"
                     /note="N-acetylmuramoyl-L-alanine amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="AmiD"
                     /protein_id="YP_005928072.1"
                     /db_xref="GI:386009795"
                     /db_xref="GeneID:12518389"
                     /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVL
                     HYTNASLERSLALLTQGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNS
                     SSIGIEIVNPGFTDTPNGRVWHPYSEAQIQSLIALLKDIVKRNNIEPRHIIGHSDIAP
                     LRKLDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSVGWYQQELARFGYQIE
                     QTGVLDVATRHVIAAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
     misc_feature    165086..165799
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="N-acetyl-anhydromuramyl-L-alanine amidase [Cell
                     envelope biogenesis, outer membrane]; Region: ampD;
                     COG3023"
                     /db_xref="CDD:225567"
     misc_feature    165131..165526
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="Peptidoglycan recognition proteins (PGRPs) are
                     pattern recognition receptors that bind, and in certain
                     cases, hydrolyze peptidoglycans (PGNs) of bacterial cell
                     walls. PGRPs have been divided into three classes: short
                     PGRPs (PGRP-S), that are small (20...; Region: PGRP;
                     cd06583"
                     /db_xref="CDD:133475"
     misc_feature    order(165152..165154,165212..165214,165482..165484,
                     165506..165508,165512..165514)
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="amidase catalytic site [active]"
                     /db_xref="CDD:133475"
     misc_feature    order(165152..165154,165482..165484,165512..165514)
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="Zn binding residues [ion binding]; other site"
                     /db_xref="CDD:133475"
     misc_feature    order(165155..165160,165200..165202,165212..165214,
                     165257..165259,165278..165283,165320..165322,
                     165482..165484,165494..165496,165506..165514)
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133475"
     misc_feature    165620..165784
                     /gene="amiD"
                     /locus_tag="PPUBIRD1_0158"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     gene            166012..167610
                     /locus_tag="PPUBIRD1_0159"
                     /db_xref="GeneID:12518390"
     CDS             166012..167610
                     /locus_tag="PPUBIRD1_0159"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain containing protein"
                     /protein_id="YP_005928073.1"
                     /db_xref="GI:386009796"
                     /db_xref="GeneID:12518390"
                     /translation="MSAFIALLRQIFYRPWMLATLAALASAAVLLSASIGIALQQMKQ
                     SESEQMNAQGERFLERLEQVFGQLREGVDLLQAQPLRGCNPAMLAALQQVGLNSRFIY
                     EAAYVDGNVACSNRGDERAFVPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGKFL
                     VSTSRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSD
                     RLIYRMPTKSPDYQLVLIAPRASLPLKMNGMLWLLFPGSVLAACCIGWLVLQLILQRR
                     SMSSELQNALRRGELQVLYQPIIELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAEN
                     TGQIRQITDFVLQRVLEQLGQLLRSHPKLYISINLAACDVMVPRIGRVAARLLALHRV
                     APSQIAFEVTERGLIDVVVARDNLQALRAVGHQVLIDDFGTGYCSLAYLQTLPVDCLK
                     IDKAFIDALGHDAASSGVAPHIIRMAHDLHLRVIAEGIEFEDQAVLLNSEGVNYGQGW
                     LFARPLNARQFAELVTRGHLPRRV"
     misc_feature    166114..167568
                     /locus_tag="PPUBIRD1_0159"
                     /note="Predicted signal transduction protein containing
                     sensor and EAL domains [Signal transduction mechanisms];
                     Region: COG4943"
                     /db_xref="CDD:227279"
     misc_feature    166141..166773
                     /locus_tag="PPUBIRD1_0159"
                     /note="CSS motif domain associated with EAL; Region:
                     CSS-motif; pfam12792"
                     /db_xref="CDD:257300"
     misc_feature    166849..167565
                     /locus_tag="PPUBIRD1_0159"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(167625..169391)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /db_xref="GeneID:12518391"
     CDS             complement(167625..169391)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /EC_number="2.7.13.3"
                     /note="multi-sensor signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="KinB"
                     /protein_id="YP_005928074.1"
                     /db_xref="GI:386009797"
                     /db_xref="GeneID:12518391"
                     /translation="MKLRTRLFLSISALITVALLGLLLGLVSMLQMATVQQQLVRDTT
                     HALEVGLKLRQNLGEQLMLILNEDTAPESLRLLQESFQDLLNQGLEQGGERTGFSKAS
                     SNYQAFLQTYRDSAAPARSMGVDQPLGAAFNQVRTDLIDSHKHALDLITRSEERTRDR
                     ALLVSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAKAADQLGKGDFDVTLPVAQA
                     AELNQLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQGRLEHL
                     NPVAQRQLGWNDSRVGSSLVEALQRPELEQQLRQVLRGGSLDRPPDDLNMEVDEESRL
                     LTYSLTPVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFG
                     LLRERVKFPPEARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLELAPCAIDDL
                     LEHAQLRFAEQAAHKQIELIKELDPPLPRIQADVAQLDRVLDNLLHNAIRHTANGGRI
                     RLHARRHAERVIISVEDNGEGISYGQQARIFEPFVQVGRKKGGAGLGLALCKEIVQLH
                     GGRMGVFSRPGQGTQFYMALPV"
     misc_feature    complement(167631..168917)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: VicK; COG5002"
                     /db_xref="CDD:227335"
     misc_feature    complement(168681..168818)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(168687..168692,168699..168704,
                     168708..168713,168720..168725,168729..168734,
                     168780..168782,168786..168791,168798..168803,
                     168807..168812))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(168315..168614)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(168402..168404,168408..168410,
                     168486..168497,168534..168536,168552..168554,
                     168564..168566))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(168375..168377,168381..168383,
                     168456..168461,168468..168470,168492..168494,
                     168507..168509))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(168096..168296)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(168111..168113,168123..168125,
                     168132..168134,168144..168146,168153..168155,
                     168165..168167,168222..168224,168231..168233,
                     168243..168245,168252..168254,168264..168266,
                     168276..168278))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(168258..168260)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(167634..167933)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(167646..167648,167652..167657,
                     167670..167672,167676..167678,167724..167735,
                     167802..167807,167811..167813,167817..167819,
                     167823..167825,167892..167894,167901..167903,
                     167913..167915))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(167901..167903)
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(167727..167729,167733..167735,
                     167805..167807,167811..167813))
                     /gene="kinB"
                     /locus_tag="PPUBIRD1_0160"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(169403..170749)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /db_xref="GeneID:12518392"
     CDS             complement(169403..170749)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Alginate biosynthesis transcriptional regulatory
                     protein algB"
                     /codon_start=1
                     /transl_table=11
                     /product="AlgB"
                     /protein_id="YP_005928075.1"
                     /db_xref="GI:386009798"
                     /db_xref="GeneID:12518392"
                     /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQA
                     ETLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAG
                     AADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMMAVLET
                     ARQVAITDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFG
                     HTRGAFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVT
                     RRADVRILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILILADRFLA
                     RFVKEYSRPARGFSDEARTALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGE
                     QPAGNAPRVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
     misc_feature    complement(169406..170728)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(170378..170716)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(170420..170425,170432..170434,
                     170489..170491,170549..170551,170573..170575,
                     170702..170707))
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(170573..170575)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(170549..170557,170561..170566))
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(170417..170425)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(169817..170296)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(170204..170227)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(169886..169888,170012..170014,
                     170201..170224))
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(170009..170026)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(169829..169831)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(169412..169534)
                     /gene="algB"
                     /locus_tag="PPUBIRD1_0161"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            170960..171781
                     /locus_tag="PPUBIRD1_0162"
                     /db_xref="GeneID:12518393"
     CDS             170960..171781
                     /locus_tag="PPUBIRD1_0162"
                     /codon_start=1
                     /transl_table=11
                     /product="Transport-associated protein"
                     /protein_id="YP_005928076.1"
                     /db_xref="GI:386009799"
                     /db_xref="GeneID:12518393"
                     /translation="MPFSLRTAVLAATLLPIFTPAFADPVQDARLEGALQTALSMNRM
                     LDSFRINVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENLLQLNTQLVERPL
                     ELRAYAQRLEDVTLAAVIRARLLWSRTTEKAPIEVQSSEGVVTLRGKVDSAEAKELAG
                     VVARTTDGVYLVNNLVSLDTAAMAKARETPAGALTGPQPSDSWIVDKIQSSYRFSRNL
                     DGLNLKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVATKVEG"
     misc_feature    171092..171244
                     /locus_tag="PPUBIRD1_0162"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    171350..171493
                     /locus_tag="PPUBIRD1_0162"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    171605..171751
                     /locus_tag="PPUBIRD1_0162"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            171956..172246
                     /locus_tag="PPUBIRD1_0163"
                     /db_xref="GeneID:12518394"
     CDS             171956..172246
                     /locus_tag="PPUBIRD1_0163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928077.1"
                     /db_xref="GI:386009800"
                     /db_xref="GeneID:12518394"
                     /translation="MNRQSVNRSQSAALPLRQMLTLGMAMLLTLAAGLFYYSLQTARL
                     AEQVAAQTALLTQIQATRANTLVKAADWQPAGQAIASPATVEKFVPQERWVF"
     gene            172478..172924
                     /locus_tag="PPUBIRD1_0165"
                     /db_xref="GeneID:12518395"
     CDS             172478..172924
                     /locus_tag="PPUBIRD1_0165"
                     /codon_start=1
                     /transl_table=11
                     /product="lysozyme inhibitor"
                     /protein_id="YP_005928078.1"
                     /db_xref="GI:386009801"
                     /db_xref="GeneID:12518395"
                     /translation="MVAALLLGGSAAAMAANDGQVRVDQLLGSDPEYRETWQDTLEGE
                     ERLPDWVVNLTGSSQQQMSAVTEDGDKYLVGPLCEKQDNCTYKRLIVAFSWDKDDAYG
                     MLVEVPEGLPSDKSPTRHAQYRWLGEPDDGMKAMLQEQLKRDPNWY"
     misc_feature    172556..172915
                     /locus_tag="PPUBIRD1_0165"
                     /note="Inhibitor of vertebrate lysozyme (Ivy); Region:
                     Ivy; pfam08816"
                     /db_xref="CDD:255053"
     gene            173643..174998
                     /gene="gltP"
                     /locus_tag="PPUBIRD1_0166"
                     /db_xref="GeneID:12518396"
     CDS             173643..174998
                     /gene="gltP"
                     /locus_tag="PPUBIRD1_0166"
                     /note="glutamate/aspartate:proton symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="GltP"
                     /protein_id="YP_005928079.1"
                     /db_xref="GI:386009802"
                     /db_xref="GeneID:12518396"
                     /translation="MTTKTKGKDMKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAW
                     WISNVLQPAGDIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTT
                     IAIVVGLVLANLFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIF
                     AALMRGEMLPIIFFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIG
                     VFALIAVTVANFGFSSLLPLAKLVVLVYFAIAFFAFMVLGLVARLFGFSVIKIMRIMK
                     DELILAYSTSSSETVLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIF
                     IAQLYGIDLSWSQQLLLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAG
                     VDRIMDMARTALNVVGNALAALVIARWEGMYDAVKGEQYYASLMAEKQGAVVVGETAK
                     R"
     misc_feature    173670..174962
                     /gene="gltP"
                     /locus_tag="PPUBIRD1_0166"
                     /note="glutamate/aspartate:proton symporter; Provisional;
                     Region: gltP; PRK11283"
                     /db_xref="CDD:183075"
     gene            175146..176375
                     /locus_tag="PPUBIRD1_0167"
                     /db_xref="GeneID:12518397"
     CDS             175146..176375
                     /locus_tag="PPUBIRD1_0167"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoside recognition domain-containing
                     protein"
                     /protein_id="YP_005928080.1"
                     /db_xref="GI:386009803"
                     /db_xref="GeneID:12518397"
                     /translation="MLNGLWLGFFLVAAVSAMAQWLVGGNAGIFAAMVESIFAMAKLS
                     VEVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHQALGLITMN
                     FAANGLGLDNAATPIGLKAMRALQELNPSSTTASNAQILFLVLNASSLTLLPVTVFMY
                     RAQQGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGF
                     MAFLGTLSAAALGSLSSLLGNLTLFGVIMLFLVVGALKRVKVYEAFVEGATEGFDVAK
                     NLLPYLVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSA
                     ARAMLIETMQTQGVDSFAALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLA
                     EFSGVVAAIFVCYWFFA"
     misc_feature    175146..175790
                     /locus_tag="PPUBIRD1_0167"
                     /note="Uncharacterized membrane protein, required for
                     spore maturation in B.subtilis. [General function
                     prediction only]; Region: SpmA; COG2715"
                     /db_xref="CDD:225336"
     misc_feature    175881..176372
                     /locus_tag="PPUBIRD1_0167"
                     /note="Uncharacterized membrane protein [Function
                     unknown]; Region: SpmB; COG0700"
                     /db_xref="CDD:223772"
     gene            complement(176357..176992)
                     /locus_tag="PPUBIRD1_0168"
                     /db_xref="GeneID:12518398"
     CDS             complement(176357..176992)
                     /locus_tag="PPUBIRD1_0168"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative lipoprotein"
                     /protein_id="YP_005928081.1"
                     /db_xref="GI:386009804"
                     /db_xref="GeneID:12518398"
                     /translation="MNPSLRLLTLAASLSLASACSILPQSEPVDLYRLPVNQPSRTAP
                     PLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGARWSDAAPVLLRNRLLDGFQRE
                     GQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVVIRYDARLVQGRNQRILASK
                     RFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTITQANQAQLKLQAKNQ"
     misc_feature    complement(176396..176926)
                     /locus_tag="PPUBIRD1_0168"
                     /note="Protein of unknown function (DUF330); Region:
                     DUF330; cl01135"
                     /db_xref="CDD:260806"
     gene            complement(176989..177927)
                     /locus_tag="PPUBIRD1_0169"
                     /db_xref="GeneID:12518399"
     CDS             complement(176989..177927)
                     /locus_tag="PPUBIRD1_0169"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928082.1"
                     /db_xref="GI:386009805"
                     /db_xref="GeneID:12518399"
                     /translation="METRAHHVLIGLVTVLVVTGAMLFGLWLAKSSVDDAFKDYEVVF
                     NEAVSGLSPGSTVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTL
                     AGVTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINMLLHN
                     ANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAIAQLVQVGKQASATLAETQAL
                     MRNANGLLDSEGKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAI
                     RELRETLNALKGISRQLEADPSGYLLGRDNNKEFQP"
     misc_feature    complement(177046..177903)
                     /locus_tag="PPUBIRD1_0169"
                     /note="virulence factor Mce family protein; Region:
                     Mtu_fam_mce; TIGR00996"
                     /db_xref="CDD:233227"
     misc_feature    complement(177580..177810)
                     /locus_tag="PPUBIRD1_0169"
                     /note="mce related protein; Region: MCE; pfam02470"
                     /db_xref="CDD:251316"
     gene            complement(177931..178722)
                     /locus_tag="PPUBIRD1_0170"
                     /db_xref="GeneID:12518400"
     CDS             complement(177931..178722)
                     /locus_tag="PPUBIRD1_0170"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005928083.1"
                     /db_xref="GI:386009806"
                     /db_xref="GeneID:12518400"
                     /translation="MSGQDCVIEARGICNRFGRQVVHENLDLDLYRGEILAVVGGSGS
                     GKSVLLRSIIGLRRPNEGQIKVLGQDLTGLRDEQRSLVERRFGVLFQKGALFSSLTVT
                     ENVALPLIEHAGLSRSDAEHLAGVKLALAGLPISAADKYPASLSGGMIKRAALARALA
                     LDPDILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVL
                     SQKKVLVAGPLAEVEKTNDTWIQEYFHGPRGRAAEQAATRAGQER"
     misc_feature    complement(177955..178722)
                     /locus_tag="PPUBIRD1_0170"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, ATPase component [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: Ttg2A;
                     COG1127"
                     /db_xref="CDD:224052"
     misc_feature    complement(177994..178701)
                     /locus_tag="PPUBIRD1_0170"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(178582..178605)
                     /locus_tag="PPUBIRD1_0170"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(178114..178116,178213..178218,
                     178450..178452,178579..178587,178591..178596))
                     /locus_tag="PPUBIRD1_0170"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(178450..178461)
                     /locus_tag="PPUBIRD1_0170"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(178261..178290)
                     /locus_tag="PPUBIRD1_0170"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(178213..178230)
                     /locus_tag="PPUBIRD1_0170"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(178195..178206)
                     /locus_tag="PPUBIRD1_0170"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(178108..178128)
                     /locus_tag="PPUBIRD1_0170"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(178719..179843)
                     /locus_tag="PPUBIRD1_0171"
                     /db_xref="GeneID:12518401"
     CDS             complement(178719..179843)
                     /locus_tag="PPUBIRD1_0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928084.1"
                     /db_xref="GI:386009807"
                     /db_xref="GeneID:12518401"
                     /translation="MTTPSATLDASSQPACLRITGDWTLAHYASLKRESERLRSQCPA
                     DTVADLSQLGRLDTAGASLLAELLGSERLSRCTHALPEASQALLKNVYCSVQDYCIPV
                     KEPERNVLLLLLERIGRAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPVVAH
                     IEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTA
                     ILMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAM
                     ICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGF
                     KVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
     misc_feature    complement(179577..179795)
                     /locus_tag="PPUBIRD1_0171"
                     /note="Sulphate Transporter and Anti-Sigma factor
                     antagonist domain found in the C-terminal region of
                     sulphate transporters as well as in bacterial and archaeal
                     proteins involved in the regulation of sigma factors;
                     Region: STAS; cl00604"
                     /db_xref="CDD:260524"
     misc_feature    complement(178722..179537)
                     /locus_tag="PPUBIRD1_0171"
                     /note="ABC-type transport system involved in resistance to
                     organic solvents, permease component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: Ttg2B; COG0767"
                     /db_xref="CDD:223838"
     gene            complement(179984..181009)
                     /locus_tag="PPUBIRD1_0172"
                     /db_xref="GeneID:12518402"
     CDS             complement(179984..181009)
                     /locus_tag="PPUBIRD1_0172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928085.1"
                     /db_xref="GI:386009808"
                     /db_xref="GeneID:12518402"
                     /translation="MPQIPHIVQRVIELLKRYPGIIALGGFLSGIGSFILVDRQAGLA
                     SWVAVLMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFI
                     TTTWNSGQLVFTGLLGAAGLVSIIDPLYYKWLAPRRWLFLALHTLTLFAALLTALPII
                     LHLTTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVLVTLSVGGGGWLLRSWVP
                     PATLWMTEVAVSTEVLNRQPGDSLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQ
                     KDGQEVDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVV
                     NDAPAGS"
     misc_feature    complement(180008..180217)
                     /locus_tag="PPUBIRD1_0172"
                     /note="Protein of unknown function (DUF2914); Region:
                     DUF2914; pfam11141"
                     /db_xref="CDD:256313"
     gene            complement(181103..182509)
                     /locus_tag="PPUBIRD1_0173"
                     /db_xref="GeneID:12518403"
     CDS             complement(181103..182509)
                     /locus_tag="PPUBIRD1_0173"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M16 domain-containing protein"
                     /protein_id="YP_005928086.1"
                     /db_xref="GI:386009809"
                     /db_xref="GeneID:12518403"
                     /translation="MRCLMFVCLLICSLPSFALDRSRVEGYLLPNGLQVILKNGYERD
                     HVAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDETGEGGLEERLQALGGEWNAYTS
                     SADTTFVIEAPARNQRKVLDLLLAVIRDTTIDAKALATAKRIIEREDGGHYGHLQRWL
                     DRQDIGHPANDQLATELGLKCPERSNLDDMTLAQVQALRDRWYAANNMTLIMVGGLDR
                     LLPAYLERSFGELPATEPEERRNLESITRQAQQRRNLTRGWLGDGVKLHWLFIEPVLD
                     NDHQATLDLLSHYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDK
                     AVKVMQALFDHLRKEGLDPDTFARIKEASIAKESWSTQGNSALADYYWGALNDYTDGR
                     FASPVRKLRQVSLEQANEALKDLLKEDGYVRIEKPLLGYDELYGLMALLVGLCLAAGL
                     LRWRRHGPERPSGATRQQ"
     misc_feature    complement(181244..182494)
                     /locus_tag="PPUBIRD1_0173"
                     /note="Predicted Zn-dependent peptidases [General function
                     prediction only]; Region: PqqL; COG0612"
                     /db_xref="CDD:223685"
     misc_feature    complement(<182066..>182290)
                     /locus_tag="PPUBIRD1_0173"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    complement(181424..181945)
                     /locus_tag="PPUBIRD1_0173"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(182540..184219)
                     /locus_tag="PPUBIRD1_0174"
                     /db_xref="GeneID:12518404"
     CDS             complement(182540..184219)
                     /locus_tag="PPUBIRD1_0174"
                     /codon_start=1
                     /transl_table=11
                     /product="Sodium-dependent inorganic phosphate (Pi)
                     transporter"
                     /protein_id="YP_005928087.1"
                     /db_xref="GI:386009810"
                     /db_xref="GeneID:12518404"
                     /translation="MQQGAFAMLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRII
                     SQNMDKRPLAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTAL
                     MARVLTFDLSWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAP
                     ITHAQGVKVLFASLTGDIMLDALVGAMFAMISYSSLAAVLLTATLAGAELISLPVAIG
                     LVVGANIGSGLLAFISTSMQNAAGRRVALGSLLYKLIGLVLIIPVLHPLVEWMDSLSF
                     SPQELVIGFHLLYNTLRCLIMLPTVKPMGRLCNVLLPERETGNGQVRPRHLDASALET
                     PSLALANAARETLRLGDIVDSLLESMLGALRGTQTALPQQVRALGEDAEALYSAIKLY
                     LAQMSREDLSEQDNRRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQVGLE
                     ELTGLQEQLLANLRLGLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVV
                     QSIETSSLHLELIADMKRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARQP"
     misc_feature    complement(182600..184198)
                     /locus_tag="PPUBIRD1_0174"
                     /note="Na+/phosphate symporter [Inorganic ion transport
                     and metabolism]; Region: NptA; COG1283"
                     /db_xref="CDD:224202"
     misc_feature    complement(183749..184162)
                     /locus_tag="PPUBIRD1_0174"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     misc_feature    complement(<183434..183721)
                     /locus_tag="PPUBIRD1_0174"
                     /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
                     pfam02690"
                     /db_xref="CDD:251479"
     gene            complement(184471..185241)
                     /gene="terC"
                     /locus_tag="PPUBIRD1_0175"
                     /db_xref="GeneID:12518405"
     CDS             complement(184471..185241)
                     /gene="terC"
                     /locus_tag="PPUBIRD1_0175"
                     /note="integral membrane protein TerC"
                     /codon_start=1
                     /transl_table=11
                     /product="protein TerC"
                     /protein_id="YP_005928088.1"
                     /db_xref="GI:386009811"
                     /db_xref="GeneID:12518405"
                     /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQP
                     RTRIFGLALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSS
                     QEIYHGLEGEDENAEEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVA
                     AIVVAVLVMMLCAGAISNFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFA
                     MAFSLGVEAINIRMRTAMARKDGKDHDPVKLRKDIPGQ"
     misc_feature    complement(184510..185241)
                     /gene="terC"
                     /locus_tag="PPUBIRD1_0175"
                     /note="Membrane protein TerC, possibly involved in
                     tellurium resistance [Inorganic ion transport and
                     metabolism]; Region: TerC; COG0861"
                     /db_xref="CDD:223930"
     gene            complement(185311..186618)
                     /locus_tag="PPUBIRD1_0176"
                     /db_xref="GeneID:12518406"
     CDS             complement(185311..186618)
                     /locus_tag="PPUBIRD1_0176"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="YP_005928089.1"
                     /db_xref="GI:386009812"
                     /db_xref="GeneID:12518406"
                     /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAK
                     IGPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTA
                     VLALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTA
                     RAASALHVDPSDIFVPMIPAMLFGVLAILAIAYMYGKRERARLGELHLPTDDIDHSEI
                     TVSQYPDARRPKLLYFNGALTAALMVALIAGLLPLPVLFMIAFSIAMIVNYPCLQQQK
                     DRIAAHAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAI
                     VSMPFTFFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYL
                     LVALAGIEFGDHQRFTLKWAVLVCLCIMLGALLMGIFPLFSSL"
     misc_feature    complement(185323..186618)
                     /locus_tag="PPUBIRD1_0176"
                     /note="H+/citrate symporter [Energy production and
                     conversion]; Region: CitM; COG2851"
                     /db_xref="CDD:225407"
     misc_feature    complement(185485..186606)
                     /locus_tag="PPUBIRD1_0176"
                     /note="Citrate transporter; Region: CitMHS; pfam03600"
                     /db_xref="CDD:252049"
     gene            186883..187287
                     /locus_tag="PPUBIRD1_0177"
                     /db_xref="GeneID:12518407"
     CDS             186883..187287
                     /locus_tag="PPUBIRD1_0177"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928090.1"
                     /db_xref="GI:386009813"
                     /db_xref="GeneID:12518407"
                     /translation="MMQDVTEGGCHCGALRYRLEGNLTDIAHCHCSICRRVSGGLVVT
                     WLTLPRSGFQWLTGEPSCYVAPASCSRYFCGQCGAHVALVTTHSPQTIDVTVATLDHP
                     ERVRANRHIWVGSRLPWLHLDEDLPSEDEGRL"
     misc_feature    186898..187263
                     /locus_tag="PPUBIRD1_0177"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3791"
                     /db_xref="CDD:226314"
     gene            complement(187326..189281)
                     /locus_tag="PPUBIRD1_0178"
                     /db_xref="GeneID:12518408"
     CDS             complement(187326..189281)
                     /locus_tag="PPUBIRD1_0178"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928091.1"
                     /db_xref="GI:386009814"
                     /db_xref="GeneID:12518408"
                     /translation="MKRVRAWLLGCALTLLGTPALADLQLELQASGLDPQQTQASQAL
                     LDEAMGKLPPHFKQQLDRHVRVSWSDNMPADAYGQASLISTLELNRRLLPSLADGSAA
                     AERTDRPHGTVREELLATVLHELTHLYDRARLWPSAENSLIARCKRQQGTLGKVGLPE
                     ECRGQAERRFTLSDDPRLLDLAGWQQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIA
                     VNMEYFLLDPSYSCRRPALYQYLREHFGWAPQQDTCAKGLPFINAGSDFARQPLGEID
                     PERVYEVDYLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFV
                     NDVQLSSWDGLVGNYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLNRDEIENLVRQA
                     AEMHWSYDGNYWFLSNNCAVESLKLLRSGTANPRLNDLDSIMPNGLLAVLKGRGLADT
                     SVLDNPREALRLGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLALNAEQRRSWFAK
                     ADLRTSAALLLLEQASLRRQLLLAQDEVKQRYLNAAALKDGSINKADATLKQMLANSG
                     FLSRPAELLDSKGYGLPQPEERKHLEQVSRERQAQLLRLSTSLDKEVRALLEPSRAKE
                     IAAVEANVKQIGEHLRALHKAAGGLQL"
     misc_feature    complement(<188895..189119)
                     /locus_tag="PPUBIRD1_0178"
                     /note="SprT-like family; Region: SprT-like; cl19237"
                     /db_xref="CDD:267590"
     misc_feature    complement(187953..188486)
                     /locus_tag="PPUBIRD1_0178"
                     /note="Domain of unknown function (DUF4105); Region:
                     DUF4105; pfam13387"
                     /db_xref="CDD:257713"
     gene            complement(189278..189598)
                     /locus_tag="PPUBIRD1_0179"
                     /db_xref="GeneID:12518409"
     CDS             complement(189278..189598)
                     /locus_tag="PPUBIRD1_0179"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928092.1"
                     /db_xref="GI:386009815"
                     /db_xref="GeneID:12518409"
                     /translation="MRKPLIAASLGMLLLADLAQAQTLVATSNIIVRAFGRSIDFTSD
                     TTTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFNTLRERVPEARGASDQVLAEA
                     ILAL"
     misc_feature    complement(189281..189499)
                     /locus_tag="PPUBIRD1_0179"
                     /note="Protein of unknown function (DUF2388); Region:
                     DUF2388; pfam09498"
                     /db_xref="CDD:192307"
     gene            complement(189635..189928)
                     /locus_tag="PPUBIRD1_0180"
                     /db_xref="GeneID:12518410"
     CDS             complement(189635..189928)
                     /locus_tag="PPUBIRD1_0180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928093.1"
                     /db_xref="GI:386009816"
                     /db_xref="GeneID:12518410"
                     /translation="MRYLLPLLFAAAGMASAHAMDTTTQSLVITGYVTSQVTAAPFDR
                     KLVTQARDDAAAFVASGGLIRGARLEAALESLRHNCARHAVGDLELAQAILVQ"
     misc_feature    complement(189638..189853)
                     /locus_tag="PPUBIRD1_0180"
                     /note="Protein of unknown function (DUF2388); Region:
                     DUF2388; pfam09498"
                     /db_xref="CDD:192307"
     gene            complement(190016..190333)
                     /locus_tag="PPUBIRD1_0181"
                     /db_xref="GeneID:12518411"
     CDS             complement(190016..190333)
                     /locus_tag="PPUBIRD1_0181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928094.1"
                     /db_xref="GI:386009817"
                     /db_xref="GeneID:12518411"
                     /translation="MNRKHLLGAALLLGLAGTANATSFVVTTDAVVGAVAASTDATSD
                     VSSSFRDDKIVQAARDDAASFVGTQGAIRGARLESAFVHIRSNMPALQASDAQLAQAI
                     LAL"
     misc_feature    complement(190019..190333)
                     /locus_tag="PPUBIRD1_0181"
                     /note="conserverd hypothetical protein; Region: TIGR02448"
                     /db_xref="CDD:233872"
     gene            complement(190642..190857)
                     /locus_tag="PPUBIRD1_0182"
                     /db_xref="GeneID:12518412"
     CDS             complement(190642..190857)
                     /locus_tag="PPUBIRD1_0182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928095.1"
                     /db_xref="GI:386009818"
                     /db_xref="GeneID:12518412"
                     /translation="MERTLSSGLVFESNAQQSNTSLPLRALSTLLLWQRRMTSRRQLA
                     RLDSRLLADAGISESQRYEELSKPFWR"
     misc_feature    complement(190645..>190791)
                     /locus_tag="PPUBIRD1_0182"
                     /note="Domain of unknown function (DUF1127); Region:
                     DUF1127; cl02276"
                     /db_xref="CDD:261233"
     gene            complement(191231..192724)
                     /locus_tag="PPUBIRD1_0183"
                     /db_xref="GeneID:12518413"
     CDS             complement(191231..192724)
                     /locus_tag="PPUBIRD1_0183"
                     /codon_start=1
                     /transl_table=11
                     /product="Acetyl-CoA hydrolase/transferase family protein"
                     /protein_id="YP_005928096.1"
                     /db_xref="GI:386009819"
                     /db_xref="GeneID:12518413"
                     /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKA
                     VPHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQ
                     VMFIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQV
                     IVEINLSHNTNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISD
                     QPDSPSTVLPPDDETQGIADHLINFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLI
                     ESPFEDLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSTRRNADVFGNLERYKDKLVL
                     RPQEISNHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHL
                     AVFVTKSIAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDN
                     CVHPDYRAALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
     misc_feature    complement(191249..192685)
                     /locus_tag="PPUBIRD1_0183"
                     /note="succinate CoA transferase; Region: YgfH_subfam;
                     TIGR03458"
                     /db_xref="CDD:234217"
     misc_feature    complement(192080..192685)
                     /locus_tag="PPUBIRD1_0183"
                     /note="Acetyl-CoA hydrolase/transferase N-terminal domain;
                     Region: AcetylCoA_hydro; pfam02550"
                     /db_xref="CDD:251367"
     misc_feature    complement(191333..191737)
                     /locus_tag="PPUBIRD1_0183"
                     /note="Acetyl-CoA hydrolase/transferase C-terminal domain;
                     Region: AcetylCoA_hyd_C; pfam13336"
                     /db_xref="CDD:257666"
     gene            complement(192911..194347)
                     /gene="pntB"
                     /locus_tag="PPUBIRD1_0184"
                     /db_xref="GeneID:12518414"
     CDS             complement(192911..194347)
                     /gene="pntB"
                     /locus_tag="PPUBIRD1_0184"
                     /EC_number="1.6.1.2"
                     /note="Nicotinamide nucleotide transhydrogenase subunit
                     beta"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PntB"
                     /protein_id="YP_005928097.1"
                     /db_xref="GI:386009820"
                     /db_xref="GeneID:12518414"
                     /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLA
                     ILTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGAPVQFAGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLVLAFIMGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGGDTDTGAAQGSQEQRPVKSGSADDATFLLSNADSVIIVPGYGLAV
                     ARAQHALKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINA
                     EFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     misc_feature    complement(192917..194347)
                     /gene="pntB"
                     /locus_tag="PPUBIRD1_0184"
                     /note="NAD/NADP transhydrogenase beta subunit [Energy
                     production and conversion]; Region: PntB; COG1282"
                     /db_xref="CDD:224201"
     gene            complement(194350..194664)
                     /locus_tag="PPUBIRD1_0185"
                     /db_xref="GeneID:12518415"
     CDS             complement(194350..194664)
                     /locus_tag="PPUBIRD1_0185"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotinamide nucleotide transhydrogenase subunit
                     alpha 2"
                     /protein_id="YP_005928098.1"
                     /db_xref="GI:386009821"
                     /db_xref="GeneID:12518415"
                     /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNA
                     ISAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKTKNEA
                     KK"
     misc_feature    complement(194383..194637)
                     /locus_tag="PPUBIRD1_0185"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            complement(194676..195797)
                     /locus_tag="PPUBIRD1_0186"
                     /db_xref="GeneID:12518416"
     CDS             complement(194676..195797)
                     /locus_tag="PPUBIRD1_0186"
                     /EC_number="1.6.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="Nicotinamide nucleotide transhydrogenase subunit
                     alpha 1"
                     /protein_id="YP_005928099.1"
                     /db_xref="GI:386009822"
                     /db_xref="GeneID:12518416"
                     /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAA
                     IPDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLVGMLNPFNGELIG
                     KMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHHYPRFMPMLMTAAG
                     TVKAARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETD
                     EERECAEGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSAETV
                     AQMKPGSVVIDLAAAQGGNCPLTVADQVVQENGVTIVGPTNLPAQVSADASALYARNL
                     LDFMKLLFDKDGALIINLEDDIVAACLMCRDGQVVRKNG"
     misc_feature    complement(194700..195797)
                     /locus_tag="PPUBIRD1_0186"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    complement(194697..195794)
                     /locus_tag="PPUBIRD1_0186"
                     /note="NAD/NADP transhydrogenase alpha subunit [Energy
                     production and conversion]; Region: PntA; COG3288"
                     /db_xref="CDD:225826"
     misc_feature    complement(order(194841..194843,194847..194849,
                     194925..194927,195522..195524,195579..195581,
                     195753..195755))
                     /locus_tag="PPUBIRD1_0186"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(194799..194804,194811..194813,
                     194823..194828,194952..194957,195240..195245,
                     195312..195314,195321..195329,195333..195335,
                     195339..195356,195360..195365,195369..195374,
                     195381..195386,195393..195398,195423..195428,
                     195666..195668))
                     /locus_tag="PPUBIRD1_0186"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(194988..194990,194994..194996,
                     195015..195023,195072..195074,195105..195107,
                     195210..195218,195276..195287,195408..195410,
                     195417..195419,195426..195428,195438..195443))
                     /locus_tag="PPUBIRD1_0186"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(195177..195188,195192..195197,
                     195243..195245,195264..195269,195396..195398,
                     195426..195428,195432..195437))
                     /locus_tag="PPUBIRD1_0186"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    complement(order(195231..195233,195237..195239,
                     195306..195308,195315..195317,195324..195338))
                     /locus_tag="PPUBIRD1_0186"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     gene            complement(196217..197134)
                     /locus_tag="PPUBIRD1_0187"
                     /db_xref="GeneID:12518417"
     CDS             complement(196217..197134)
                     /locus_tag="PPUBIRD1_0187"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005928100.1"
                     /db_xref="GI:386009823"
                     /db_xref="GeneID:12518417"
                     /translation="MRRKIPSTAALICFEAAARNESFTKAAQELALTQGAVCRQIGGL
                     EAFLNVELFRRSRRGVRLTEAGLSYSRQVAAQLDAVERDTLSVMRQQGANVIELAVVP
                     TFGTQWLLPRLKDFQQCHPEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHQL
                     MGENPVPVCSPALLNDQGMLEARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGP
                     RYELFSMLAQAAMHDMGIALIPPFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKV
                     ESASLRAFRDWLVGQAQAYINSSGTNATN"
     misc_feature    complement(196253..197134)
                     /locus_tag="PPUBIRD1_0187"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    complement(196937..197107)
                     /locus_tag="PPUBIRD1_0187"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(196271..196852)
                     /locus_tag="PPUBIRD1_0187"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators GcdR-like, contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_GcdR_like; cd08481"
                     /db_xref="CDD:176170"
     misc_feature    complement(order(196748..196768,196772..196825,
                     196829..196852))
                     /locus_tag="PPUBIRD1_0187"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176170"
     misc_feature    complement(order(196406..196408,196466..196474,
                     196823..196825,196829..196834))
                     /locus_tag="PPUBIRD1_0187"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176170"
     gene            197295..198476
                     /locus_tag="PPUBIRD1_0188"
                     /db_xref="GeneID:12518418"
     CDS             197295..198476
                     /locus_tag="PPUBIRD1_0188"
                     /EC_number="1.3.99.7"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_005928101.1"
                     /db_xref="GI:386009824"
                     /db_xref="GeneID:12518418"
                     /translation="MAGKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLE
                     AFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMS
                     VQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDG
                     GYRLTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWQGLSAPAIHGKVGLRASI
                     TGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGAMGAAEACWHTARQYTLD
                     RQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     Y"
     misc_feature    197313..198470
                     /locus_tag="PPUBIRD1_0188"
                     /note="Glutaryl-CoA dehydrogenase; Region: GCD; cd01151"
                     /db_xref="CDD:173840"
     misc_feature    197337..198473
                     /locus_tag="PPUBIRD1_0188"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    order(197703..197705,197709..197714,197727..197732,
                     197802..197804,197808..197810,198393..198395,
                     198414..198416,198420..198422)
                     /locus_tag="PPUBIRD1_0188"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173840"
     misc_feature    order(197730..197732,198015..198017,198036..198041,
                     198048..198050,198405..198410)
                     /locus_tag="PPUBIRD1_0188"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173840"
     misc_feature    198408..198410
                     /locus_tag="PPUBIRD1_0188"
                     /note="catalytic base [active]"
                     /db_xref="CDD:173840"
     gene            198490..199710
                     /locus_tag="PPUBIRD1_0189"
                     /db_xref="GeneID:12518419"
     CDS             198490..199710
                     /locus_tag="PPUBIRD1_0189"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl-CoA transferase"
                     /protein_id="YP_005928102.1"
                     /db_xref="GI:386009825"
                     /db_xref="GeneID:12518419"
                     /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDT
                     RSWGPPFLKDVEGEDTSEAAYYLSANRNKRSVTIDFTQSEGQRLVRELAAKCDIVIEN
                     FKVGGLAAYGLDYQSLKAVNPQLIYCSITGFGQTGPYARRAGYDFMIQGLGGLMSLTG
                     RPEGEEGAGPVKVGVALTDILTGLYSTVAMLAALAHRDQTGVGQHVDMALLDVQVACL
                     ANQAMNYLTTGTPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQ
                     WAEDPRFATNKLRVANRAELIPLIRQATVFKTTAEWVAQLEAAGVPCGPINNLAQMFQ
                     DPQVLARGLALNIPHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTEAVLGEVLGL
                     DVGEVQRLRGAGVL"
     misc_feature    198490..199707
                     /locus_tag="PPUBIRD1_0189"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            200280..201797
                     /locus_tag="PPUBIRD1_r0001"
                     /note="rrn16SA"
                     /db_xref="GeneID:12518420"
     rRNA            200280..201797
                     /locus_tag="PPUBIRD1_r0001"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:12518420"
     gene            202094..204995
                     /locus_tag="PPUBIRD1_r0002"
                     /note="rrn23SA"
                     /db_xref="GeneID:12518421"
     rRNA            202094..204995
                     /locus_tag="PPUBIRD1_r0002"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:12518421"
     gene            205128..205247
                     /locus_tag="PPUBIRD1_r0003"
                     /note="rrn5SA"
                     /db_xref="GeneID:12518422"
     rRNA            205128..205247
                     /locus_tag="PPUBIRD1_r0003"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:12518422"
     gene            205710..207227
                     /locus_tag="PPUBIRD1_r0004"
                     /note="rrn16SB"
                     /db_xref="GeneID:12518423"
     rRNA            205710..207227
                     /locus_tag="PPUBIRD1_r0004"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:12518423"
     gene            207524..210425
                     /locus_tag="PPUBIRD1_r0005"
                     /note="rrn23SB"
                     /db_xref="GeneID:12518424"
     rRNA            207524..210425
                     /locus_tag="PPUBIRD1_r0005"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:12518424"
     gene            210558..210677
                     /locus_tag="PPUBIRD1_r0006"
                     /note="rrn5SB-1"
                     /db_xref="GeneID:12518425"
     rRNA            210558..210677
                     /locus_tag="PPUBIRD1_r0006"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:12518425"
     gene            210783..210902
                     /locus_tag="PPUBIRD1_r0007"
                     /note="rrn5SB-2"
                     /db_xref="GeneID:12518426"
     rRNA            210783..210902
                     /locus_tag="PPUBIRD1_r0007"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:12518426"
     gene            complement(210967..213453)
                     /locus_tag="PPUBIRD1_0190"
                     /db_xref="GeneID:12518427"
     CDS             complement(210967..213453)
                     /locus_tag="PPUBIRD1_0190"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005928103.1"
                     /db_xref="GI:386009826"
                     /db_xref="GeneID:12518427"
                     /translation="MSINPVLTHTFSPNDFRPVLQSAHLRHAIRAVLFGTALGLATVP
                     QLSVAADTAEVSQHYAIPAGQLTDVLNKIARQAGITLSSTPQLTDGLHSNGLQGQYTT
                     DQALRQLLNGSGLEAVSQGGSNYVLQAQRQNAALALPDTDIRSFSLGNALGSMEGYNA
                     THSQVATKTSMPLVETSQSVSVVTRQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYD
                     YVAMRGFNDGSVDNIYVDGLKSMGDNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSP
                     GGLVALTTKKPLFAPYHQVQATVGTQGQRGVGFDFSGPVDDDQRIAYRLTGLADASET
                     QFDHNKEERYAIAPAISVDFTEDTSLTLQAYLQHDPDGGYHGGNPADGMLHKRNGLRL
                     SDHFFEGEPSIDNYERTQQSFSYQFEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWAD
                     VDSNMLNRAYTGGDERLHSYIIDNMLQAEFFTGAAKHTLLLGADYQRRKADVTWRYGT
                     VDPLDAGNPQYGNGNLQVLGENRYQRRLQQTGVYLQDLVELDQWRFSLGLRQDWVRVS
                     EENRDSDSKVSDQRSRFTSRAGVLYLFENGIAPYISYSESFNPNTVSDQQGRPLAPTE
                     GTQWEAGIKYQPPGSDSLFTASVFRIEQENLASKQPDEDFYRPVGEVRSQGLELEAHV
                     QLTDSLKLLGGYTFTDIEYSKSMPSLVSGNLDNKGNSPTQAPKQMLSLWADYNFRQGA
                     LDGLRLGGGVRYVGYSWVDAENSMKVPSYTLFDASIGYDLGKVGLTGVDVRLNANNLT
                     NESYITSCASLNYCYMGEERNVSATVSYQF"
     misc_feature    complement(213064..213219)
                     /locus_tag="PPUBIRD1_0190"
                     /note="Secretin and TonB N terminus short domain; Region:
                     STN; smart00965"
                     /db_xref="CDD:198033"
     misc_feature    complement(210970..213006)
                     /locus_tag="PPUBIRD1_0190"
                     /note="ferrichrome outer membrane transporter;
                     Provisional; Region: PRK10044"
                     /db_xref="CDD:236643"
     misc_feature    complement(210970..212919)
                     /locus_tag="PPUBIRD1_0190"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(212602..212628,212662..212694,
                     212737..212757,212779..212796,212833..212862,
                     212890..212919))
                     /locus_tag="PPUBIRD1_0190"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(212059..212061,212140..212142))
                     /locus_tag="PPUBIRD1_0190"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(213547..214503)
                     /gene="fecR"
                     /locus_tag="PPUBIRD1_0191"
                     /db_xref="GeneID:12518428"
     CDS             complement(213547..214503)
                     /gene="fecR"
                     /locus_tag="PPUBIRD1_0191"
                     /note="anti-FecI sigma factor, FecR"
                     /codon_start=1
                     /transl_table=11
                     /product="FecR protein"
                     /protein_id="YP_005928104.1"
                     /db_xref="GI:386009827"
                     /db_xref="GeneID:12518428"
                     /translation="MTVARPDTKTVRQAIQWMLRLRESGHDPALQQQCEQWRSTHHEN
                     EQAWQRVVHLHQDLDLRAIPGAGLALQTLETSQQRLRRRQALKLLGGVVMAGSASWLA
                     KDLNTVSAWASDYATGTGERRVFTLPDGSMMQLNTCSAVDLAFHDQRRLVRLKHGELM
                     INCNPRHPLLVQTRDALLEGFEGRFVAYQDSDCTRVSVSYGKVAIHRPGTGQLQWIES
                     GQNWRLDAQGAHRLAHMDMDAMAWTEGLIVTQDMRLSNFLAQVSRYRHGYLSCSNDIA
                     DLRLSGVFRLEDPEQLLRLLPQTLPVQLRRRTRWWVHVESMT"
     misc_feature    complement(213562..214494)
                     /gene="fecR"
                     /locus_tag="PPUBIRD1_0191"
                     /note="Fe2+-dicitrate sensor, membrane component
                     [Inorganic ion transport and metabolism / Signal
                     transduction mechanisms]; Region: FecR; COG3712"
                     /db_xref="CDD:226235"
     misc_feature    complement(213892..214167)
                     /gene="fecR"
                     /locus_tag="PPUBIRD1_0191"
                     /note="FecR protein; Region: FecR; pfam04773"
                     /db_xref="CDD:252792"
     gene            complement(214508..215011)
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /db_xref="GeneID:12518429"
     CDS             complement(214508..215011)
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /note="ECF subfamily RNA polymerase sigma factor"
                     /codon_start=1
                     /transl_table=11
                     /product="FecI"
                     /protein_id="YP_005928105.1"
                     /db_xref="GI:386009828"
                     /db_xref="GeneID:12518429"
                     /translation="MPSNDSVQTLYSDHHGWLHTWLRSKLGNAADAADLAQDTFVRLL
                     QRREQLQLNAPRAFLRTVARGLVIDHWRREELHRAYLEALAHVPEALVPSVETRELLL
                     ELLERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQMGISVRTVERYIADALYHCYV
                     LRYEDDC"
     misc_feature    complement(214535..215011)
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK12528"
                     /db_xref="CDD:171561"
     misc_feature    complement(214790..214984)
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(214538..214693)
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(214547..214549,214553..214558,
                     214562..214570,214574..214579,214583..214585,
                     214613..214618,214634..214636,214664..214666))
                     /gene="fecI"
                     /locus_tag="PPUBIRD1_0192"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(215118..215807)
                     /locus_tag="PPUBIRD1_0193"
                     /db_xref="GeneID:12518430"
     CDS             complement(215118..215807)
                     /locus_tag="PPUBIRD1_0193"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_005928106.1"
                     /db_xref="GI:386009829"
                     /db_xref="GeneID:12518430"
                     /translation="MAKKIKLSNVLASEQLLPHQARGVIEERLRSAILDGRLPPGTAV
                     RQQELATLYGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLE
                     SEALRQSIPLLDASDIASARGYIQQLENETSHTEIGRLNRLLHMALYSKAPNKKLLRL
                     IENELNEEERFLRFHLSSMGLGKLTQDDHNALVDAASDKLVDEAVAVLERHLNGGARV
                     IRNYLDTQLGH"
     misc_feature    complement(215163..215738)
                     /locus_tag="PPUBIRD1_0193"
                     /note="phosphonate utilization associated transcriptional
                     regulator; Region: phnR_burk; TIGR03338"
                     /db_xref="CDD:132381"
     misc_feature    complement(215556..215735)
                     /locus_tag="PPUBIRD1_0193"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(215565..215576,215580..215585,
                     215613..215615,215622..215627,215631..215645,
                     215667..215672,215673..215675))
                     /locus_tag="PPUBIRD1_0193"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(215166..215531)
                     /locus_tag="PPUBIRD1_0193"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            216010..216771
                     /locus_tag="PPUBIRD1_0194"
                     /db_xref="GeneID:12518431"
     CDS             216010..216771
                     /locus_tag="PPUBIRD1_0194"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928107.1"
                     /db_xref="GI:386009830"
                     /db_xref="GeneID:12518431"
                     /translation="MPLSFAVASPTIAAFDWSEQGFAVAISWLLKTVVRYVGFAALLG
                     SLLLSGLHADWDFSQISRKSQALYGPLGAGQGRIDAWQSLMATQKQGTELERLQVVNR
                     FFNQQLRYVEDIDLWHEVDYWATPVQALIKGAGDCEDYAIAKYFSLRRMGIPSEKLRI
                     TYVKALRQNRAHMVLTYYSSPQAQPLVLDSLMDAIKPASQRTDLLPVYAFNGEGLWLT
                     GAAGNKKVGDTKRLSRWQDLLKKMQAEGFPAEPVY"
     misc_feature    <216286..216669
                     /locus_tag="PPUBIRD1_0194"
                     /note="Bacterial transglutaminase-like cysteine proteinase
                     BTLCP; Region: Peptidase_C93; cl17596"
                     /db_xref="CDD:248150"
     gene            216782..218728
                     /locus_tag="PPUBIRD1_0195"
                     /db_xref="GeneID:12518432"
     CDS             216782..218728
                     /locus_tag="PPUBIRD1_0195"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_005928108.1"
                     /db_xref="GI:386009831"
                     /db_xref="GeneID:12518432"
                     /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQD
                     AATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERQAEPDPGGV
                     PLWFVRLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLSWLLLCGA
                     ASAVLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKL
                     KALFTEQAERSERLRAESYQDSLTGLSNRRYFEMQLNNRVSNLEDARAGYLLLLRVQG
                     LAGLNARLGGQRTDQLLQAVGEQLRRTCASYPETNDLISRSRGGEFAVLAPGMVHEEA
                     VHLAQALEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPT
                     PGWVCLEQGVAAVAADSQHAWHERLDQAFINGHFELFFQPVMECASSQRVLHHKVISR
                     LRDGHGEALPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADP
                     KALQRIFELLSQNAALGPRLVFEIGEEQLPEQAALEQLTRRLHGFGFGLALQRFGGRF
                     SMIGNLAHLGLAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGE
                     RLVLLEMGVGGIQGQLVGEPAPWR"
     misc_feature    216803..218725
                     /locus_tag="PPUBIRD1_0195"
                     /note="biofilm formation regulator HmsP; Provisional;
                     Region: PRK11829"
                     /db_xref="CDD:183329"
     misc_feature    217490..217942
                     /locus_tag="PPUBIRD1_0195"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(217598..217600,217739..217741)
                     /locus_tag="PPUBIRD1_0195"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(217613..217615,217622..217627,217637..217639,
                     217649..217651,217727..217729,217733..217744)
                     /locus_tag="PPUBIRD1_0195"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(217715..217717,217799..217801)
                     /locus_tag="PPUBIRD1_0195"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    218024..218719
                     /locus_tag="PPUBIRD1_0195"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(218855..220231)
                     /locus_tag="PPUBIRD1_0196"
                     /db_xref="GeneID:12518433"
     CDS             complement(218855..220231)
                     /locus_tag="PPUBIRD1_0196"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family type I secretion membrane fusion
                     protein"
                     /protein_id="YP_005928109.1"
                     /db_xref="GI:386009832"
                     /db_xref="GeneID:12518433"
                     /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVV
                     RLTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEG
                     QIVEVGQPLLRLDETRFASNVGETEADRLAMALRVERLSAEVEDRPLIIDEKLRKAAP
                     NQAASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRTQYANSLELLRKEISM
                     SEPLVATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFR
                     SEALTQLNEARTELNKATATSKALDDRVHRTLVTSPVRGIVKQLLVNTIGGVIQPGSD
                     IIEVVPLDDTLVIEAKILPKDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTI
                     TDEDKKTTYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKA
                     RSEALRER"
     misc_feature    complement(218858..220111)
                     /locus_tag="PPUBIRD1_0196"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     misc_feature    complement(219845..219985)
                     /locus_tag="PPUBIRD1_0196"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(218993..219307)
                     /locus_tag="PPUBIRD1_0196"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(220221..222377)
                     /locus_tag="PPUBIRD1_0197"
                     /db_xref="GeneID:12518434"
     CDS             complement(220221..222377)
                     /locus_tag="PPUBIRD1_0197"
                     /EC_number="3.6.3.43"
                     /codon_start=1
                     /transl_table=11
                     /product="Toxin secretion ATP-binding protein"
                     /protein_id="YP_005928110.1"
                     /db_xref="GI:386009833"
                     /db_xref="GeneID:12518434"
                     /translation="MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTT
                     GLPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWE
                     NDDTARLLLSESDGGEVHVSREALLSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRD
                     TLLRSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYI
                     FDLILKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLR
                     DFLASLTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFPLALGIGYALQRPLMATME
                     RTMALASERQSSLIETLAGLDAVKVNNAESERQYMWEQTLGTLSRLELRVKVLSSLAM
                     NITLLIQQLAGVAMICVGVYLIIDGNLSMGGLVACYMLSGRALGPLGQLNGLLARYQQ
                     AKVTMVSTDHMMDLPQERNFEERPLSRKVLQGSVEFRGVDFTYPNQQNLALKNINLTI
                     RPGEKVGIIGRSGSGKSSLAKLIVGLYEADGGSLLVDGVDIRQIDVSELRHNIGYVPQ
                     DIQLLAGTLRDNLVSGARYIEDELILQAAELAGVHEFARLHPDGYELQVGERGQNLSG
                     GQRQNVALGRALLLNPQILLLDEPTSAMDNTGEERLKQRLQAVVEGKTVLLVTHRASL
                     LSLVDRLIVIDRGQIVADGPKAAVMDALKKGQISVA"
     misc_feature    complement(220236..222290)
                     /locus_tag="PPUBIRD1_0197"
                     /note="type I secretion system ATPase, LssB family;
                     Region: type_I_sec_LssB; TIGR03375"
                     /db_xref="CDD:234189"
     misc_feature    complement(221961..222290)
                     /locus_tag="PPUBIRD1_0197"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region:
                     Peptidase_C39_likeD; cd02421"
                     /db_xref="CDD:239102"
     misc_feature    complement(221064..221864)
                     /locus_tag="PPUBIRD1_0197"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(220275..220934)
                     /locus_tag="PPUBIRD1_0197"
                     /note="ATP-binding cassette domain of bacteriocin
                     exporters, subfamily C; Region:
                     ABCC_bacteriocin_exporters; cd03245"
                     /db_xref="CDD:213212"
     misc_feature    complement(220803..220826)
                     /locus_tag="PPUBIRD1_0197"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(order(220344..220346,220437..220442,
                     220680..220682,220800..220808,220812..220817))
                     /locus_tag="PPUBIRD1_0197"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(220680..220691)
                     /locus_tag="PPUBIRD1_0197"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(220485..220514)
                     /locus_tag="PPUBIRD1_0197"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(220437..220454)
                     /locus_tag="PPUBIRD1_0197"
                     /note="Walker B; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(220419..220430)
                     /locus_tag="PPUBIRD1_0197"
                     /note="D-loop; other site"
                     /db_xref="CDD:213212"
     misc_feature    complement(220338..220358)
                     /locus_tag="PPUBIRD1_0197"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213212"
     gene            223371..249419
                     /locus_tag="PPUBIRD1_0199"
                     /db_xref="GeneID:12518435"
     CDS             223371..249419
                     /locus_tag="PPUBIRD1_0199"
                     /codon_start=1
                     /transl_table=11
                     /product="Surface adhesion protein, putative"
                     /protein_id="YP_005928111.1"
                     /db_xref="GI:386009834"
                     /db_xref="GeneID:12518435"
                     /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLAGEEVLTGPG
                     GAVTLELADGRLLDLGRDSQWSADAPDSSTDLSQAAAQAAPSVEELQQAIAAGVDPTT
                     ELEATAAGPSSAGGGALGGGHSFVMLEETAGRVDPTVGFPTDGLGFAGVPDNEEVGLL
                     DTNGNNLVTTPTDTTVATELTLGATPSISEAGGVIVYTATVGQAPTTNLVLTLSNGAV
                     IVIPAGQTSGSVNVAVPANDTPYIDGGQISATVTGSTGGGGLTVTLPQTPAVTQVTDT
                     IDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQVITVEAGKTQGSVDFQ
                     TPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTE
                     GGVITYTVTLSNPAQTPVTVNLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVT
                     IESATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQT
                     PVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNP
                     TPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEA
                     GKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTA
                     TLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDV
                     YNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITY
                     TVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATG
                     GNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTL
                     SNGQVITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTT
                     INDSVDATTATLTASPSVTEGGVITYTVILSNPAQTPVTVTLSNGQTITVEAGKTQGS
                     VDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTITDSVDTTTATLTASP
                     SVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGST
                     VSVTIESATGGNFEHLTPNPTPASTVINDSIDTVTVSIVSNGNVTEDQQPSFTVKVSQ
                     ALDRPLTVTLSNGDTVTIEAGKTEVEYKTSVQGDDVYLDAGSITLSVTDATVPGATFE
                     KLALGGPATVEISDTISEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFK
                     LTDGTTVVVAANSTTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTP
                     VSTEVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNA
                     QVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAAKVDVT
                     DTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANS
                     TTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPG
                     NEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPY
                     THDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAASVQVTDTLDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNV
                     YVGTNAPVINAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDA
                     GQISLGINSAVDATGAAFENLELGGSASVQVTDTLDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAID
                     AVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITADQASVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGITSAVDV
                     DGHTFENLQLGGNASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAIDAVSGADAWKFENL
                     NLDKTPVSTTVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLIV
                     TLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLQLGGN
                     ASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTV
                     VVAANSTTGSATVAAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTTVTD
                     EPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHDAQGDDVYQDAGQISLGITSAVDVDGHTFENLQLGGNASVQVTDTLDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATA
                     TAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVK
                     VTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGD
                     DVYNDAGQISLGITSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATPSVTEGG
                     EITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTND
                     PVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAE
                     NVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLG
                     ITSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
                     GLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGA
                     DVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDA
                     TGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQ
                     LTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPL
                     AHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFEN
                     LELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTL
                     SDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTP
                     VSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVT
                     LSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNA
                     SVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVI
                     TVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTD
                     EPGTPGNEGDLVKVTITADQTSVAENVKPIFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQLGGNASVQVTDTTDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTAT
                     VTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSN
                     EGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYT
                     HAAQGDDVYNDAGQISLGINSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATP
                     SVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNV
                     YVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDA
                     GQISLGITSAVDVDGRTFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSI
                     ATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTF
                     TVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVD
                     ATGATFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINN
                     HSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFE
                     QLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDL
                     VVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELG
                     GAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIDKHAALTFTLDDGK
                     TTITIPANGTTGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTS
                     VTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTI
                     KAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLELGGAASVQVTDTLD
                     EVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVG
                     TATVTAPDNVYVGANDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEG
                     DLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHA
                     AQGDDVYNDAGQISLGITSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSV
                     TEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYV
                     GSNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQT
                     SVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQ
                     ISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTATPSVTEGGEITYTITL
                     TNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIAT
                     VGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSLAENVK
                     PTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINS
                     AVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLP
                     INNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVG
                     KFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLA
                     HDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENL
                     ELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLS
                     DGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVGKFEQLTLDKTPV
                     STSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQ
                     VTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTD
                     TTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANG
                     TVGTATVTAPDNVYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPG
                     NEGDLVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVIIKAGETSAPY
                     THAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDN
                     VYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDPVKVTITA
                     DQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYND
                     AGQISLGINSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYT
                     ITLTNKDGLPIDKHAALTFTLDDGKTTITIPANGTTGTATVTAPDNVYVGTNDPVVMS
                     IATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPT
                     FTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAV
                     DVDGRTFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIN
                     NHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGANDPVVMSIATVEGADVGKF
                     EQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHD
                     LVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQL
                     GGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDG
                     KTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVST
                     SVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVT
                     IKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGAATVQVTDTT
                     DEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTV
                     GTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNE
                     GDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTH
                     AAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPS
                     VTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVY
                     VGTNDPVIKSIATVGGADVGKFEQLTLDKTPVSTAVTDEPGSGTPGTGNKGDVTTVGI
                     TGTTSLTEGETGQYTLTLSNASKSEVTITLSYSGTAQNGDDFTGVATVKIPANSTGTT
                     FNIATLNDKLVEGTENFVVKIETATGGNFENLQVDSSKSSVTTTILDNDHLPVSPGGA
                     VFGVEDTDYVFAWSDFKVTDADGNTNLSVTITSLPAAGNLQFFNGTAWVNVAVGQVVS
                     QADITAKNLKFVPALNQSGADNYGGNGVGNQKADYAQFKFKPNDGTNLGSEVTMKVDI
                     SPVADKPTLSFGSADIESKGLTKEVWTSLKGLGTGGNGITGEDLKTVFANSGSANSSS
                     TTTNVQSDGSVTAGTGSKTSGLIYLEAGKVYTFSGLADDSFVVTIGGKTVVTATWGAG
                     GGVSGTFTPNTSGYYPIEVYHANQSGPGSYDLNIQVGSGAVTDLSSSNVKMYQNVTEM
                     ANAGLGVSDLHTVNGQSYYDGYKLNEGPEGGSVKLVGISTALTDTDGSESLNVTLSGI
                     PKGTVLSDGAGHTVTVGTAPVDVTGWKLSSLTLTPPAYYKGSFDITVTSTATESLGGS
                     AITTGNIPVTVYGATYKASVGTSGNDTLTGSEGNDIFVADVSGLNVVQGKNYNIAFMV
                     DSSGSMSDKSIADAKTQLASVFNTLKASLGSDTSGTVNIFLVDFDTQVNKNVAVNLAD
                     PDALSKLQAVLNSMVGGYYGGGTNYEDAFKTTSNFFNSTMATSNKGAENLTYFITDGK
                     PTYYQSNESTNPSLWKNGKSLDDVVNVNNYKMGDTFSAWADATHKVEISSSGVVKVLT
                     YTENRRGELVLDSTKTVGTLHAQGDGTYEFSSLDGTGYADYWNYVYSAAGSTESFAVL
                     GGTNGLSKVQAIGLNSDVTLNDLKPYDSAGKPQTNIDPSDLAKAILGHSEATVPGADT
                     IDSGNGNDIIFGDLITLNGVVSEGYQALQTYVAQKSGVEVGAVTTSNVHQYITEHYTE
                     FDISGAKDGNDILSGGNGNDILFGQGGSDTLNGGKGNDILLGGTGNDTLIGGQGDDIL
                     IGGSGADTFVWKAGDVGNDVIKDFNKAEGDRIDLKDLLQGEKGSTIDNYLKLTTVEGT
                     TTLQVSSEGKLNAEGGIANADVTIKLEGVNWSNQTINSLISGADPTIIIHNKDS"
     misc_feature    <246219..246362
                     /locus_tag="PPUBIRD1_0199"
                     /note="Calx-beta domain; Region: Calx-beta; cl02522"
                     /db_xref="CDD:261323"
     misc_feature    247842..>248231
                     /locus_tag="PPUBIRD1_0199"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    order(247863..247865,248103..248105,248202..248204)
                     /locus_tag="PPUBIRD1_0199"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     misc_feature    249135..249377
                     /locus_tag="PPUBIRD1_0199"
                     /note="type I secretion C-terminal target domain (VC_A0849
                     subclass); Region: T1SS_VCA0849; TIGR03661"
                     /db_xref="CDD:234299"
     gene            249565..249906
                     /locus_tag="PPUBIRD1_0200"
                     /db_xref="GeneID:12518436"
     CDS             249565..249906
                     /locus_tag="PPUBIRD1_0200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928112.1"
                     /db_xref="GI:386009835"
                     /db_xref="GeneID:12518436"
                     /translation="MFYVQRNAAGQLLRVEAAAFDQFTEMLPSDHADIQEWFADDVVE
                     NSLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKALSSLNN
                     LIDEEEQGGLI"
     gene            249962..250099
                     /locus_tag="PPUBIRD1_0201"
                     /db_xref="GeneID:12518437"
     CDS             249962..250099
                     /locus_tag="PPUBIRD1_0201"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_005928113.1"
                     /db_xref="GI:386009836"
                     /db_xref="GeneID:12518437"
                     /translation="MLAALPSIKLCAGLAVVILIGLLAEGLVFNNLEGLTVLRWETPR
                     G"
     gene            complement(251533..252093)
                     /locus_tag="PPUBIRD1_0202"
                     /db_xref="GeneID:12518438"
     CDS             complement(251533..252093)
                     /locus_tag="PPUBIRD1_0202"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional factor-related protein"
                     /protein_id="YP_005928114.1"
                     /db_xref="GI:386009837"
                     /db_xref="GeneID:12518438"
                     /translation="MPFATTRATLSRQWALLRQLPSRSPGITSAELVWRLRDVGFTVS
                     KRTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLLTHLRGDALQPSQG
                     EGVELVARISDALARQLRDAPLSSDMQLTALEHGHRLRGTVSDGWPLRWWLLSHGDRV
                     VVEQPAGLREEIGRILSNAAAQYQNL"
     misc_feature    complement(<251920..>252012)
                     /locus_tag="PPUBIRD1_0202"
                     /note="Arginine repressor, DNA binding domain; Region:
                     Arg_repressor; pfam01316"
                     /db_xref="CDD:250529"
     misc_feature    complement(251554..>251853)
                     /locus_tag="PPUBIRD1_0202"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            252301..253095
                     /locus_tag="PPUBIRD1_0203"
                     /db_xref="GeneID:12518439"
     CDS             252301..253095
                     /locus_tag="PPUBIRD1_0203"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein repeat-containing
                     protein"
                     /protein_id="YP_005928115.1"
                     /db_xref="GI:386009838"
                     /db_xref="GeneID:12518439"
                     /translation="MSVASNIHSLLARLLPERVIAPPAPAGRRQRLFSGVGLPSQRSL
                     LVNRLDEANDLQAVYVDLRRQALQGSVSALNDLGWIWLNGKYWRADTVLAGHLLRMAA
                     LQGNAAAWFNLGQQHYFGKGIDPSYVQAAECYRQAFDRGMLHAAAALGDLYEEEVCDG
                     DLEWQVDLVQAYQWFLRGAEQGEARCRFEVGYRLMHGLHVEANLKAALYWLELAAAAG
                     VVQAAEELAVHFSSRDAVRYQEWRDRAVQMGSTLALTMKLEDQIHP"
     misc_feature    252451..253068
                     /locus_tag="PPUBIRD1_0203"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    252619..252711
                     /locus_tag="PPUBIRD1_0203"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            253217..253681
                     /locus_tag="PPUBIRD1_0204"
                     /db_xref="GeneID:12518440"
     CDS             253217..253681
                     /locus_tag="PPUBIRD1_0204"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_005928116.1"
                     /db_xref="GI:386009839"
                     /db_xref="GeneID:12518440"
                     /translation="MVFFMSLDFLRLQVSSGLVVAARHWRRICHTALTGYGISEACAA
                     PLLMIVRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLT
                     AEGRALAEAIEAELVRLRRDVLGGIDQADLEAALRVLHAFEAAGLGSAGGVA"
     misc_feature    <253352..253639
                     /locus_tag="PPUBIRD1_0204"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    <253361..253615
                     /locus_tag="PPUBIRD1_0204"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            253678..255765
                     /locus_tag="PPUBIRD1_0205"
                     /db_xref="GeneID:12518441"
     CDS             253678..255765
                     /locus_tag="PPUBIRD1_0205"
                     /codon_start=1
                     /transl_table=11
                     /product="Fusaric acid resistance protein region"
                     /protein_id="YP_005928117.1"
                     /db_xref="GI:386009840"
                     /db_xref="GeneID:12518441"
                     /translation="MNGFFSSVPPARDWFYGVRTFGASMIALYIALLMQLPRPYWAMA
                     TVYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLF
                     LSLNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAI
                     FWPRRLAPVVVGATGNWFTEAIRYSDTYLARDASADKVGGMRGAMVTTFNSLELMIGQ
                     LAHEGAGPHTLKNARELRGRMIHLLPVIDALGDALVALEGRAPAQFAQLQPVLEAARE
                     WLKGTADSASVAHWAALHEQIGRLQPATAALDQRAELLLSNALYRLTEWADLWQDCCT
                     LQHALRTDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWN
                     DGASAVILAAVACSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLV
                     LAFAVPFICIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNSNLAGPAGL
                     LFAFIWTLVMRPFGVELAAKRMTRFAWRDIVEMTEPATLAEHRQVGVQMLDRLMQHLP
                     RLSQTGQDSGVALRDLRVGLNLLDLLAYMPRAGQQARERLNTVVEEVGAHYAACLRAG
                     ERLHAPAALLRNMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAE
                     QPQLPPGLDGAPL"
     misc_feature    253714..255693
                     /locus_tag="PPUBIRD1_0205"
                     /note="Fusaric acid resistance protein family; Region:
                     FUSC; pfam04632"
                     /db_xref="CDD:252713"
     misc_feature    253744..>255234
                     /locus_tag="PPUBIRD1_0205"
                     /note="Fusaric acid resistance protein-like; Region:
                     FUSC_2; cl19401"
                     /db_xref="CDD:267754"
     gene            255762..255974
                     /locus_tag="PPUBIRD1_0206"
                     /db_xref="GeneID:12518442"
     CDS             255762..255974
                     /locus_tag="PPUBIRD1_0206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928118.1"
                     /db_xref="GI:386009841"
                     /db_xref="GeneID:12518442"
                     /translation="MIGELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWH
                     RALFNVALYAVLLGAVDHFCRNLMLP"
     misc_feature    255768..255941
                     /locus_tag="PPUBIRD1_0206"
                     /note="Protein of unknown function (DUF1656); Region:
                     DUF1656; pfam07869"
                     /db_xref="CDD:254477"
     gene            255971..256846
                     /locus_tag="PPUBIRD1_0207"
                     /db_xref="GeneID:12518443"
     CDS             255971..256846
                     /locus_tag="PPUBIRD1_0207"
                     /codon_start=1
                     /transl_table=11
                     /product="Secretion protein HlyD family protein"
                     /protein_id="YP_005928119.1"
                     /db_xref="GI:386009842"
                     /db_xref="GeneID:12518443"
                     /translation="MKKPLLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIR
                     ADVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFTLALRQAKATLGERQETLA
                     QASREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPV
                     DGYLNDRAPRNHEFVTAGRPVLSVVDSASYHVDGYFEETKLGGIHIGDAVDIRVMGDN
                     TRLRGHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMI
                     AGRTATVSIIEGQRP"
     misc_feature    255995..256828
                     /locus_tag="PPUBIRD1_0207"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    256106..256246
                     /locus_tag="PPUBIRD1_0207"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    256433..256684
                     /locus_tag="PPUBIRD1_0207"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            256843..258261
                     /locus_tag="PPUBIRD1_0208"
                     /db_xref="GeneID:12518444"
     CDS             256843..258261
                     /locus_tag="PPUBIRD1_0208"
                     /codon_start=1
                     /transl_table=11
                     /product="RND efflux transporter"
                     /protein_id="YP_005928120.1"
                     /db_xref="GI:386009843"
                     /db_xref="GeneID:12518444"
                     /translation="MKQLILAGLCLSLGACMMVGPDYEVPGDAAVQRNDLNGPLRQDA
                     DSVVSAPVPEDWWQLYQDQRLNELVRQALSANTELRVAAANIAKARAQVEVAESQGGF
                     NGGVKLGAQRLQESGEAFLQPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANAD
                     AVQAAADTARITLVADVVKAYTQVCSANEEYHIARESLDLQEQSVKLNQRLRDAGRGD
                     ETQVTRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQ
                     LVPVGDGAALLKRRPDVRQAERQLAAATAYIGVATGALYPDISIGAQVGTIGILENLG
                     EPSTNRWGFGPQISWSIPTNGTRARIRMAEASTQAALAHFDGVVLNAIRETQTRLAQY
                     SALLDRRDALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRTYTDMRAQLAAANSQ
                     VAQGQIAVFLALGGGWKGTAKP"
     misc_feature    256870..258258
                     /locus_tag="PPUBIRD1_0208"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    257035..257607
                     /locus_tag="PPUBIRD1_0208"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    257692..258231
                     /locus_tag="PPUBIRD1_0208"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            258372..260315
                     /locus_tag="PPUBIRD1_0209"
                     /db_xref="GeneID:12518445"
     CDS             258372..260315
                     /locus_tag="PPUBIRD1_0209"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome c family protein"
                     /protein_id="YP_005928121.1"
                     /db_xref="GI:386009844"
                     /db_xref="GeneID:12518445"
                     /translation="MFSFAFPSRLAMKTRSRLLAWLPAALLGPVLALCSTLALAESPA
                     NAAKAQHLLDYIGADYPPTVQDGKVIDEGEYREQQEFSAVLADLVKGLPANTEQAALE
                     QGVQALRQAIDQRQEGTAVAKQARQLGARLAVAYEVSQAPVITPDPARGAALYAQNCS
                     ICHGDTGAGDGPAGVGLEPAPANLRDVSRLDQLSLFDLYNTLALGIDGTEMPSFADQL
                     DDRQRWDVAAYIASFTAKPEAGKGDKTWNLADLARQTPAEVAVNEGTAAVEAFRAQRA
                     QPPQVKRGPAQLLEYTASTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNID
                     TQARKDTEKSLMAYRQSLQDGLPEAQAEQRLADAKTKLEQAAKLLGSDGLSWTLSYIS
                     GLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWALAAYVID
                     VGGAQRELLEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYIKSSLVSGGGRFGFAVLA
                     FFSVYRELFEVILFYETLWLQAGPAGHQAVLAGGATALVLLVGLAWVILRGSAKLPLS
                     LFFSINAALLCALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAV
                     ALLAIVFLYGRSWLAEKRSAAVN"
     misc_feature    258807..259061
                     /locus_tag="PPUBIRD1_0209"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     misc_feature    259173..260267
                     /locus_tag="PPUBIRD1_0209"
                     /note="High-affinity Fe2+/Pb2+ permease [Inorganic ion
                     transport and metabolism]; Region: FTR1; COG0672"
                     /db_xref="CDD:223744"
     gene            complement(260378..260623)
                     /locus_tag="PPUBIRD1_0210"
                     /db_xref="GeneID:12518446"
     CDS             complement(260378..260623)
                     /locus_tag="PPUBIRD1_0210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928122.1"
                     /db_xref="GI:386009845"
                     /db_xref="GeneID:12518446"
                     /translation="MPFTPDLIDEMEVLALFKHDSSQEGIKITSTASPALIAAAQRLH
                     EKGLTDQPDGGYLTSLGHDAVESVQLLQNILKAPQPA"
     misc_feature    complement(260393..260623)
                     /locus_tag="PPUBIRD1_0210"
                     /note="TIGR02647 family protein; Region: DNA"
                     /db_xref="CDD:131695"
     gene            complement(260693..260995)
                     /locus_tag="PPUBIRD1_0211"
                     /db_xref="GeneID:12518447"
     CDS             complement(260693..260995)
                     /locus_tag="PPUBIRD1_0211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928123.1"
                     /db_xref="GI:386009846"
                     /db_xref="GeneID:12518447"
                     /translation="MSEPTDIDNDDDEAFAEATLTQAIENQIESGEPPAAKATFNKLT
                     LVGYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGDDE"
     gene            261144..261806
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /db_xref="GeneID:12518448"
     CDS             261144..261806
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /EC_number="2.5.1.18"
                     /note="glutathione S-transferase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GstE"
                     /protein_id="YP_005928124.1"
                     /db_xref="GI:386009847"
                     /db_xref="GeneID:12518448"
                     /translation="MLKLYGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALEVS
                     PRGKVPVLETEHGFLSETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIEL
                     PARTCYAESFFGMSVDPLIKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCF
                     SVDLANAVGKKVLDIDFLVDFPQAKALLQLMGENPHMPRILADKEASMPAFMEMIRSG
                     KR"
     misc_feature    261147..261695
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="Glutathione S-transferase [Posttranslational
                     modification, protein turnover, chaperones]; Region: Gst;
                     COG0625"
                     /db_xref="CDD:223698"
     misc_feature    261147..261353
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="Glutathione S-transferase (GST) family, N-terminal
                     domain; a large, diverse group of cytosolic dimeric
                     proteins involved in cellular detoxification by catalyzing
                     the conjugation of  glutathione (GSH) with a wide range of
                     endogenous and xenobiotic...; Region: GST_N_family;
                     cd00570"
                     /db_xref="CDD:238319"
     misc_feature    order(261177..261179,261183..261188,261192..261197,
                     261204..261209,261330..261332,261339..261344)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238319"
     misc_feature    order(261177..261179,261285..261293,261324..261329)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:238319"
     misc_feature    order(261285..261287,261321..261326,261330..261335,
                     261342..261344)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238319"
     misc_feature    261408..261716
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 9 of Glutathione S-transferases; Region:
                     GST_C_9; cd10424"
                     /db_xref="CDD:198344"
     misc_feature    order(261411..261413,261432..261434,261600..261602,
                     261609..261614,261621..261623,261633..261635)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198344"
     misc_feature    order(261411..261416,261423..261428,261435..261437,
                     261546..261548)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198344"
     misc_feature    order(261432..261434,261444..261449,261624..261626,
                     261633..261635)
                     /gene="gstE"
                     /locus_tag="PPUBIRD1_0212"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198344"
     gene            complement(261931..263325)
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /db_xref="GeneID:12518449"
     CDS             complement(261931..263325)
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /EC_number="4.3.2.1"
                     /note="Argininosuccinate lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="ArlY"
                     /protein_id="YP_005928125.1"
                     /db_xref="GI:386009848"
                     /db_xref="GeneID:12518449"
                     /translation="MSTEKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSI
                     AHATMLAQVGVLSDAERDTIIDGLKTIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIG
                     ITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAETIMPGFT
                     HLQTAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIDRELTC
                     KLLGFEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPD
                     RFCTGSSIMPQKKNPDVPELVRGKSGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLF
                     DAADTLRDSLRAFADMIPAIKPKHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEI
                     VGHAVKYGVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARDHIGGTAPAQV
                     RAAVVRGKALLASR"
     misc_feature    complement(261940..263313)
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /note="argininosuccinate lyase; Provisional; Region:
                     PRK00855"
                     /db_xref="CDD:179143"
     misc_feature    complement(261943..263244)
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /note="Argininosuccinate lyase (argininosuccinase, ASAL);
                     Region: Argininosuccinate_lyase; cd01359"
                     /db_xref="CDD:176463"
     misc_feature    complement(order(262336..262341,262345..262347,
                     262354..262356,262360..262362,262441..262443,
                     262450..262452,262456..262458,262480..262482,
                     262486..262488,262615..262617,262843..262848,
                     262972..262974,262981..262989,263056..263058,
                     263062..263064,263230..263232,263242..263244))
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /note="active sites [active]"
                     /db_xref="CDD:176463"
     misc_feature    complement(order(261967..261969,261991..262005,
                     262009..262011,262147..262149,262156..262158,
                     262165..262170,262183..262185,262195..262197,
                     262210..262212,262291..262293,262300..262302,
                     262333..262335,262342..262344,262351..262362,
                     262384..262392,262396..262398,262405..262413,
                     262417..262434,262438..262443,262450..262452,
                     262456..262464,262468..262479,262495..262497,
                     262519..262521,262528..262533,262546..262551,
                     262558..262563,262567..262572,262579..262581,
                     262591..262593,262600..262602,262612..262614,
                     262618..262623,262630..262644,262684..262686,
                     262693..262695,262699..262713,262744..262746,
                     262756..262758,262765..262770,262777..262779,
                     262795..262800,262810..262812,262828..262851,
                     262996..263001,263008..263010,263017..263019))
                     /gene="arlY"
                     /locus_tag="PPUBIRD1_0213"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176463"
     gene            263623..264366
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /db_xref="GeneID:12518450"
     CDS             263623..264366
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="LytTR family two component transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="PprA"
                     /protein_id="YP_005928126.1"
                     /db_xref="GI:386009849"
                     /db_xref="GeneID:12518450"
                     /translation="MNVLIVDDEPQGRERLTRLLGELEGYTVLEPSATNGDEALALIE
                     SLKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCSGDDEYGAEAFKDSTLSHVTK
                     PFQAHALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPLPQVIYF
                     IADHKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHF
                     QLYLKGLDGDALTVSRRHVAGVRKMMQTL"
     misc_feature    263623..264363
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="Response regulator of the LytR/AlgR family
                     [Transcription / Signal transduction mechanisms]; Region:
                     LytT; COG3279"
                     /db_xref="CDD:225818"
     misc_feature    263632..263970
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(263641..263646,263782..263784,263806..263808,
                     263866..263868,263917..263919,263926..263931)
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    263782..263784
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(263791..263796,263800..263808)
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    263926..263934
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    264061..264357
                     /gene="pprA"
                     /locus_tag="PPUBIRD1_0215"
                     /note="LytTr DNA-binding domain; Region: LytTR; pfam04397"
                     /db_xref="CDD:252568"
     gene            264486..265427
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /db_xref="GeneID:12518451"
     CDS             264486..265427
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /EC_number="2.5.1.61"
                     /note="Porphobilinogen deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="HemC protein"
                     /protein_id="YP_005928127.1"
                     /db_xref="GI:386009850"
                     /db_xref="GeneID:12518451"
                     /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHTGLQVTLVPMVSR
                     GDKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICERE
                     DPRDAFVSNTFDSLEALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLD
                     AGEYDAIILAAAGLIRLGFEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAP
                     LHHVDTADRVMAERALNKRLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADA
                     RAPRAAAEALGVQVAEDLLGQGAEAILKEVYGEAGHP"
     misc_feature    264489..265370
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    264501..265373
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    order(264522..264524,264537..264539,264729..264746,
                     264750..264752,264777..264782,264786..264803,
                     264876..264878,264882..264887,264897..264899,
                     264936..264938,264999..265001,265008..265013,
                     265059..265082,265134..265136,265155..265157,
                     265164..265166,265176..265181,265188..265190,
                     265209..265211,265221..265223,265227..265229,
                     265263..265265,265278..265280,265287..265289,
                     265296..265298,265302..265304)
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    order(264528..264530,264540..264542,264726..264728,
                     264732..264737,264864..264872,264876..264881,
                     264927..264929,264948..264950,264987..264995,
                     265002..265004,265011..265013,265068..265070,
                     265077..265082,265209..265211)
                     /gene="hemC"
                     /locus_tag="PPUBIRD1_0216"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            265424..266191
                     /gene="hemD"
                     /locus_tag="PPUBIRD1_0217"
                     /db_xref="GeneID:12518452"
     CDS             265424..266191
                     /gene="hemD"
                     /locus_tag="PPUBIRD1_0217"
                     /EC_number="4.2.1.75"
                     /note="uroporphyrinogen-III synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="HemD protein"
                     /protein_id="YP_005928128.1"
                     /db_xref="GI:386009851"
                     /db_xref="GeneID:12518452"
                     /translation="MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLEIEPITVQA
                     PQRLSLEGLHDFQAIIVVSKPAARLLLEHLAETSIQPPQRGWFTVGEATAGVLQGAGL
                     EVSFPPRGDDSEALLALPALRQALTELAPRVLIVRGVGGRELLAERLAEQGASVEYLE
                     LYRRCLPAYPAGTLMRRIEAERLNGLVVSSGQGFEHLQQMAGADWLRLAQLPLFVPSP
                     RVAEQAKAAGAQQVVDCRGASATALLAAVQRSAAPAS"
     misc_feature    265442..266164
                     /gene="hemD"
                     /locus_tag="PPUBIRD1_0217"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    order(265451..265453,265610..265618,265697..265699,
                     265835..265837,265907..265909,265913..265915,
                     265988..266002)
                     /gene="hemD"
                     /locus_tag="PPUBIRD1_0217"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            266237..267337
                     /locus_tag="PPUBIRD1_0218"
                     /db_xref="GeneID:12518453"
     CDS             266237..267337
                     /locus_tag="PPUBIRD1_0218"
                     /codon_start=1
                     /transl_table=11
                     /product="Uroporphyrin-III C-methyltransferase, putative"
                     /protein_id="YP_005928129.1"
                     /db_xref="GI:386009852"
                     /db_xref="GeneID:12518453"
                     /translation="MSETVLSNNDQPSAQAPAEPVTTPPAKRSGSGLAALALLLGAAG
                     VAVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDR
                     RRLVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALV
                     EGADEILREQSDPGAFAAREQLARSLATLNSTQQPDRTGLFLKLAAQRELVQQLSAQS
                     PEFDSNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRL
                     ALSLTIEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLDSLNALADQPV
                     SVVTPDLSESLAAVQAYIQRRHLPAEAEGGKP"
     misc_feature    266405..267319
                     /locus_tag="PPUBIRD1_0218"
                     /note="HemX; Region: HemX; cl19375"
                     /db_xref="CDD:267728"
     gene            267334..268572
                     /gene="hemY"
                     /locus_tag="PPUBIRD1_0219"
                     /db_xref="GeneID:12518454"
     CDS             267334..268572
                     /gene="hemY"
                     /locus_tag="PPUBIRD1_0219"
                     /note="HemY domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HemY"
                     /protein_id="YP_005928130.1"
                     /db_xref="GI:386009853"
                     /db_xref="GeneID:12518454"
                     /translation="MKRVYLLAVLAIVVAAALGIAVAKHSGYVLISYGGFRYQSGLWA
                     ALAGILAVVLLLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRLAIEQGQLDLAEGRWA
                     SAQRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTH
                     AQLQMDRGENDGALETLLAMQERHPHNGQVLRLLQRLYVERGDWSALIRLLPDLRKGK
                     VLPAAELAALEQRAWGQNLSLATTRGEDALSARQSLERAWQQLTAAQRQEPQLVLAYA
                     EQLRQVGAQNEAEQVLRTALKRDYESHLARLYGLVRGDDPVRQLQTAEGWLKAHPQDA
                     SLLLTLGRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQE
                     GLGLLDERLLALPLPEGVRA"
     misc_feature    267394..268512
                     /gene="hemY"
                     /locus_tag="PPUBIRD1_0219"
                     /note="heme biosynthesis-associated TPR protein; Region:
                     TPR_hemY_coli; TIGR00540"
                     /db_xref="CDD:233013"
     misc_feature    267412..267735
                     /gene="hemY"
                     /locus_tag="PPUBIRD1_0219"
                     /note="HemY protein N-terminus; Region: HemY_N; pfam07219"
                     /db_xref="CDD:191703"
     gene            268795..269301
                     /gene="dsbB"
                     /locus_tag="PPUBIRD1_0220"
                     /db_xref="GeneID:12518455"
     CDS             268795..269301
                     /gene="dsbB"
                     /locus_tag="PPUBIRD1_0220"
                     /note="Disulfide bond formation protein B 2"
                     /codon_start=1
                     /transl_table=11
                     /product="DsbB"
                     /protein_id="YP_005928131.1"
                     /db_xref="GI:386009854"
                     /db_xref="GeneID:12518455"
                     /translation="MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRL
                     LLGGYALLCFAAVLQAPGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPV
                     PIGRVFEQSWGEAARQLLLGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAY
                     RFRTLARA"
     misc_feature    268795..269220
                     /gene="dsbB"
                     /locus_tag="PPUBIRD1_0220"
                     /note="Disulfide bond formation protein DsbB; Region:
                     DsbB; pfam02600"
                     /db_xref="CDD:251407"
     gene            269533..270003
                     /gene="pfrA"
                     /locus_tag="PPUBIRD1_0221"
                     /db_xref="GeneID:12518456"
     CDS             269533..270003
                     /gene="pfrA"
                     /locus_tag="PPUBIRD1_0221"
                     /note="anti-RNA polymerase sigma 70 factor"
                     /codon_start=1
                     /transl_table=11
                     /product="PfrA"
                     /protein_id="YP_005928132.1"
                     /db_xref="GI:386009855"
                     /db_xref="GeneID:12518456"
                     /translation="MLDSCQNAQERWGGVHKLIDRWLEERQELVQAFRALRDVRPAFA
                     DKDTNGDFCALLVDYVSAWHFEVCEQLVSEAKAFGDEKALKLAEEINPRINDSTQIAL
                     AFNDHCAKGECKDTERFAEKLAKLGGLLHERFELEDCLIEVLHNAHKEEGAVQA"
     misc_feature    269533..269997
                     /gene="pfrA"
                     /locus_tag="PPUBIRD1_0221"
                     /note="anti-RNA polymerase sigma 70 factor; Provisional;
                     Region: PRK11718"
                     /db_xref="CDD:236962"
     gene            complement(270012..270617)
                     /gene="fklB"
                     /locus_tag="PPUBIRD1_0222"
                     /db_xref="GeneID:12518457"
     CDS             complement(270012..270617)
                     /gene="fklB"
                     /locus_tag="PPUBIRD1_0222"
                     /EC_number="5.2.1.8"
                     /note="peptidyl-prolyl cis-trans isomerase FklB"
                     /codon_start=1
                     /transl_table=11
                     /product="FklB"
                     /protein_id="YP_005928133.1"
                     /db_xref="GI:386009856"
                     /db_xref="GeneID:12518457"
                     /translation="MAPLALADNDDHDLAYSLGASLGERLRQEMPGLQLDALVEGLKQ
                     SYQGQPLKLDKTRMQAVLQQLEAQEGDAATQKLQAAETRFMANERGRYGVHELTEGVL
                     YSELQAGTGAQPKAGGKVQVRYVGRLPDGSIFDQNQTPQWFNLDSVIEGWQVALPKMH
                     TGAKWRLVIPSAQAYGAEGAGDLIAPYTPLIFEIELLAVGD"
     misc_feature    complement(270309..270596)
                     /gene="fklB"
                     /locus_tag="PPUBIRD1_0222"
                     /note="Domain amino terminal to FKBP-type peptidyl-prolyl
                     isomerase; Region: FKBP_N; pfam01346"
                     /db_xref="CDD:250550"
     misc_feature    complement(270021..270581)
                     /gene="fklB"
                     /locus_tag="PPUBIRD1_0222"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerases 1
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: FkpA; COG0545"
                     /db_xref="CDD:223619"
     misc_feature    complement(270027..270278)
                     /gene="fklB"
                     /locus_tag="PPUBIRD1_0222"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     gene            270829..271764
                     /gene="algP"
                     /locus_tag="PPUBIRD1_0223"
                     /db_xref="GeneID:12518458"
     CDS             270829..271764
                     /gene="algP"
                     /locus_tag="PPUBIRD1_0223"
                     /note="alginate regulatory protein AlgP"
                     /codon_start=1
                     /transl_table=11
                     /product="AlgP"
                     /protein_id="YP_005928134.1"
                     /db_xref="GI:386009857"
                     /db_xref="GeneID:12518458"
                     /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEEACSQALADAEKLLAKL
                     EKQRGKAQEKLHNGRLKLQDAAKAGKAKAQNKAQKAIGELEELLESLKERQTQTRSYI
                     QQLKRDAQDSLKLAQGVGKVREAAGKALDQRAAKPAAKATAAAKPAAKPAAKATAAAK
                     PAAKPAAKATATAKPAAKPAAKTTAAAKPVAKPAAKATAAAKPAAKPAAKVTAAAKPA
                     AKPAARATAAAKPAAKATAAAKPAAKPAAKAPAAKPAAKPAAAKAPARTAAKPAANPA
                     EAKPATPAAATNSVSPAAAAPSAPVSTPSQVPSAS"
     gene            complement(271743..272222)
                     /locus_tag="PPUBIRD1_0224"
                     /db_xref="GeneID:12518459"
     CDS             complement(271743..272222)
                     /locus_tag="PPUBIRD1_0224"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928135.1"
                     /db_xref="GI:386009858"
                     /db_xref="GeneID:12518459"
                     /translation="MHTDLWNYALALYARPGVEAACLELQALGGDVCLLLCATWLQAR
                     GVAVLGERAHALQELAEPWQRDVVTPLRSLRQQWRTPASADAQLAALREQVKGLELQA
                     EKALLERLQERSQQWPAGSHEPTDDWLARLAPDQALHHDALVQLRVAAAALQDAEGT"
     misc_feature    complement(271890..272216)
                     /locus_tag="PPUBIRD1_0224"
                     /note="Protein of unknown function (DUF2390); Region:
                     DUF2390; pfam09523"
                     /db_xref="CDD:255411"
     gene            272336..274183
                     /locus_tag="PPUBIRD1_0225"
                     /db_xref="GeneID:12518460"
     CDS             272336..274183
                     /locus_tag="PPUBIRD1_0225"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_005928136.1"
                     /db_xref="GI:386009859"
                     /db_xref="GeneID:12518460"
                     /translation="MTLHAGHKAGLIGANGAGKSSLFALLRGELSPDAGDCQLPGDWR
                     IAHMRQEVDTLDRLAVDYVLDGDVRLRKVQAELAAAEQAHDGTALARLHSELESADGY
                     TADARARKLLAGLGFTNDQMDRRVGDFSGGWRMRLNLAQALMCPSDLLLLDEPTNHLD
                     LDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLHVEQRKLNLYKGGYTAFERTRA
                     ERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQAQSRIKALERMEELSAAHVDSP
                     FDFVFRESQKISSPLLSLSEGRLGYGDKAILDKVKLQLTPGARIGLLGPNGAGKSTLI
                     KNLAGELEPLSGRLVRGENLAVGYFAQHQLDSLDDKASPLLHLQRIAPAEREQTLRDF
                     LGGFDFHGARCDEPVVNFSGGEKARLALALIAWERPNLLLLDEPTNHLDLEMRLALTM
                     ALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVDTFDGDLEDYSRWLVEYRQRSAPA
                     STAPVNPDKTDKKAQRQAAAALRQQLAPHKKAADKLETELNQVHAQLAEIETALGDGG
                     LYDAARKDELRDLLARQTRLKQREGELEEAWMEALETLESMQAELEALS"
     misc_feature    272336..272941
                     /locus_tag="PPUBIRD1_0225"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    272339..274174
                     /locus_tag="PPUBIRD1_0225"
                     /note="putative ABC transporter ATP-binding protein;
                     Provisional; Region: PRK10636"
                     /db_xref="CDD:236729"
     misc_feature    272921..273172
                     /locus_tag="PPUBIRD1_0225"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    273230..273784
                     /locus_tag="PPUBIRD1_0225"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    273299..>273559
                     /locus_tag="PPUBIRD1_0225"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     gene            274183..274770
                     /locus_tag="PPUBIRD1_0226"
                     /db_xref="GeneID:12518461"
     CDS             274183..274770
                     /locus_tag="PPUBIRD1_0226"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928137.1"
                     /db_xref="GI:386009860"
                     /db_xref="GeneID:12518461"
                     /translation="MEELRSLLPGQWMDTFWLGLQILLILAAAFILQRIVARGLSRLG
                     QRYPLPPELLVPVRGGLRWLIMGSALLFVLERMGVSATVLWTALSGFVAVAAVAFFAM
                     WSVLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEVPEAGG
                     ALVQVPNSQFFQKSVRRWRGAEVQALHKDTAAEAD"
     misc_feature    274240..>274722
                     /locus_tag="PPUBIRD1_0226"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    274363..>274722
                     /locus_tag="PPUBIRD1_0226"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            274969..275601
                     /gene="lysE"
                     /locus_tag="PPUBIRD1_0227"
                     /db_xref="GeneID:12518462"
     CDS             274969..275601
                     /gene="lysE"
                     /locus_tag="PPUBIRD1_0227"
                     /note="amino acid transporter LysE"
                     /codon_start=1
                     /transl_table=11
                     /product="LysE"
                     /protein_id="YP_005928138.1"
                     /db_xref="GI:386009861"
                     /db_xref="GeneID:12518462"
                     /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNAL
                     GLQLGLIMQIAIIAAGVGAVLAASATAFQVIKWFGVGYLVYLAYKQWRALPMDMSDES
                     GVRPIGKPLSLVFRGFLVNISNPKALVFMLAVLPQFLNPHAPLLPQYVAITVTMVTVD
                     LLVMAGYTGLASHVLRMLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPV"
     misc_feature    274969..275589
                     /gene="lysE"
                     /locus_tag="PPUBIRD1_0227"
                     /note="LysE type translocator; Region: LysE; cl00565"
                     /db_xref="CDD:260502"
     gene            complement(275650..276402)
                     /locus_tag="PPUBIRD1_0228"
                     /db_xref="GeneID:12518463"
     CDS             complement(275650..276402)
                     /locus_tag="PPUBIRD1_0228"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928139.1"
                     /db_xref="GI:386009862"
                     /db_xref="GeneID:12518463"
                     /translation="MFMQFGFGAVLIVLAMLVLSAFRILREYERGVVFQLGRFWQVKG
                     PGLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQV
                     EDFLVATSQLAQTTLRAVLGKHELDELLAEREQLNLDIRQVLDAQTDAWGIKVANVEI
                     KHVDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLSKEPGAMQLRY
                     MQTLGMIAGDKSSTIVFPLPIDLLKGLVDKEK"
     misc_feature    complement(275698..276399)
                     /locus_tag="PPUBIRD1_0228"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    complement(275716..276249)
                     /locus_tag="PPUBIRD1_0228"
                     /note="Uncharacterized prokaryotic subgroup of the
                     stomatin-like proteins (slipins) family; belonging to the
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_eoslipins_u1; cd08826"
                     /db_xref="CDD:259808"
     misc_feature    complement(order(275869..275871,275881..275883,
                     275893..275895,275899..275919,275926..275928,
                     276001..276006,276013..276015,276100..276108,
                     276112..276117,276154..276162,276184..276186,
                     276214..276219,276226..276249))
                     /locus_tag="PPUBIRD1_0228"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259808"
     gene            complement(276405..277751)
                     /locus_tag="PPUBIRD1_0229"
                     /db_xref="GeneID:12518464"
     CDS             complement(276405..277751)
                     /locus_tag="PPUBIRD1_0229"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928140.1"
                     /db_xref="GI:386009863"
                     /db_xref="GeneID:12518464"
                     /translation="MIARCWRLLLLLLLLGITPGGQAAPGAVWVLNIDDAIGPASADY
                     LVRSLSQAQAQGAQLVVIRMDTPGGLDSAMRQMIKAILASPVPVASYVAPSGARAASA
                     GTYILYASHVAAMAPGTNLGAATPVRIGGAPGTPSDDKAKGGDDETLARKQVNDAAAY
                     IRGLAQMRGRNADWAEQAVREAVSLSASEALRLNVIDQVADDLSDLLRKLDGKTLQVA
                     GQPRQLQTAGASVVEHLPDWRTRVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGG
                     VVGGICLLLALYALQLLPVSFAGVALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGA
                     LILIDTDAPGFGIPLALIGTLALLSALLIGGVLGMALKARQRALVSGDAGLVGSLVTV
                     TQVMASDPFCGVVLAQGEPWQARCATPLQTGQNVRVTARHGVMLEVSAAAPATQGE"
     misc_feature    complement(276438..277697)
                     /locus_tag="PPUBIRD1_0229"
                     /note="Membrane-bound serine protease (ClpP class)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: NfeD; COG1030"
                     /db_xref="CDD:223961"
     misc_feature    complement(277080..277670)
                     /locus_tag="PPUBIRD1_0229"
                     /note="Nodulation formation efficiency D (NfeD) is a
                     membrane-bound ClpP-class protease; Region:
                     Clp_protease_NfeD_1; cd07020"
                     /db_xref="CDD:132931"
     misc_feature    complement(order(277140..277142,277665..277667))
                     /locus_tag="PPUBIRD1_0229"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132931"
     misc_feature    complement(order(277296..277298,277449..277451))
                     /locus_tag="PPUBIRD1_0229"
                     /note="active site residues [active]"
                     /db_xref="CDD:132931"
     misc_feature    complement(276438..276851)
                     /locus_tag="PPUBIRD1_0229"
                     /note="NfeD-like C-terminal, partner-binding; Region:
                     NfeD; pfam01957"
                     /db_xref="CDD:250993"
     gene            277850..278308
                     /locus_tag="PPUBIRD1_0230"
                     /db_xref="GeneID:12518465"
     CDS             277850..278308
                     /locus_tag="PPUBIRD1_0230"
                     /codon_start=1
                     /transl_table=11
                     /product="YbaK/prolyl-tRNA synthetase associated
                     domain-containing protein"
                     /protein_id="YP_005928141.1"
                     /db_xref="GI:386009864"
                     /db_xref="GeneID:12518465"
                     /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVA
                     KSVMLDDRHGNYIMAVLPANRHLDMTKVRMSGAWHLTRESGLPSLFNDCERGAVPALG
                     DAYQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
     misc_feature    277898..278293
                     /locus_tag="PPUBIRD1_0230"
                     /note="YbaK-like.  The YbaK family of deacylase domains
                     includes the INS amino acid-editing domain of  the
                     bacterial class II prolyl tRNA synthetase (ProRS), and
                     it's trans-acting homologs, YbaK, ProX, and PrdX.  The
                     primary function of INS is to hydrolyze...; Region:
                     YbaK_like; cd04332"
                     /db_xref="CDD:239824"
     misc_feature    order(277982..277984,278135..278140,278219..278221)
                     /locus_tag="PPUBIRD1_0230"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239824"
     gene            278370..278612
                     /locus_tag="PPUBIRD1_0231"
                     /db_xref="GeneID:12518466"
     CDS             278370..278612
                     /locus_tag="PPUBIRD1_0231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928142.1"
                     /db_xref="GI:386009865"
                     /db_xref="GeneID:12518466"
                     /translation="MEAPIHPFADLFKQLGLPDDPTSIDQFITSHSPLKNEIKLVDAP
                     FWNDSQRAFLKDSIIEDSDWAVPFDQLNEALRRPRK"
     misc_feature    278370..278594
                     /locus_tag="PPUBIRD1_0231"
                     /note="Protein of unknown function (DUF2789); Region:
                     DUF2789; pfam10982"
                     /db_xref="CDD:204569"
     gene            278718..279320
                     /locus_tag="PPUBIRD1_0232"
                     /db_xref="GeneID:12518467"
     CDS             278718..279320
                     /locus_tag="PPUBIRD1_0232"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928143.1"
                     /db_xref="GI:386009866"
                     /db_xref="GeneID:12518467"
                     /translation="MTILGTLTASYFYGIRQTQQMNQAVHFLYAAAAVTVAVALVALT
                     WIAWQQLRLNKREVVQGRTLLTIWNTKVALRRVETVFDRYFWGSYWHSGRTFEEVMGE
                     LRGTPLEQSLDALKRQCRVLDREIHDRHHHWLANARDLSSVAQAMARERYQLDLGEPT
                     HSGHGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
     gene            complement(279327..279764)
                     /locus_tag="PPUBIRD1_0233"
                     /db_xref="GeneID:12518468"
     CDS             complement(279327..279764)
                     /locus_tag="PPUBIRD1_0233"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928144.1"
                     /db_xref="GI:386009867"
                     /db_xref="GeneID:12518468"
                     /translation="MKNVEQILKTKSQHQTVYTIGPDDSVLDALKLLAEKNVGALPVV
                     EGGQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKQKLDFCMNLMTDRH
                     LRHLPVVDNGRLLGLLSIGDLVKETIDEQASLIKQMEQYIRGE"
     misc_feature    complement(279393..279755)
                     /locus_tag="PPUBIRD1_0233"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    complement(279390..279722)
                     /locus_tag="PPUBIRD1_0233"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair_10; cd04623"
                     /db_xref="CDD:239995"
     gene            complement(279934..281664)
                     /locus_tag="PPUBIRD1_0234"
                     /db_xref="GeneID:12518469"
     CDS             complement(279934..281664)
                     /locus_tag="PPUBIRD1_0234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928145.1"
                     /db_xref="GI:386009868"
                     /db_xref="GeneID:12518469"
                     /translation="MQLKKLTATTLLLASIGLFTQPAQANLTQQQSAAIVKAFDGSDP
                     SDFKQFLGKLKGSDLGKANNLEATVDAYLANKPLAAGQQDEINRLLGLYTRIKYGKAA
                     TETLRELVAIPTFNVEGTPQYENPEFLKIADKIKALADRFGLAFRNIDNRVYEISLGS
                     GKEVIGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGIVVAMY
                     ALKVAKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPDYNLALDGGYPVVIAEK
                     GYGTVMASFTKRPASGKGAEIVNLTGGLATNQIPTTSVATLISDNPAQLTKHLQQAGA
                     KYVKQHGSDFSIDAKADGKQVLLTVTGVSAHSSEPESGINPVARMLDFINGLGQQVPL
                     KHNHFTDAARYAADNWGLDYLGNKLGVAFKDPFMGPLTTSLTFVGVDDKGLKLAVNLR
                     IPKGKPIATIKDELADKLGKWTRQSNTSVAFDYSLDEPMYRNPEGEWVKALLAVATEN
                     LGMKHEFGTSAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVEQFMLDLQVVSEM
                     VARIGQMPKL"
     misc_feature    complement(279937..281664)
                     /locus_tag="PPUBIRD1_0234"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06156"
                     /db_xref="CDD:235720"
     misc_feature    complement(279955..281376)
                     /locus_tag="PPUBIRD1_0234"
                     /note="M20 Peptidase Xaa-His dipeptidase (PepV) degrades
                     hydrophobic dipeptides; Region: M20_PepV; cd03888"
                     /db_xref="CDD:193509"
     misc_feature    complement(order(280030..280035,280039..280041,
                     280102..280107,280315..280317,280570..280572,
                     280744..280746,280864..280869,280936..280941,
                     281038..281043,281155..281157))
                     /locus_tag="PPUBIRD1_0234"
                     /note="active site"
                     /db_xref="CDD:193509"
     misc_feature    complement(order(280030..280032,280867..280869,
                     280936..280941,281041..281043,281155..281157))
                     /locus_tag="PPUBIRD1_0234"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193509"
     gene            complement(281827..281903)
                     /locus_tag="PPUBIRD1_t0064"
                     /note="tRNA-Arg7"
                     /db_xref="GeneID:12518470"
     tRNA            complement(281827..281903)
                     /locus_tag="PPUBIRD1_t0064"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12518470"
     gene            282024..282149
                     /locus_tag="PPUBIRD1_0235"
                     /db_xref="GeneID:12518471"
     CDS             282024..282149
                     /locus_tag="PPUBIRD1_0235"
                     /codon_start=1
                     /transl_table=11
                     /product="Arylsulfotransferase"
                     /protein_id="YP_005928146.1"
                     /db_xref="GI:386009869"
                     /db_xref="GeneID:12518471"
                     /translation="MNNGWSGGTGRNWAHVNAIDYGADNDSIIVSAQHQGGVNWP"
     misc_feature    <282045..>282137
                     /locus_tag="PPUBIRD1_0235"
                     /note="Arylsulfotransferase (ASST); Region:
                     Arylsulfotrans; cl19972"
                     /db_xref="CDD:268325"
     gene            282379..283821
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /db_xref="GeneID:12518472"
     CDS             282379..283821
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /EC_number="1.2.1.16"
                     /note="Succinate-semialdehyde dehydrogenase [NADP+]"
                     /codon_start=1
                     /transl_table=11
                     /product="GabD"
                     /protein_id="YP_005928147.1"
                     /db_xref="GI:386009870"
                     /db_xref="GeneID:12518472"
                     /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPK
                     MGTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPL
                     AEAKGEIAYAASFIEWFAEEAKRIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPA
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGG
                     ELTGNSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFIVFDDADLDKAVEG
                     AIISKYRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEEGTTTGPLIDG
                     KAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPL
                     FRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPF
                     GGIKASGLGREGSKYGIEDYLEIKYLCISV"
     misc_feature    282466..283812
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(282580..282582,282607..282609,282730..282732,
                     282739..282744,282748..282774,282790..282798,
                     282811..282813,283057..283059,283093..283095,
                     283105..283107,283114..283116,283285..283287,
                     283297..283299,283435..283437,283633..283635,
                     283639..283644,283654..283656,283660..283662,
                     283669..283671,283675..283695,283711..283713,
                     283720..283725,283741..283743,283756..283758,
                     283792..283812)
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(282835..282849,282871..282873,282916..282918,
                     282922..282927,283069..283080,283087..283089,
                     283096..283101,283141..283149,283243..283245,
                     283528..283530,283534..283536,283612..283614,
                     283726..283728)
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(282847..282849,283141..283143,283234..283236,
                     283243..283245)
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_0236"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            284004..285281
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /db_xref="GeneID:12518473"
     CDS             284004..285281
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /EC_number="2.6.1.19"
                     /EC_number="2.6.1.22"
                     /note="4-aminobutyrate aminotransferase; bifunctional"
                     /codon_start=1
                     /transl_table=11
                     /product="GabT protein"
                     /protein_id="YP_005928148.1"
                     /db_xref="GI:386009871"
                     /db_xref="GeneID:12518473"
                     /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGREL
                     IDFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDF
                     DKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPA
                     PKELMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFP
                     LAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTA
                     GLREIQKKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGT
                     YGNVLRILVPLTAEDALLDKGLAIIEECFAEIA"
     misc_feature    284025..285266
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    284073..285278
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    order(284334..284342,284418..284423,284427..284429,
                     284622..284624,284721..284723,284727..284732,
                     284808..284810)
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(284337..284342,284418..284423,284622..284624,
                     284721..284723,284730..284732,284808..284810)
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    284808..284810
                     /gene="gabT"
                     /locus_tag="PPUBIRD1_0237"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            285419..286678
                     /locus_tag="PPUBIRD1_0238"
                     /db_xref="GeneID:12518474"
     CDS             285419..286678
                     /locus_tag="PPUBIRD1_0238"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative signal transduction protein"
                     /protein_id="YP_005928149.1"
                     /db_xref="GI:386009872"
                     /db_xref="GeneID:12518474"
                     /translation="MSAAAPTPPSVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGS
                     QALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGVPFILMSNRNDSASVREALPL
                     HPTAYLSKPLNLDNLRKRLQELLLAVGEEIACPIPALQAGASLPAYLEQRRATADGGP
                     LLADVQVAINRALNPQGLNLRVLEEEVRNDPQVTAVLIAAANSAALHRDAPVQTLLQA
                     LNKLGSTQSMNLILGMTLKRSARLSDPLLAEHATRYWDLSLHTAEYGRTLARMLELDE
                     GRCYCAGLLHCLGDLAVLRCLQEWRLAGGDLDERNVQQSLEEFGAAFGSALRTRWRLP
                     LALRELIAAIYQLGGGVYSREILAMNLAGQLSRLPAEQGLEKVASGKTARLLKLGLPE
                     LRRLRKVENPEVKPQEDPPVAGAEVSS"
     misc_feature    285443..>285901
                     /locus_tag="PPUBIRD1_0238"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    285452..285793
                     /locus_tag="PPUBIRD1_0238"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(285461..285466,285596..285598,285620..285622,
                     285680..285682,285737..285739,285746..285751)
                     /locus_tag="PPUBIRD1_0238"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    285596..285598
                     /locus_tag="PPUBIRD1_0238"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(285605..285610,285614..285622)
                     /locus_tag="PPUBIRD1_0238"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    285746..285754
                     /locus_tag="PPUBIRD1_0238"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    285815..286642
                     /locus_tag="PPUBIRD1_0238"
                     /note="Predicted signal transduction protein [Signal
                     transduction mechanisms]; Region: COG1639"
                     /db_xref="CDD:224554"
     misc_feature    285896..286456
                     /locus_tag="PPUBIRD1_0238"
                     /note="HDOD domain; Region: HDOD; pfam08668"
                     /db_xref="CDD:254961"
     gene            complement(286769..287797)
                     /locus_tag="PPUBIRD1_0239"
                     /db_xref="GeneID:12518475"
     CDS             complement(286769..287797)
                     /locus_tag="PPUBIRD1_0239"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase with PAS/PAC sensor"
                     /protein_id="YP_005928150.1"
                     /db_xref="GI:386009873"
                     /db_xref="GeneID:12518475"
                     /translation="MLAARFHVETCSVHMAKNIPTIFPGTPPPEAAQTLLALLHAQGE
                     VARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWR
                     DSIYPDDLEFAERSLAQVLLKGAVEDREYRILNADGQLRWLSDKCYINQQHDGDRVII
                     VGIAEDITEKKQLEGELQRLATTDVLTQSSNRRHFFECAQQAFDSARADGTPLAFLLL
                     DIDDFKRINDSYGHQEGDQVLQHIADSGKAVLRRGDLFGRIGGEEFAAVFPGCNAQVA
                     EQIAERLQRQIQHLSFSHGQQTYGVTVSQGLTGLTDEDVALDSLYARADAAMYQAKRQ
                     GKNQIVRG"
     misc_feature    complement(287297..287575)
                     /locus_tag="PPUBIRD1_0239"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(287306..287572)
                     /locus_tag="PPUBIRD1_0239"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    complement(order(287384..287386,287399..287401,
                     287477..287488,287531..287533,287549..287551,
                     287561..287563))
                     /locus_tag="PPUBIRD1_0239"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(287357..287359,287363..287365,
                     287447..287452,287459..287461,287483..287485,
                     287495..287497))
                     /locus_tag="PPUBIRD1_0239"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(286778..287254)
                     /locus_tag="PPUBIRD1_0239"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(287012..287014,287141..287143))
                     /locus_tag="PPUBIRD1_0239"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(287009..287020,287024..287026,
                     287090..287092,287102..287104,287114..287119,
                     287126..287128))
                     /locus_tag="PPUBIRD1_0239"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(286952..286954,287036..287038))
                     /locus_tag="PPUBIRD1_0239"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(287897..289081)
                     /locus_tag="PPUBIRD1_0240"
                     /db_xref="GeneID:12518476"
     CDS             complement(287897..289081)
                     /locus_tag="PPUBIRD1_0240"
                     /codon_start=1
                     /transl_table=11
                     /product="Fatty acid desaturase"
                     /protein_id="YP_005928151.1"
                     /db_xref="GI:386009874"
                     /db_xref="GeneID:12518476"
                     /translation="MWYNGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALEL
                     NGALKHFFRFWLWLTTAQNTREWTAVHRKHHAKCETPDDPHSPVYKGLGTVLRKGAEL
                     YREEARNPETLRIYGKNCPDDWIERNLYSRYKLGGIALMAVIDLLLFGTLGITIWAVQ
                     MMWIPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKL
                     SVKRWEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKASLDMDTAMAILNNRFQIMA
                     QYRKLVIGPLVKQELARVDASVRHRFRRAKRLLSRETSLLEDRHHVRIESMLAHSQAL
                     KTIYEKRLALQQIWARTSANGHDMLAAMKDWVHEAETSGIQALRDFAAQLKTYSLRPT
                     GA"
     misc_feature    complement(288356..289048)
                     /locus_tag="PPUBIRD1_0240"
                     /note="The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like
                     CD includes the delta-9 and delta-11 acyl CoA desaturases
                     found in various eukaryotes including vertebrates,
                     insects, higher plants, and fungi. The delta-9 acyl-lipid
                     desaturases are found in a wide...; Region:
                     Delta9-FADS-like; cd03505"
                     /db_xref="CDD:239582"
     misc_feature    complement(order(288452..288457,288464..288466,
                     288857..288862,288869..288871,288965..288967,
                     288980..288982))
                     /locus_tag="PPUBIRD1_0240"
                     /note="Di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239582"
     misc_feature    complement(287921..>288283)
                     /locus_tag="PPUBIRD1_0240"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            289228..291123
                     /locus_tag="PPUBIRD1_0241"
                     /db_xref="GeneID:12518477"
     CDS             289228..291123
                     /locus_tag="PPUBIRD1_0241"
                     /codon_start=1
                     /transl_table=11
                     /product="Sensory box protein"
                     /protein_id="YP_005928152.1"
                     /db_xref="GI:386009875"
                     /db_xref="GeneID:12518477"
                     /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHSMTDDPLALTVGR
                     QINVVVWVLLSALLIYVSRVRLLNFIGHGARLRCEDRERLRMAAAVFDSTLEGVLVTD
                     RQGLIVHVNRAFMRITGYQQDEVIGQRPSKFKSGHHGLAFYQEVFATLAEKGEWSGEI
                     WNRRKSGEIYPQWQTICAIRDDEGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGL
                     PNRLLFTDRVEQALAAAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLG
                     EVLGNGVTLARLGGDEFGVLVENCQQVGQAGKLAQCIIERMREPFQFEGNRLFISASV
                     GISLYPSDALGAEQLLRNADSALYKAKSNGRACYALYTEELTAHAQHRVETAAELRRA
                     LEQDELRVYFQPVHDLASGRQVGVETLVRWQHPRRGLVPPGEFIPIAERTGLIAEIDT
                     WVLQQACRQMVQWQAQGRQLTFVGVNISSRLFGQHELYRQVAEVLHDTGLAPALLELE
                     VTESAVMEDPEVALEQLHRLRELGVTLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVA
                     GLPVDEDDIAIVRVIIALARSMGMQVHAEGIEQAEQASFLLQEECQLGQGYWFGRPVP
                     AEDLRWD"
     misc_feature    289249..291117
                     /locus_tag="PPUBIRD1_0241"
                     /note="RNase II stability modulator; Provisional; Region:
                     PRK10060"
                     /db_xref="CDD:236645"
     misc_feature    289513..289815
                     /locus_tag="PPUBIRD1_0241"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(289555..289557,289567..289569,289585..289587,
                     289624..289635,289711..289713,289726..289728)
                     /locus_tag="PPUBIRD1_0241"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(289615..289617,289627..289629,289651..289653,
                     289660..289665,289747..289749,289753..289755)
                     /locus_tag="PPUBIRD1_0241"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    289858..290334
                     /locus_tag="PPUBIRD1_0241"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(289969..289971,290098..290100)
                     /locus_tag="PPUBIRD1_0241"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(289984..289986,289993..289998,290008..290010,
                     290020..290022,290086..290088,290092..290103)
                     /locus_tag="PPUBIRD1_0241"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(290074..290076,290161..290163)
                     /locus_tag="PPUBIRD1_0241"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    290386..291108
                     /locus_tag="PPUBIRD1_0241"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(291151..291795)
                     /locus_tag="PPUBIRD1_0242"
                     /db_xref="GeneID:12518478"
     CDS             complement(291151..291795)
                     /locus_tag="PPUBIRD1_0242"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_005928153.1"
                     /db_xref="GI:386009876"
                     /db_xref="GeneID:12518478"
                     /translation="MWIDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIF
                     EARLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFA
                     RIAEVSLREVDHGLVEAAQAMGCRRRHIIWHVLLPEALPGIVGGFTITLVTLINSSAM
                     AGAIGAGGLGDIAYRYGYQRFDSQIMLTVIAMLVALVALIQLGGDRLAKGLNKR"
     misc_feature    complement(291196..291750)
                     /locus_tag="PPUBIRD1_0242"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(291199..291204,291211..291216,
                     291220..291225,291232..291237,291265..291270,
                     291307..291312,291319..291330,291349..291351,
                     291358..291363,291403..291405,291454..291456,
                     291463..291468,291478..291480,291484..291489,
                     291496..291498,291502..291504,291508..291513,
                     291577..291579,291583..291588,291595..291624,
                     291628..291639,291688..291690,291703..291708,
                     291715..291720))
                     /locus_tag="PPUBIRD1_0242"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(291313..291330,291577..291621))
                     /locus_tag="PPUBIRD1_0242"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(291235..291237,291265..291267,
                     291274..291276,291310..291312,291526..291528,
                     291577..291579))
                     /locus_tag="PPUBIRD1_0242"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(291382..291384,291394..291399,
                     291415..291453))
                     /locus_tag="PPUBIRD1_0242"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(291785..292894)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /db_xref="GeneID:12518479"
     CDS             complement(291785..292894)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="Methionine import ATP-binding protein metN2"
                     /codon_start=1
                     /transl_table=11
                     /product="MetN2"
                     /protein_id="YP_005928154.1"
                     /db_xref="GI:386009877"
                     /db_xref="GeneID:12518479"
                     /translation="MSQANALRAPTPQALPPLAREQALRPEVNEAHVRFIGLGKTYPG
                     QAQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEKPSQGRVLIDQVDIALFD
                     EDHLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPKAERQRKVRELLELVGLQ
                     EKHHVYPAQLSGGQKQRVGIARALVHSPEILLCDEATSALDPETTASILELLRDINQR
                     LGLTIVLITHEMAVIRDICHRVVVLERGAVVEQGEVWRVFGSPRHEVTRTLLAHLQAK
                     LPAALQASLQARPASGNSAVVLKLTVLGEPELSALFNDLGGRVRLLQGGVETIGEHAL
                     GQLILSVQHSPHDTHQLLERARRWAEDVEVLGHVD"
     misc_feature    complement(291791..292798)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="DL-methionine transporter ATP-binding subunit;
                     Provisional; Region: metN; PRK11153"
                     /db_xref="CDD:236863"
     misc_feature    complement(292109..292798)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="ATP-binding cassette domain of methionine
                     transporter; Region: ABC_MetN_methionine_transporter;
                     cd03258"
                     /db_xref="CDD:213225"
     misc_feature    complement(292673..292696)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(order(292211..292213,292310..292315,
                     292541..292543,292670..292678,292682..292687))
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(292541..292552)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(292358..292387)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(292310..292327)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="Walker B; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(292292..292303)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="D-loop; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(292205..292225)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213225"
     misc_feature    complement(291800..292015)
                     /gene="metN2"
                     /locus_tag="PPUBIRD1_0243"
                     /note="This domain is found at the C-terminus of ABC
                     transporter proteins involved in D-methionine transport as
                     well as a number of ferredoxin-like proteins; Region: NIL;
                     smart00930"
                     /db_xref="CDD:197998"
     gene            complement(292896..293696)
                     /locus_tag="PPUBIRD1_0244"
                     /db_xref="GeneID:12518480"
     CDS             complement(292896..293696)
                     /locus_tag="PPUBIRD1_0244"
                     /codon_start=1
                     /transl_table=11
                     /product="NLPA lipoprotein"
                     /protein_id="YP_005928155.1"
                     /db_xref="GI:386009878"
                     /db_xref="GeneID:12518480"
                     /translation="MLEKLFRPVAAIAITLGLCAGALAAEPLKIGTTSAFAIPLEAAV
                     EEAHKRGLEVKLIEFSDWIAPNVSLNSGDIDANYFQHIPFLENAKAAAGFNLVPYAPG
                     IINNVGLYSKKYKSFAELPEGASVAIANDPINSGRGLLLLAKAGLITLKPGVGYKATE
                     DDIVANPKKLKILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKE
                     YVIQFVIRPQSKDDPRLAKFVDIYQHSPAVRAALNKAHGKLYQAGWEG"
     misc_feature    complement(292905..293687)
                     /locus_tag="PPUBIRD1_0244"
                     /note="NLPA lipoprotein; Region: Lipoprotein_9; cl19159"
                     /db_xref="CDD:267512"
     gene            complement(293689..295074)
                     /gene="soxA"
                     /locus_tag="PPUBIRD1_0245"
                     /db_xref="GeneID:12518481"
     CDS             complement(293689..295074)
                     /gene="soxA"
                     /locus_tag="PPUBIRD1_0245"
                     /note="Dibenzothiophene desulfurization enzyme A"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SoxA"
                     /protein_id="YP_005928156.1"
                     /db_xref="GI:386009879"
                     /db_xref="GeneID:12518481"
                     /translation="MAKQILLNAFNMNCIGHINHGLWTHPRDTSTQYKTLDYWTNLAR
                     LLERGLFDGLFIADIVGTYDIYGQSLDVTLKESIQLPVNDPLLLVSAMAAVTRHLGFG
                     LTANLTYEAPYLFARRLSTLDHLSNGRVGWNIVTGYLDSAARAMGLAQQPEHDRRYDQ
                     ADEYLQVLYKLLEGSWADDAVVADREHRVYASPDKVRKVQHQGEFYKVEGYHLCEPSP
                     QRTPVLFQAGSSQRGLAFAGNHAECVFISGQDKAATRAQVDKVRAATQAAGRDPQAVK
                     VFMGITVIVAATEQLAQAKHAEYLRHASAEAGVAHFAASTGIDFAAYELDQPIAFSQG
                     NAIQSATRQLQDNAWTRRRLLQQHALGGRYVTLVGAPEQVAEQLIAWIDETGLDGFNL
                     TRTVTPESFEDFIELVIPQLQQRGRYKTAYTEGTLREKLFQADRPHLPADHPGSAYRF
                     TPAPTGALHHA"
     misc_feature    complement(293785..295056)
                     /gene="soxA"
                     /locus_tag="PPUBIRD1_0245"
                     /note="FMN-dependent oxidoreductase, nitrilotriacetate
                     monooxygenase family; Region: FMN_nitrolo; TIGR03860"
                     /db_xref="CDD:234375"
     gene            complement(295074..296255)
                     /gene="soxC"
                     /locus_tag="PPUBIRD1_0246"
                     /db_xref="GeneID:12518482"
     CDS             complement(295074..296255)
                     /gene="soxC"
                     /locus_tag="PPUBIRD1_0246"
                     /note="Dibenzothiophene desulfurization enzyme C"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxC"
                     /protein_id="YP_005928157.1"
                     /db_xref="GI:386009880"
                     /db_xref="GeneID:12518482"
                     /translation="MTIAIITSDAQALAVAEDIAQQLRRDSALRDRERRLPLAELELF
                     TRSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSP
                     EQQQRLYAEVLAGRRFGNALAELGTKTAHERTTRLSRDGDGFRINGRKFYSTGAIYAQ
                     RIPTSVVDEQGIQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVP
                     FQSVFERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPL
                     TLKSFGHLAVRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLT
                     AGTTLFELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAVGNYYLNDANPPRRGT
                     I"
     misc_feature    complement(295077..296243)
                     /gene="soxC"
                     /locus_tag="PPUBIRD1_0246"
                     /note="sulfur acquisition oxidoreductase, SfnB family;
                     Region: sulfur_SfnB; TIGR04022"
                     /db_xref="CDD:188537"
     misc_feature    complement(295095..296216)
                     /gene="soxC"
                     /locus_tag="PPUBIRD1_0246"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(295128..295130,295134..295136,
                     295140..295148,295794..295796,295800..295802,
                     295890..295892,295896..295898,295983..295985))
                     /gene="soxC"
                     /locus_tag="PPUBIRD1_0246"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(296398..297639)
                     /gene="soxC_2"
                     /locus_tag="PPUBIRD1_0247"
                     /db_xref="GeneID:12518483"
     CDS             complement(296398..297639)
                     /gene="soxC_2"
                     /locus_tag="PPUBIRD1_0247"
                     /note="Dibenzothiophene desulfurization enzyme C"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxC_2"
                     /protein_id="YP_005928158.1"
                     /db_xref="GI:386009881"
                     /db_xref="GeneID:12518483"
                     /translation="MPSQANTQFHSDLDSSPPLLPAKVLRNDAEALQAARELAKVARE
                     QAARRDQQRKLPWAEIELFTRSGLGSISVPKAYGGPDVSFATVAEVFRLISAADPALG
                     QIPQNQFGMLQLLRLTASEAQQALIFRSVLDGWRIGNAGPERGTRDTLTLKARITRAG
                     DSYRISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGSPGLRIVDDWSGFGQRTT
                     ASGTVLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVR
                     EKSRPWIEANVERASDDPYVIADIGRLKLELHAAEALLRKAARVLDEVNAAPIDADAA
                     ARASIAVAEAKVLTTEIALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRW
                     KYHAVGAYHLNGTLPARHSWI"
     misc_feature    complement(296401..297576)
                     /gene="soxC_2"
                     /locus_tag="PPUBIRD1_0247"
                     /note="sulfur acquisition oxidoreductase, SfnB family;
                     Region: sulfur_SfnB; TIGR04022"
                     /db_xref="CDD:188537"
     misc_feature    complement(296419..297543)
                     /gene="soxC_2"
                     /locus_tag="PPUBIRD1_0247"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    complement(order(296452..296454,296458..296460,
                     296464..296472,297121..297123,297127..297129,
                     297217..297219,297223..297225,297310..297312))
                     /gene="soxC_2"
                     /locus_tag="PPUBIRD1_0247"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(297953..298711)
                     /locus_tag="PPUBIRD1_0249"
                     /db_xref="GeneID:12518484"
     CDS             complement(297953..298711)
                     /locus_tag="PPUBIRD1_0249"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative amino-acid ABC transporter ATP-binding
                     protein"
                     /protein_id="YP_005928159.1"
                     /db_xref="GI:386009882"
                     /db_xref="GeneID:12518484"
                     /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFL
                     RCLNLLETPDAGQIQIGAISIDANRPLGGQQGAIRRLRQQAGFVFQNFNLFPHRTALE
                     NVIEGPVIVKKTPREQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAME
                     PEVILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKG
                     VIVEQGEAKALFAAPKEERTRQFLRKFLGTAASE"
     misc_feature    complement(297968..298711)
                     /locus_tag="PPUBIRD1_0249"
                     /note="putative amino-acid ABC transporter ATP-binding
                     protein YecC; Provisional; Region: PRK11264"
                     /db_xref="CDD:183063"
     misc_feature    complement(298052..298708)
                     /locus_tag="PPUBIRD1_0249"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(298589..298612)
                     /locus_tag="PPUBIRD1_0249"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(298112..298114,298208..298213,
                     298442..298444,298586..298594,298598..298603))
                     /locus_tag="PPUBIRD1_0249"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(298442..298453)
                     /locus_tag="PPUBIRD1_0249"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(298256..298285)
                     /locus_tag="PPUBIRD1_0249"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(298208..298225)
                     /locus_tag="PPUBIRD1_0249"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(298190..298201)
                     /locus_tag="PPUBIRD1_0249"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(298106..298126)
                     /locus_tag="PPUBIRD1_0249"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(298714..299382)
                     /locus_tag="PPUBIRD1_0250"
                     /db_xref="GeneID:12518485"
     CDS             complement(298714..299382)
                     /locus_tag="PPUBIRD1_0250"
                     /codon_start=1
                     /transl_table=11
                     /product="Polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_005928160.1"
                     /db_xref="GI:386009883"
                     /db_xref="GeneID:12518485"
                     /translation="MIAESLQLVVDSAPFLLKGAGYTVLLSVGGMFFGLVLGFALALM
                     RLSKILPLNWLARVYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAA
                     YICEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKD
                     TALAATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQH
                     DQEH"
     misc_feature    complement(298720..299379)
                     /locus_tag="PPUBIRD1_0250"
                     /note="amino acid ABC transporter permease; Provisional;
                     Region: PRK15100"
                     /db_xref="CDD:185055"
     misc_feature    complement(298771..299325)
                     /locus_tag="PPUBIRD1_0250"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298777..298782,298789..298794,
                     298798..298803,298810..298815,298843..298848,
                     298885..298890,298897..298908,298927..298929,
                     298936..298941,298981..298983,299032..299034,
                     299041..299046,299056..299058,299062..299067,
                     299074..299076,299080..299082,299086..299091,
                     299155..299157,299161..299166,299173..299202,
                     299206..299217,299245..299247,299260..299265,
                     299272..299277))
                     /locus_tag="PPUBIRD1_0250"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298891..298908,299155..299199))
                     /locus_tag="PPUBIRD1_0250"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298813..298815,298843..298845,
                     298852..298854,298888..298890,299104..299106,
                     299155..299157))
                     /locus_tag="PPUBIRD1_0250"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298960..298962,298972..298977,
                     298993..299031))
                     /locus_tag="PPUBIRD1_0250"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(299379..300173)
                     /locus_tag="PPUBIRD1_0251"
                     /db_xref="GeneID:12518486"
     CDS             complement(299379..300173)
                     /locus_tag="PPUBIRD1_0251"
                     /codon_start=1
                     /transl_table=11
                     /product="Cystine transporter subunit"
                     /protein_id="YP_005928161.1"
                     /db_xref="GI:386009884"
                     /db_xref="GeneID:12518486"
                     /translation="MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGL
                     EGTYPPFSFQDENGKLTGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVV
                     NQVTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYE
                     QWVKKDVPQADVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTQLAGDAFS
                     RLESGVAMRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
     misc_feature    complement(299382..300104)
                     /locus_tag="PPUBIRD1_0251"
                     /note="cystine transporter subunit; Provisional; Region:
                     PRK11260"
                     /db_xref="CDD:183061"
     misc_feature    complement(299400..300056)
                     /locus_tag="PPUBIRD1_0251"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(299586..299588,299700..299702,
                     299841..299843,299916..299918,300030..300032))
                     /locus_tag="PPUBIRD1_0251"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(299607..299609,299625..299627,
                     299637..299639))
                     /locus_tag="PPUBIRD1_0251"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(299505..299519)
                     /locus_tag="PPUBIRD1_0251"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            300483..301415
                     /locus_tag="PPUBIRD1_0252"
                     /db_xref="GeneID:12518487"
     CDS             300483..301415
                     /locus_tag="PPUBIRD1_0252"
                     /EC_number="2.3.1.30"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine O-acetyltransferase"
                     /protein_id="YP_005928162.1"
                     /db_xref="GI:386009885"
                     /db_xref="GeneID:12518487"
                     /translation="MSEQPSSAHWQLQSIVTGLRGAREQWRTRNGRSIGEQGGRELPS
                     REAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLAQARLELRYAAR
                     QSKAELAGVDARALSLIQGFAAALPELRVLLDTDVLAAYHGDPAARSVDEVLLCYPGI
                     LAIIHHRLAHHLYKAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGE
                     TAIIGERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIG
                     KGSTIGGNVWLTRSVPAESNITQANLQLDCQDKN"
     misc_feature    300888..301376
                     /locus_tag="PPUBIRD1_0252"
                     /note="serine O-acetyltransferase; Region: cysE;
                     TIGR01172"
                     /db_xref="CDD:200082"
     misc_feature    301056..301367
                     /locus_tag="PPUBIRD1_0252"
                     /note="Serine acetyltransferase (SAT): SAT catalyzes the
                     CoA-dependent acetylation of the side chain hydroxyl group
                     of L-serine to form O-acetylserine, as the first step of a
                     two-step biosynthetic pathway in bacteria and plants
                     leading to the formation of...; Region: LbH_SAT; cd03354"
                     /db_xref="CDD:100045"
     misc_feature    order(301059..301061,301065..301067,301110..301112,
                     301239..301241,301329..301331,301338..301340,
                     301344..301346)
                     /locus_tag="PPUBIRD1_0252"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100045"
     misc_feature    order(301107..301112,301167..301172,301188..301193,
                     301239..301244,301275..301277,301320..301322,
                     301326..301331,301338..301340,301344..301346)
                     /locus_tag="PPUBIRD1_0252"
                     /note="active site"
                     /db_xref="CDD:100045"
     misc_feature    order(301107..301112,301188..301190,301239..301244)
                     /locus_tag="PPUBIRD1_0252"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100045"
     misc_feature    order(301167..301172,301188..301193,301275..301277,
                     301320..301322,301326..301331,301338..301340,
                     301344..301346)
                     /locus_tag="PPUBIRD1_0252"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100045"
     gene            301686..303542
                     /locus_tag="PPUBIRD1_0254"
                     /db_xref="GeneID:12518488"
     CDS             301686..303542
                     /locus_tag="PPUBIRD1_0254"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline/carnitine/betaine transporter"
                     /protein_id="YP_005928163.1"
                     /db_xref="GI:386009886"
                     /db_xref="GeneID:12518488"
                     /translation="MSAPNPSAANGKIRMNPPVFYFAASFILIFGLVVISNPQAAGDW
                     LLAAQNWAAKTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGML
                     FAAGISITLFFFCVSEPLTHMLQPPQGEAGTVEAGRQAMQILFLHWGLHGWGVFAFVG
                     MALAYFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLH
                     LNAGLDYLFGISHSQWVQVILITLMMGAAVAVAVAGVEKGVRVMSDINLFLACALLLF
                     VLFAGPTQHLFNTLIQNLGDYLGALPRKSFDVYAYGENRGWLGGWTVFYWAWWIAWAP
                     FVGLFIARISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSALDQVINHGMTALGQSAL
                     DNPSMSLYLLLETYPWSKAVIATTVFISFVFFVTSADSGTVVLSTLSAKGGDADEDGP
                     NWLRIFWGAMTALITSALLFAGSIDSLKSAVVLTSLPFSLILLCMMWGLHKAFYLESQ
                     RQIAQMHSLAPFAQSRRGRGGWRQRLSQAVHFPSRDEVYRFMDDVVRPAIADVREVFE
                     QKGLVLITQDDPSHDNVSLKIGHGEEQPFIYQVQMRGYFTPSFALGGWVRRS"
     misc_feature    301686..303518
                     /locus_tag="PPUBIRD1_0254"
                     /note="BCCT family transporter; Region: BCCT; cl00569"
                     /db_xref="CDD:260506"
     gene            303539..303688
                     /locus_tag="PPUBIRD1_0255"
                     /db_xref="GeneID:12518489"
     CDS             303539..303688
                     /locus_tag="PPUBIRD1_0255"
                     /codon_start=1
                     /transl_table=11
                     /product="Choline/carnitine/betaine transporter"
                     /protein_id="YP_005928164.1"
                     /db_xref="GI:386009887"
                     /db_xref="GeneID:12518489"
                     /translation="MKNRRYYRAEVHLSEGSQNYDLVGYSKEQIINDILDQYERHMQY
                     LHLVR"
     misc_feature    <303551..303685
                     /locus_tag="PPUBIRD1_0255"
                     /note="BCCT family transporter; Region: BCCT; cl00569"
                     /db_xref="CDD:260506"
     gene            complement(303813..304646)
                     /gene="tauD"
                     /locus_tag="PPUBIRD1_0256"
                     /db_xref="GeneID:12518490"
     CDS             complement(303813..304646)
                     /gene="tauD"
                     /locus_tag="PPUBIRD1_0256"
                     /EC_number="1.14.11.17"
                     /note="taurine dioxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="TauD"
                     /protein_id="YP_005928165.1"
                     /db_xref="GI:386009888"
                     /db_xref="GeneID:12518490"
                     /translation="MSLTITPLSPALGAQISGVDLSRDISAEERDAIEQALLQHQVLF
                     LRDQPINPEQQARFAARFGDLHIHPIYPNVPDTPQVLVLDTAVTDVRDNAVWHTDVTF
                     LPTPALGAVLSAKQLPAYGGDTLWASGIAAFEALSAPLREMLDGLTATHDFTKSFPLE
                     RFGTTPQDLARWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDA
                     LLRLLFAHATRPEFSIRWRWQEHDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAP
                     F"
     misc_feature    complement(303816..304646)
                     /gene="tauD"
                     /locus_tag="PPUBIRD1_0256"
                     /note="Probable taurine catabolism dioxygenase [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: TauD; COG2175"
                     /db_xref="CDD:225086"
     misc_feature    complement(303816..304646)
                     /gene="tauD"
                     /locus_tag="PPUBIRD1_0256"
                     /note="taurine dioxygenase; Reviewed; Region: tauD;
                     PRK09553"
                     /db_xref="CDD:181947"
     gene            complement(304695..305534)
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /db_xref="GeneID:12518491"
     CDS             complement(304695..305534)
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="Taurine transport system permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TauC"
                     /protein_id="YP_005928166.1"
                     /db_xref="GI:386009889"
                     /db_xref="GeneID:12518491"
                     /translation="MSSLDLPVAGKHDAQTRPAATLRRPLSTRWISTLTLASLLLVWW
                     LVTAAGWVEPLFLPSPGDILSKAWTLLTQGYMDASLWQHLGASLGRIGLALVAATLTA
                     IPVGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAP
                     IAIATATGVRTVDPAKLRAAQSLGATKAQLIRHVILPSALPDILTGIRIGLGVGWSTL
                     VAAELIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHG
                     QIH"
     misc_feature    complement(304707..305483)
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(304764..305285)
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(304770..304775,304782..304787,
                     304791..304796,304803..304808,304836..304841,
                     304866..304871,304878..304889,304908..304910,
                     304917..304922,304962..304964,305013..305015,
                     305022..305027,305037..305039,305043..305048,
                     305055..305057,305061..305063,305067..305072,
                     305118..305120,305124..305129,305136..305165,
                     305169..305180,305205..305207,305220..305225,
                     305232..305237))
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(304872..304889,305118..305162))
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(304806..304808,304836..304838,
                     304845..304847,304869..304871,305085..305087,
                     305118..305120))
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(304941..304943,304953..304958,
                     304974..305012))
                     /gene="tauC"
                     /locus_tag="PPUBIRD1_0257"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /db_xref="GeneID:12518492"
     CDS             complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /EC_number="3.6.3.36"
                     /note="Taurine import ATP-binding protein tauB"
                     /codon_start=1
                     /transl_table=11
                     /product="TauB"
                     /protein_id="YP_005928167.1"
                     /db_xref="GI:386009890"
                     /db_xref="GeneID:12518492"
                     /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGK
                     TSLLNLIAGFVAPSGGHITLDGVPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELA
                     GVPRAQREAKAREMLTLVDLNGFGERRIWQLSGGQKQRVGLARALAADPRLLLMDEPF
                     GALDAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQ
                     LNFGQRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQERA"
     misc_feature    complement(305543..306313)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="taurine transporter ATP-binding subunit;
                     Provisional; Region: tauB; PRK11248"
                     /db_xref="CDD:183056"
     misc_feature    complement(305657..306310)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(306185..306208)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(305747..305749,305846..305851,
                     306077..306079,306182..306190,306194..306199))
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(306077..306088)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(305894..305923)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(305846..305863)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(305828..305839)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(305741..305761)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_0258"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /db_xref="GeneID:12518493"
     CDS             complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="taurine ABC transporter, periplasmic binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TauA"
                     /protein_id="YP_005928168.1"
                     /db_xref="GI:386009891"
                     /db_xref="GeneID:12518493"
                     /translation="MIPHAPLRLFAALTLASTSWLAQAADLTVAYQTTVDPAKVAQVD
                     GDYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIAT
                     QIGAGEALVARDSIKSPQDLIGKKVAVPFVSTGHYSLLAALKSWNIDPSKVQILNLAP
                     PAIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFAEK
                     HPDVVKAFAKVTLDAYADYRKDPKAWLADKGNVDKLVKLSGAKASDIPVLLEGNVYPL
                     AADQANALGAPTTQALTDTANFLKQQGKVEAVLPDYSPYVSAKFLPN"
     misc_feature    complement(306339..307286)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(306570..307160)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(306771..306773,306903..306905,
                     307041..307043,307116..307118))
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(306792..306794,306810..306812,
                     306822..306824))
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(306681..306698)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_0259"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            307779..309119
                     /locus_tag="PPUBIRD1_0260"
                     /db_xref="GeneID:12518494"
     CDS             307779..309119
                     /locus_tag="PPUBIRD1_0260"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane porin"
                     /protein_id="YP_005928169.1"
                     /db_xref="GI:386009892"
                     /db_xref="GeneID:12518494"
                     /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNR
                     EDHAKPGAERPDQRESGQGFKLDYISGFTQGTVGFGVDAQALWGIHLDGGEGYHKSGF
                     FPDDGKGSAAQWARFGANAKARFSKTEAHFGSALAPNLPILVSNDGRLLPQTFEGGTI
                     QSKEIDNLTINAGQLTHAMGRASSNRTGLSVAGSNAESNKFRYGGLDYKLTPDLTLQY
                     YYSNLEDFYKQHFLGATHVFKIADDQSFKTDLRYFDSSSDGKNGNDSAYNFNNNGGYA
                     KNTGEIDNKTWSAMFTYTLGGHALMLGHQQVGDDGGFVWLNQGSLSNDSGTSEGAGGS
                     SFYLFTDSMINQFARAGENTTFGQYSYDFAALGVPGLKASVAYLRGDDIRNKSGSGTY
                     NEWERDARIDYTLQEGALKGLGFSLRQGVYRGAGESSSDQDQARFIVNYTYSFL"
     misc_feature    307842..309113
                     /locus_tag="PPUBIRD1_0260"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            309285..309923
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /db_xref="GeneID:12518495"
     CDS             309285..309923
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="peroxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="LsfA"
                     /protein_id="YP_005928170.1"
                     /db_xref="GI:386009893"
                     /db_xref="GeneID:12518495"
                     /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPV
                     CTTELGLTAKLKDEFAKRGVKAIALSVDPVDSHHKWIDDINETQNTVVNFPIIADADR
                     KVSDLYDLIHPNASDTLTVRSLFIIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLT
                     DNHKVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
     misc_feature    309285..309860
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    309297..309908
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="Peroxiredoxin (PRX) family, 1-cys PRX subfamily;
                     composed of PRXs containing only one conserved cysteine,
                     which serves as the peroxidatic cysteine. They are
                     homodimeric thiol-specific antioxidant (TSA) proteins that
                     confer a protective role in cells by...; Region: PRX_1cys;
                     cd03016"
                     /db_xref="CDD:239314"
     misc_feature    order(309297..309299,309411..309413,309420..309428,
                     309435..309437,309531..309533,309540..309542,
                     309609..309611,309642..309644,309684..309692,
                     309696..309704,309708..309725,309729..309731,
                     309738..309740,309750..309755,309780..309785,
                     309789..309794,309891..309893,309900..309902)
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239314"
     misc_feature    order(309333..309335,309495..309503,309507..309512,
                     309516..309521,309525..309530,309555..309557,
                     309582..309587,309615..309617,309636..309641,
                     309828..309830,309885..309887)
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="decamer (pentamer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239314"
     misc_feature    order(309408..309410,309417..309419,309648..309650)
                     /gene="lsfA"
                     /locus_tag="PPUBIRD1_0261"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239314"
     gene            310143..310736
                     /gene="ssuE"
                     /locus_tag="PPUBIRD1_0262"
                     /db_xref="GeneID:12518496"
     CDS             310143..310736
                     /gene="ssuE"
                     /locus_tag="PPUBIRD1_0262"
                     /note="FMN reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="SsuE"
                     /protein_id="YP_005928171.1"
                     /db_xref="GI:386009894"
                     /db_xref="GeneID:12518496"
                     /translation="MLVVSIGGSPSLRSRSGVLLERSRQWLQDRGVEVVTFQVRDFPA
                     EDLLHARFDSPHVQHFQQLVAQADGLIVSTPVYKASFSGALKTLLDLLPERALAHKIV
                     LPIATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVAYAEGTKPAQLVQALE
                     ERLHDSLETFHVALARRPRPVAPGVLNERLISARWSI"
     misc_feature    310143..310721
                     /gene="ssuE"
                     /locus_tag="PPUBIRD1_0262"
                     /note="NAD(P)H-dependent FMN reductase; Provisional;
                     Region: PRK10569"
                     /db_xref="CDD:182557"
     gene            310822..311787
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /db_xref="GeneID:12518497"
     CDS             310822..311787
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="ABC-type transporter periplasmic sulfonate-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SsuA protein"
                     /protein_id="YP_005928172.1"
                     /db_xref="GI:386009895"
                     /db_xref="GeneID:12518497"
                     /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLL
                     KAKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLL
                     YVAYEPPAPHSEAILVPKGSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSD
                     IQPVYLPPADARAAFERGSVDAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLAT
                     RNYATQHPAVINTVIEEVRAVGEWSQANPQEVTDQVAPLLGLPADITLTSVKRQGYGA
                     APLTPDVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
     misc_feature    310912..311757
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    310975..311565
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(311023..311025,311107..311109,311245..311247,
                     311377..311379)
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(311326..311328,311338..311340,311356..311358)
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    311449..311466
                     /gene="ssuA"
                     /locus_tag="PPUBIRD1_0263"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            311847..312995
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /db_xref="GeneID:12518498"
     CDS             311847..312995
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /EC_number="1.14.14.5"
                     /note="Alkanesulfonate monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SsuD"
                     /protein_id="YP_005928173.1"
                     /db_xref="GI:386009896"
                     /db_xref="GeneID:12518498"
                     /translation="MSLNIFWFLPTHGDGKYLGTSEGARAVDHGYLQQIAQAADRLGF
                     GGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGR
                     ALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGA
                     KLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVRKKAAAQ
                     GREVRFGIRLHVIVRETNEAAWAAAERLISHLDDDTISRAQASLARFDSVGQQRMAAL
                     HGGNRDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGIDTFIFSGYPH
                     LEESYRVAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
     misc_feature    311853..312581
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /note="Alkanesulfonate monoxygenase is the monoxygenase of
                     a two-component system that catalyzes the conversion of
                     alkanesulfonates to the corresponding aldehyde and
                     sulfite. Alkanesulfonate monoxygenase (SsuD) has an
                     absolute requirement for reduced flavin...; Region:
                     Alkanesulfonate_monoxygenase; cd01094"
                     /db_xref="CDD:238527"
     misc_feature    order(311868..311870,311880..311882,312009..312011,
                     312168..312170,312228..312230,312384..312389,
                     312429..312431,312525..312527,312531..312533)
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /note="active site"
                     /db_xref="CDD:238527"
     misc_feature    order(312000..312017,312024..312026,312033..312038,
                     312045..312047,312096..312098,312102..312107,
                     312114..312119,312126..312128,312135..312137,
                     312186..312188,312195..312200,312312..312314,
                     312318..312329,312333..312338)
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238527"
     misc_feature    312075..312080
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /note="non-prolyl cis peptide bond; other site"
                     /db_xref="CDD:238527"
     misc_feature    order(312174..312200,312219..312227,312312..312353,
                     312534..312545,312564..312581)
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_0264"
                     /note="insertion regions; other site"
                     /db_xref="CDD:238527"
     gene            313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /db_xref="GeneID:12518499"
     CDS             313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="Aliphatic sulfonates transport permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SsuC"
                     /protein_id="YP_005928174.1"
                     /db_xref="GI:386009897"
                     /db_xref="GeneID:12518499"
                     /translation="MSRATSSNLTQRLAPWALPVLLLAIWQLAVSAGWLSTRILPAPS
                     AVVSAGVELVRSGEIWTHLAISGWRAGLGFVIGGSIGLVLGFITGLSNWGERLLDSSV
                     QMIRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMAR
                     SYGLSGFGLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNARE
                     FLQTDVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVARKEGA"
     misc_feature    313006..313779
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    313192..313719
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(313240..313245,313252..313257,313270..313272,
                     313297..313308,313312..313341,313348..313353,
                     313357..313359,313405..313410,313414..313416,
                     313420..313422,313429..313434,313438..313440,
                     313450..313455,313462..313464,313513..313515,
                     313555..313560,313567..313569,313588..313599,
                     313606..313611,313636..313641,313669..313674,
                     313681..313686,313690..313695,313702..313707,
                     313714..313719)
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(313315..313359,313588..313605)
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(313357..313359,313606..313608,313630..313632,
                     313639..313641,313669..313671)
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(313465..313503,313519..313524,313534..313536)
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_0265"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            313800..314612
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /db_xref="GeneID:12518500"
     CDS             313800..314612
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="Aliphatic sulfonates import ATP-binding protein
                     ssuB"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SsuB"
                     /protein_id="YP_005928175.1"
                     /db_xref="GI:386009898"
                     /db_xref="GeneID:12518500"
                     /translation="MTVLKEQPPRLLRGTPLASKGLRKTFGQREVLKGIDLHIPAGQF
                     VAIVGRSGCGKSTLLRLLAGLDQPSAGQLLAGAAPLEEAREETRLMFQDARLLPWKKV
                     IDNVGLGLSGDWRPRALEALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLL
                     LDEPLGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGL
                     DLTVDLARPRARGSHRLAALESEVLNRVLSTPGTAPEPDPVAPLPTQLRWAH"
     misc_feature    313812..314609
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="aliphatic sulfonates transport ATP-binding subunit;
                     Provisional; Region: ssuB; PRK11247"
                     /db_xref="CDD:183055"
     misc_feature    313857..314471
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    313944..313967
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(313953..313958,313962..313970,314073..314075,
                     314283..314288,314385..314387)
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    314064..314075
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    314211..314240
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    314271..314288
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    314295..314306
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    314373..314393
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_0266"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            314640..314855
                     /locus_tag="PPUBIRD1_0267"
                     /db_xref="GeneID:12518501"
     CDS             314640..314855
                     /locus_tag="PPUBIRD1_0267"
                     /codon_start=1
                     /transl_table=11
                     /product="TOBE domain-containing protein"
                     /protein_id="YP_005928176.1"
                     /db_xref="GI:386009899"
                     /db_xref="GeneID:12518501"
                     /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTR
                     SVRELELQVGSEVIAFVKSTEVSIAKL"
     misc_feature    314649..314852
                     /locus_tag="PPUBIRD1_0267"
                     /note="Molybdopterin-binding protein [Coenzyme
                     metabolism]; Region: MopI; COG3585"
                     /db_xref="CDD:226113"
     gene            complement(314998..315630)
                     /locus_tag="PPUBIRD1_0268"
                     /db_xref="GeneID:12518502"
     CDS             complement(314998..315630)
                     /locus_tag="PPUBIRD1_0268"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_005928177.1"
                     /db_xref="GI:386009900"
                     /db_xref="GeneID:12518502"
                     /translation="MNRTTTPRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAE
                     RAQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPIDSSAFSTWHELSRLIEQRM
                     LDIYHEDAAARQLILAQHGLSEVVQADRQHDMELGDLMHKLFDQHFHLPVMPPDVDVF
                     ALAMELSDRVYARSVQLHEAITPRMAEEGKRVFEAYLGLYLPPFLAKRSS"
     misc_feature    complement(315040..315618)
                     /locus_tag="PPUBIRD1_0268"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(315430..315570)
                     /locus_tag="PPUBIRD1_0268"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(315630..317207)
                     /gene="gshA"
                     /locus_tag="PPUBIRD1_0269"
                     /db_xref="GeneID:12518503"
     CDS             complement(315630..317207)
                     /gene="gshA"
                     /locus_tag="PPUBIRD1_0269"
                     /EC_number="6.3.2.2"
                     /note="Glutamate--cysteine ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="GshA"
                     /protein_id="YP_005928178.1"
                     /db_xref="GI:386009901"
                     /db_xref="GeneID:12518503"
                     /translation="MSELLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRLAQTPH
                     PEALGSALTNEQITTDYSESLLEFITPALADPAKVLESLEETHRFVYSKLGDEYLWSP
                     SMPCTLPAEEDIPIAEYGSSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSLPEALW
                     PLLREAEGSTENDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGRPHQLE
                     ELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYPPYVEI
                     GTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVRCLDIN
                     PFLPVGIDLTEARFLDAFLLFCALEDSPQLDNGECGQCTSNFLTVVKEGRRPGLELHR
                     NGQPISLKDWASELIERIRQLANLLDQAQGTDEHAKALDAQQAKVDDTSLTPSAQVLA
                     RMTEHDESFVQFSLRQSRVHAETFREQPLSNEKQQAFETLARESLARQSELEQDEVGD
                     FDLFVGAYQASILAISS"
     misc_feature    complement(315645..317204)
                     /gene="gshA"
                     /locus_tag="PPUBIRD1_0269"
                     /note="glutamate--cysteine ligase; Provisional; Region:
                     PRK02107"
                     /db_xref="CDD:235001"
     gene            complement(317361..317744)
                     /locus_tag="PPUBIRD1_0270"
                     /db_xref="GeneID:12518504"
     CDS             complement(317361..317744)
                     /locus_tag="PPUBIRD1_0270"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase superfamily protein"
                     /protein_id="YP_005928179.1"
                     /db_xref="GI:386009902"
                     /db_xref="GeneID:12518504"
                     /translation="MDVPREYVESAFSQLLGCRLQHLDSGVAEVALALEPQLRNRGQK
                     LHGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRR
                     TLVVDADVVQGDKLVAKAQGTFAVL"
     misc_feature    complement(317367..317702)
                     /locus_tag="PPUBIRD1_0270"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    complement(<317367..317621)
                     /locus_tag="PPUBIRD1_0270"
                     /note="Thioesterase-like superfamily; Region: 4HBT_3;
                     pfam13622"
                     /db_xref="CDD:257934"
     misc_feature    complement(order(317493..317504,317523..317525,
                     317610..317612))
                     /locus_tag="PPUBIRD1_0270"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(317502..317504,317508..317522,
                     317592..317594,317601..317603,317607..317609))
                     /locus_tag="PPUBIRD1_0270"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    complement(order(317523..317525,317565..317570,
                     317577..317582,317604..317606))
                     /locus_tag="PPUBIRD1_0270"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            complement(317744..320068)
                     /locus_tag="PPUBIRD1_0271"
                     /db_xref="GeneID:12518505"
     CDS             complement(317744..320068)
                     /locus_tag="PPUBIRD1_0271"
                     /codon_start=1
                     /transl_table=11
                     /product="S1 RNA-binding domain-containing protein"
                     /protein_id="YP_005928180.1"
                     /db_xref="GI:386009903"
                     /db_xref="GeneID:12518505"
                     /translation="MDSINSRIAEELGVRPQQVEAAVSLLDEGSTVPFIARYRKEVTG
                     SLDDTQLRHLEERLRYLRELDERRASILSSIEEQGKLTPELAREIKLADTKTRLEDLY
                     LPYKQKRRTKGQIALEAGLGELADGLFNDPTLAPESEAARFVNAEKGVADVKAALEGA
                     KYILMERFAEDAALLDKLRSYLKQEAVLSARVVAGKEEEGAKFRDYFAHDELLRTAPS
                     HRALAIFRGRNEGVLSVSLKVGEELPGTLHPCELMIGNHVGIENRSRPADKWLGEVVR
                     WTWKVKLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRT
                     GCKIAVVDATGKLLDHTTVYPHAPKNDWDRTISIMAALCAKHSVELIAIGNGTASRES
                     DKLVAELVKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQD
                     PLAELVKIDPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRIS
                     GLNATLAQNIVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAV
                     HPEAYPLVQRIAADTDRDIRSLIGDSSFLKRLDPKKFTDETFGLPTVTDILQELDKPG
                     RDPRPEFKTATFQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALS
                     EKFVKDPREAVKAGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVEGNRGGNRGNGGN
                     RQPQAPRQRETATAAPANNAMASLFANAKQLKKK"
     misc_feature    complement(317753..320068)
                     /locus_tag="PPUBIRD1_0271"
                     /note="Transcriptional accessory protein [Transcription];
                     Region: Tex; COG2183"
                     /db_xref="CDD:225094"
     misc_feature    complement(319469..320047)
                     /locus_tag="PPUBIRD1_0271"
                     /note="Tex-like protein N-terminal domain; Region: Tex_N;
                     pfam09371"
                     /db_xref="CDD:255322"
     misc_feature    complement(318803..319102)
                     /locus_tag="PPUBIRD1_0271"
                     /note="Likely ribonuclease with RNase H fold; Region:
                     YqgFc; smart00732"
                     /db_xref="CDD:128971"
     misc_feature    complement(318707..>318838)
                     /locus_tag="PPUBIRD1_0271"
                     /note="Uncharacterized protein family (UPF0081); Region:
                     UPF0081; cl17278"
                     /db_xref="CDD:266606"
     misc_feature    complement(318410..318604)
                     /locus_tag="PPUBIRD1_0271"
                     /note="Helix-hairpin-helix motif; Region: HHH_3;
                     pfam12836"
                     /db_xref="CDD:257337"
     misc_feature    complement(317921..318124)
                     /locus_tag="PPUBIRD1_0271"
                     /note="S1_Tex: The C-terminal S1 domain of a transcription
                     accessory factor called Tex, which has been characterized
                     in Bordetella pertussis and Pseudomonas aeruginosa. The
                     tex gene is essential in Bortella pertusis and is named
                     for its role in toxin expression; Region: S1_Tex; cd05685"
                     /db_xref="CDD:240190"
     misc_feature    complement(order(318038..318040,318044..318046,
                     318074..318076,318098..318100))
                     /locus_tag="PPUBIRD1_0271"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240190"
     gene            320286..321026
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /db_xref="GeneID:12518506"
     CDS             320286..321026
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="osmolarity response regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="OmpR"
                     /protein_id="YP_005928181.1"
                     /db_xref="GI:386009904"
                     /db_xref="GeneID:12518506"
                     /translation="MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTE
                     QMDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLE
                     LGADDYLGKPFNPDELMARVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKR
                     GDEVHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMI
                     EPDPSKPRYIQTVWGVGYVFVPDGNAGK"
     misc_feature    320301..321017
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="osmolarity response regulator; Provisional; Region:
                     ompR; PRK09468"
                     /db_xref="CDD:181883"
     misc_feature    320325..320663
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(320334..320339,320466..320468,320490..320492,
                     320550..320552,320607..320609,320616..320621)
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    320466..320468
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(320475..320480,320484..320492)
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    320616..320624
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    320715..320999
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(320787..320789,320844..320849,320901..320903,
                     320910..320912,320934..320939,320973..320975,
                     320988..320990)
                     /gene="ompR"
                     /locus_tag="PPUBIRD1_0273"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            321040..322353
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /db_xref="GeneID:12518507"
     CDS             321040..322353
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /EC_number="2.7.13.3"
                     /note="integral membrane sensor signal transduction
                     histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="EnvZ protein"
                     /protein_id="YP_005928182.1"
                     /db_xref="GI:386009905"
                     /db_xref="GeneID:12518507"
                     /translation="MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDR
                     QYSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAE
                     LGDDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLST
                     ASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQA
                     GRERELMLAGVSHDLRTPLTRLRLSLSLLNSDNELSDDMVRDIEDMDAILDQFLAFIR
                     DGRDEPVEEVDLADLVREVVAPYNQPVERVRLCLEPIPPFPLRRVSLKRMLGNLIGNA
                     LHHAGKGVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGT
                     GLGLAIVKRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
     misc_feature    321058..322311
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="osmolarity sensor protein; Provisional; Region:
                     envZ; PRK09467"
                     /db_xref="CDD:236531"
     misc_feature    321547..321690
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(321547..321552,321559..321564,321568..321573,
                     321580..321585,321589..321591,321637..321642,
                     321646..321651,321658..321663,321667..321672,
                     321679..321684)
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    321697..321867
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(321712..321714,321724..321726,321736..321738,
                     321745..321747,321796..321798,321808..321810,
                     321817..321819,321829..321831,321838..321840,
                     321850..321852)
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    321730..321732
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    322006..322311
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(322024..322026,322036..322038,322045..322047,
                     322120..322122,322126..322128,322132..322134,
                     322138..322143,322216..322227,322273..322275,
                     322279..322281,322294..322299,322303..322305)
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    322036..322038
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(322132..322134,322138..322140,322216..322218,
                     322222..322224)
                     /gene="envZ"
                     /locus_tag="PPUBIRD1_0274"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(322451..323356)
                     /gene="rimK"
                     /locus_tag="PPUBIRD1_0275"
                     /db_xref="GeneID:12518508"
     CDS             complement(322451..323356)
                     /gene="rimK"
                     /locus_tag="PPUBIRD1_0275"
                     /note="Ribosomal protein S6 modification protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RimK protein"
                     /protein_id="YP_005928183.1"
                     /db_xref="GI:386009906"
                     /db_xref="GeneID:12518508"
                     /translation="MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIASH
                     KPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLR
                     SLQLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETPQAA
                     ESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGG
                     VASLIKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGK
                     NVAGMIIEHLEKNGGPNQTRTKGKG"
     misc_feature    complement(322460..323356)
                     /gene="rimK"
                     /locus_tag="PPUBIRD1_0275"
                     /note="ribosomal protein S6 modification protein;
                     Provisional; Region: PRK10446"
                     /db_xref="CDD:182468"
     misc_feature    complement(322499..323068)
                     /gene="rimK"
                     /locus_tag="PPUBIRD1_0275"
                     /note="RimK-like ATP-grasp domain; Region: RimK;
                     pfam08443"
                     /db_xref="CDD:117020"
     gene            complement(323353..323835)
                     /locus_tag="PPUBIRD1_0276"
                     /db_xref="GeneID:12518509"
     CDS             complement(323353..323835)
                     /locus_tag="PPUBIRD1_0276"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928184.1"
                     /db_xref="GI:386009907"
                     /db_xref="GeneID:12518509"
                     /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEV
                     EPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSSNGHAQTRYVIRTSLALG
                     DGVWEVEFTLACRKNMRYRLLLGSKALIHGQLVVNPGLKYVQDKPAFPATLSPVTGAA
                     "
     misc_feature    complement(323398..323832)
                     /locus_tag="PPUBIRD1_0276"
                     /note="Uncharacterized protein conserved in archaea
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG4067"
                     /db_xref="CDD:226553"
     gene            323945..324346
                     /gene="hslR"
                     /locus_tag="PPUBIRD1_0277"
                     /db_xref="GeneID:12518510"
     CDS             323945..324346
                     /gene="hslR"
                     /locus_tag="PPUBIRD1_0277"
                     /note="RNA-binding S4 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HslR"
                     /protein_id="YP_005928185.1"
                     /db_xref="GI:386009908"
                     /db_xref="GeneID:12518510"
                     /translation="MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGER
                     CKPGKEPRVGDEFLLRTGFDERTVVVKALSVVRRGAPEAQALYEETEESVRRREQAAE
                     MRKAGAMGVTTDGRPTKKQRRQIHQLHGSYD"
     misc_feature    323975..324175
                     /gene="hslR"
                     /locus_tag="PPUBIRD1_0277"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    order(323978..323980,324014..324019,324023..324028,
                     324032..324037,324044..324049,324053..324055,
                     324074..324079,324080..324094,324098..324100)
                     /gene="hslR"
                     /locus_tag="PPUBIRD1_0277"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     gene            complement(324374..325168)
                     /locus_tag="PPUBIRD1_0278"
                     /db_xref="GeneID:12518511"
     CDS             complement(324374..325168)
                     /locus_tag="PPUBIRD1_0278"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphoesterase, PA-phosphatase related protein"
                     /protein_id="YP_005928186.1"
                     /db_xref="GI:386009909"
                     /db_xref="GeneID:12518511"
                     /translation="MDNRPLFQARWSWGPLAACTLLPIALLCFWIWPFGQILCLTFDE
                     WLFRSLNAPLADSTTWRYIWTIGSLRPFDIVVGLILLAVLIRGDWVFKATQVRQAFFG
                     FLVTLLLLVVIRALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEAAWELKDRSSK
                     SFPGDHASVLLIWALFMSVFSRGLAQYLVVWGLAALFMLPRLVAGAHWGQDDYIGGLL
                     MAVLALGWSYYTPLAAKGSEALMRWTAPLFKLLSTLPLVGRMAVLR"
     misc_feature    complement(324416..325099)
                     /locus_tag="PPUBIRD1_0278"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    complement(324491..>324718)
                     /locus_tag="PPUBIRD1_0278"
                     /note="PAP2_like proteins, a super-family of histidine
                     phosphatases and vanadium haloperoxidases, includes type 2
                     phosphatidic acid phosphatase or lipid phosphate
                     phosphatase (LPP), Glucose-6-phosphatase,
                     Phosphatidylglycerophosphatase B and bacterial acid...;
                     Region: PAP2_like; cd01610"
                     /db_xref="CDD:238813"
     misc_feature    complement(order(324536..324538,324548..324550,
                     324566..324568,324671..324679))
                     /locus_tag="PPUBIRD1_0278"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            325289..326188
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /db_xref="GeneID:12518512"
     CDS             325289..326188
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="33 kDa chaperonin"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HslO"
                     /protein_id="YP_005928187.1"
                     /db_xref="GI:386009910"
                     /db_xref="GeneID:12518512"
                     /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPV
                     KVLLGELMAATALLVGAMKFDGLLILQARSAGPIPLLMVECSSEREIRGMARYEADQI
                     PAGATLSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWL
                     NAAGGKARGLLLQQLPRDRQPDDEEREDSWQHVVALAKTLKPEEWTEGNETLLHRLYH
                     EDAVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDECGGTVEIDCQFCNERYF
                     FDASDVAQLFAGGGTDVASETRH"
     misc_feature    325304..326158
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="Hsp33-like chaperonin; Reviewed; Region: hslO;
                     PRK00114"
                     /db_xref="CDD:234643"
     misc_feature    325319..326122
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="Heat shock protein 33 (Hsp33):  Cytosolic protein
                     that acts as a molecular chaperone under oxidative
                     conditions.  In normal (reducing) cytosolic conditions,
                     four conserved Cys residues are coordinated by a Zn ion.
                     Under oxidative stress (such as heat...; Region: Hsp33;
                     cd00498"
                     /db_xref="CDD:238278"
     misc_feature    order(325349..325351,325727..325729,325739..325747,
                     325805..325807,325988..325990)
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238278"
     misc_feature    order(325349..325351,325787..325789,325793..325795,
                     325805..325816)
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="domain crossover interface; other site"
                     /db_xref="CDD:238278"
     misc_feature    order(325988..325990,325994..325996,326090..326092,
                     326099..326101)
                     /gene="hslO"
                     /locus_tag="PPUBIRD1_0279"
                     /note="redox-dependent activation switch; other site"
                     /db_xref="CDD:238278"
     gene            326368..327909
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /db_xref="GeneID:12518513"
     CDS             326368..327909
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /EC_number="4.1.1.49"
                     /note="Phosphoenolpyruvate carboxykinase [ATP]"
                     /codon_start=1
                     /transl_table=11
                     /product="PckA"
                     /protein_id="YP_005928188.1"
                     /db_xref="GI:386009911"
                     /db_xref="GeneID:12518513"
                     /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTG
                     RSPADRFIVEEPSTQDAIAWGPINRKFPADKFDALWDRVEAFNNAQDHFVSYVHVGAA
                     AEHYLPVKMTTQTAWQNLFGRCLFINPEQYNPAGRGEWQVLNVANFVCEPERDGTNSD
                     GCVIINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLF
                     FGLSGTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAI
                     KHGAVLENVVLDANKHADYSDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCD
                     LTGVLPPVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGE
                     YAELLIKRINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEH
                     LDIINLDVPKAVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKA
                     AGPQL"
     misc_feature    326368..327906
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /note="phosphoenolpyruvate carboxykinase; Provisional;
                     Region: PRK09344"
                     /db_xref="CDD:236471"
     misc_feature    order(326977..326979,327031..327051,327085..327090,
                     327139..327141,327145..327147,327604..327606,
                     327658..327660)
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /note="active site"
                     /db_xref="CDD:238418"
     misc_feature    order(326977..326979,327046..327048,327085..327090,
                     327139..327141)
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238418"
     misc_feature    order(327031..327036,327040..327051,327604..327606,
                     327658..327660)
                     /gene="pckA"
                     /locus_tag="PPUBIRD1_0280"
                     /note="nucleotide-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238418"
     gene            328191..328631
                     /locus_tag="PPUBIRD1_0281"
                     /db_xref="GeneID:12518514"
     CDS             328191..328631
                     /locus_tag="PPUBIRD1_0281"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioesterase superfamily protein"
                     /protein_id="YP_005928189.1"
                     /db_xref="GI:386009912"
                     /db_xref="GeneID:12518514"
                     /translation="MTEALQRIAFSHFHPILTRPQDNDLNGHIAGATVHSFFETAIQA
                     FLVEQAELDLRHGELAAFVVSSAADFYALPGFPDLLEVGLGVTRLAGSTVEYRLALYR
                     PGEPEACAAGTVVQVFIERDSGRPVALPEALQVILSGLVLERQA"
     misc_feature    328224..328547
                     /locus_tag="PPUBIRD1_0281"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    order(328305..328307,328371..328373,328377..328379,
                     328458..328469)
                     /locus_tag="PPUBIRD1_0281"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(328688..329170)
                     /locus_tag="PPUBIRD1_0282"
                     /db_xref="GeneID:12518515"
     CDS             complement(328688..329170)
                     /locus_tag="PPUBIRD1_0282"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928190.1"
                     /db_xref="GI:386009913"
                     /db_xref="GeneID:12518515"
                     /translation="MKKYSSILLLSFSLLSGVAMAGGTTEAGIGGALGGVLGSVVGNS
                     IGGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIG
                     AAAGGGAGGALGNYLGKEADKDDYRDGRRYRRGYDDDRRHWDRGHHYGHRKHKRHWRD
                     "
     gene            complement(329367..331613)
                     /locus_tag="PPUBIRD1_0283"
                     /db_xref="GeneID:12518516"
     CDS             complement(329367..331613)
                     /locus_tag="PPUBIRD1_0283"
                     /codon_start=1
                     /transl_table=11
                     /product="Molybdopterin oxidoreductase, alpha subunit"
                     /protein_id="YP_005928191.1"
                     /db_xref="GI:386009914"
                     /db_xref="GeneID:12518516"
                     /translation="MAKAWAGSDNALKNIRALLKTNQNGGFDCPGCAWGDSPESGMVK
                     FCENGAKAVNWEATKRRVDAAFFARYSVTSLLQQSDYWLEYQGRLTEPMVYDAPSDRY
                     LPISWDAAFALIARELNKLANPDQAEFYTSGRASNEAAYLYQLFVRAYGTNNFPDCSN
                     MCHEASGVALGQSVGVGKGTVTFDDFEHADAIFVWGQNPGTNHPRMLDPLRDAVKRGA
                     QVVCINPLKERGLERFQHPQNPLEMLTNSDRPTNTAFFRPALGGDMAMLRGMAKFVLQ
                     WEREAQANGEPAVFDHAFIAEHGHGVDEYLAVVDATPWSHIQAQSGLSLADIELAARM
                     YCRGKRVIMCWAMGITQHRHSVPTIQEIVNLQMLRGNIGVPGAGLCPVRGHSNVQGDR
                     TMGINERPPEALLDAIEKRFGFPVPRRNGHNTVEAIHAMLDGRAKVFIGLGGNFAQAT
                     PDTERTAQALRNCELTVHISTKLNRSHLVHGKQALILPCLGRTDIDLQAEGPQAVTVE
                     DSFSMVHASNGQLKPLSTQMRSEPAVIAGIAAATLGKQPVDWHWLVADYDRIRDLIGD
                     TIAGFSGFNQRLRHPGGFYLGNSAASREWATSTGRANFKANLLPDTLLDERVRASGQL
                     PDLIMQSMRSHDQYNTTIYGLDDRYRGVRGQREVLFANEADIIRLGFQPGQKVDIVSL
                     WGDEHVRRVQGFTLLAFDIPAGQAAAYYPEVNPLVPLESIGVGSHTPTSKFIAIKLER
                     ASEDRRIL"
     misc_feature    complement(329394..331583)
                     /locus_tag="PPUBIRD1_0283"
                     /note="oxidoreductase alpha (molybdopterin) subunit;
                     Region: Fdhalpha-like; TIGR01701"
                     /db_xref="CDD:233538"
     misc_feature    complement(329802..331538)
                     /locus_tag="PPUBIRD1_0283"
                     /note="The MopB_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. These members belong to the
                     molybdopterin_binding (MopB) superfamily of proteins;
                     Region: MopB_ydeP; cd02767"
                     /db_xref="CDD:239168"
     misc_feature    complement(order(330087..330089,330144..330149,
                     330192..330194,330201..330209,330279..330287,
                     330459..330464,330567..330578,330825..330827,
                     330939..330947,331008..331013,331020..331022,
                     331026..331031,331125..331133,331137..331139,
                     331404..331406))
                     /locus_tag="PPUBIRD1_0283"
                     /note="putative molybdopterin cofactor binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:239168"
     misc_feature    complement(329400..329735)
                     /locus_tag="PPUBIRD1_0283"
                     /note="The MopB_CT_ydeP CD includes a group of related
                     uncharacterized bacterial molybdopterin-binding
                     oxidoreductase-like domains with a putative molybdopterin
                     cofactor binding site. This CD is of the conserved
                     molybdopterin_binding C-terminal (MopB_CT) region...;
                     Region: MopB_CT_ydeP; cd02787"
                     /db_xref="CDD:239188"
     misc_feature    complement(order(329418..329423,329472..329474,
                     329484..329486,329694..329705,329709..329723))
                     /locus_tag="PPUBIRD1_0283"
                     /note="putative molybdopterin cofactor binding site; other
                     site"
                     /db_xref="CDD:239188"
     gene            complement(331718..332503)
                     /gene="fdhD"
                     /locus_tag="PPUBIRD1_0284"
                     /db_xref="GeneID:12518517"
     CDS             complement(331718..332503)
                     /gene="fdhD"
                     /locus_tag="PPUBIRD1_0284"
                     /note="formate dehydrogenase family accessory protein
                     FdhD"
                     /codon_start=1
                     /transl_table=11
                     /product="protein FdhD"
                     /protein_id="YP_005928192.1"
                     /db_xref="GI:386009915"
                     /db_xref="GeneID:12518517"
                     /translation="MPAASNTYDYVQLSDAKRDSTPLAEEVALAIVYNGLNQAVMLVS
                     PTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEISSRAFWNLKNQRRQLA
                     GTSGCGLCGVEALEQALPDLAVLPGAPLPPAQWLVGLRERIDAFQPLGQHCGAVHAAL
                     FMDRQGQLLLGREDIGRHNALDKLIGALLRQRIDTQGGLAIVTSRCSLELIQKVLRAG
                     IQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES"
     misc_feature    complement(331736..332434)
                     /gene="fdhD"
                     /locus_tag="PPUBIRD1_0284"
                     /note="FdhD/NarQ family; Region: FdhD-NarQ; pfam02634"
                     /db_xref="CDD:251437"
     gene            332724..333164
                     /locus_tag="PPUBIRD1_0285"
                     /db_xref="GeneID:12518518"
     CDS             332724..333164
                     /locus_tag="PPUBIRD1_0285"
                     /codon_start=1
                     /transl_table=11
                     /product="LysM domain/BON superfamily protein"
                     /protein_id="YP_005928193.1"
                     /db_xref="GI:386009916"
                     /db_xref="GeneID:12518518"
                     /translation="MSLFSFVKEAGEKLIDLLTPGNANADEQLKKHVEAVGLGNPNIT
                     ATVEGDKIILKGEVASQEEKEKIILAAGNINGVACVDDQITVTGPVVKAARFVTVKKG
                     DTLSAISVVVYGNANQYNKIFEANKPMLSHPDKIYPGQVLRIPE"
     misc_feature    332724..333161
                     /locus_tag="PPUBIRD1_0285"
                     /note="LysM domain/BON superfamily protein; Provisional;
                     Region: PRK11198"
                     /db_xref="CDD:236880"
     misc_feature    332832..332987
                     /locus_tag="PPUBIRD1_0285"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    333006..333155
                     /locus_tag="PPUBIRD1_0285"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     gene            complement(333276..333938)
                     /locus_tag="PPUBIRD1_0286"
                     /db_xref="GeneID:12518519"
     CDS             complement(333276..333938)
                     /locus_tag="PPUBIRD1_0286"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD family hydrolase"
                     /protein_id="YP_005928194.1"
                     /db_xref="GI:386009917"
                     /db_xref="GeneID:12518519"
                     /translation="MPVLPWSAIDTVLLDMDGTLLDLHYDNRFWLDHLPQRYAELHGV
                     SRAMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKREIADLIALRPDADTFLA
                     AIRQAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQAD
                     IGFEPERSLFIDDTLAILRSARRFGVGHLLAVRQPDSKAGPRDTEEFAAVEDYRELLV
                     GL"
     misc_feature    complement(333279..333935)
                     /locus_tag="PPUBIRD1_0286"
                     /note="GMP/IMP nucleotidase; Provisional; Region:
                     PRK14988"
                     /db_xref="CDD:237882"
     misc_feature    complement(333384..333908)
                     /locus_tag="PPUBIRD1_0286"
                     /note="haloacid dehalogenase superfamily, subfamily IA,
                     variant 3 with third motif having DD or ED; Region:
                     HAD-SF-IA-v3; TIGR01509"
                     /db_xref="CDD:233443"
     misc_feature    complement(333381..333662)
                     /locus_tag="PPUBIRD1_0286"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(333594..333596)
                     /locus_tag="PPUBIRD1_0286"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            334003..334569
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /db_xref="GeneID:12518520"
     CDS             334003..334569
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="ADP-ribose diphosphatase NudE"
                     /codon_start=1
                     /transl_table=11
                     /product="NudE"
                     /protein_id="YP_005928195.1"
                     /db_xref="GI:386009918"
                     /db_xref="GeneID:12518520"
                     /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGAERTYERLVGRGN
                     GYGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGF
                     GARQLEHLTELSLSPGYMSQKIQVVLASDLYEERLEGDEPEPMRVDKVNLRELSALAM
                     HPQFTEGRALAALYLARDLLIQRGLLEL"
     misc_feature    334003..334554
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="adenosine nucleotide hydrolase NudE; Provisional;
                     Region: nudE; PRK11762"
                     /db_xref="CDD:183303"
     misc_feature    334141..334533
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
                     hydrolysis of ADP-ribose and a variety of additional
                     ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
                     other members of the Nudix hydrolase superfamily, it
                     requires a divalent cation, such as Mg2+; Region:
                     ADPRase_NUDT5; cd03424"
                     /db_xref="CDD:239516"
     misc_feature    order(334141..334143,334192..334194,334198..334200,
                     334204..334206,334219..334221,334336..334347,
                     334351..334353,334357..334371,334429..334434,
                     334438..334440,334477..334482,334501..334503,
                     334513..334515,334522..334524)
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(334144..334146,334201..334203,334243..334245,
                     334285..334287,334297..334299,334366..334368)
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239516"
     misc_feature    order(334201..334203,334237..334245,334285..334287,
                     334297..334299,334366..334368,334429..334431)
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="active site"
                     /db_xref="CDD:239516"
     misc_feature    order(334240..334251,334255..334308)
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239516"
     misc_feature    order(334285..334287,334297..334299,334429..334431)
                     /gene="nudE"
                     /locus_tag="PPUBIRD1_0287"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239516"
     gene            334566..335384
                     /locus_tag="PPUBIRD1_0288"
                     /db_xref="GeneID:12518521"
     CDS             334566..335384
                     /locus_tag="PPUBIRD1_0288"
                     /EC_number="3.1.3.7"
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase"
                     /protein_id="YP_005928196.1"
                     /db_xref="GI:386009919"
                     /db_xref="GeneID:12518521"
                     /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAAD
                     LAAHRVIADGLLALAPQIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEF
                     TVNIALIENGDVVFGVVSMPTNGRCYFGGRGMGAWRADAGEAPQLIQVRNAPAQGERF
                     TVVASRRHSSPEQEALLAGLGAAVGDLELANIGSSLKFCLLAEGSADCYPRLAPTSQW
                     DTAAAQGVVEGACGEVIGLDGLPFRYPPRESLLNPYFLALPANAAWRQAFLNLI"
     misc_feature    334572..335336
                     /locus_tag="PPUBIRD1_0288"
                     /note="CysQ, a 3'-Phosphoadenosine-5'-phosphosulfate
                     (PAPS) 3'-phosphatase, is a bacterial member of the
                     inositol monophosphatase family. It has been proposed that
                     CysQ helps control intracellular levels of PAPS, which is
                     an intermediate in...; Region: CysQ; cd01638"
                     /db_xref="CDD:238816"
     misc_feature    order(334695..334697,334764..334769,334824..334841,
                     334845..334847,335058..335060,335067..335069,
                     335154..335156,335190..335192,335217..335222)
                     /locus_tag="PPUBIRD1_0288"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            complement(335545..336000)
                     /locus_tag="PPUBIRD1_0289"
                     /db_xref="GeneID:12518522"
     CDS             complement(335545..336000)
                     /locus_tag="PPUBIRD1_0289"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928197.1"
                     /db_xref="GI:386009920"
                     /db_xref="GeneID:12518522"
                     /translation="MSTDSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANV
                     NHKSTMFGGSLYCAAVLVGWGWLHLRLRELGINDGHIVIQEGQISYPLPVTGTAVARC
                     TAPDKKTWERFLAMYQRRGRARLPLETTVSNAGSDEPAVKFSGQYVLHR"
     misc_feature    complement(335548..335988)
                     /locus_tag="PPUBIRD1_0289"
                     /note="Putative thioesterase (yiiD_Cterm); Region:
                     YiiD_Cterm; pfam09500"
                     /db_xref="CDD:255399"
     gene            complement(336000..337406)
                     /locus_tag="PPUBIRD1_0290"
                     /db_xref="GeneID:12518523"
     CDS             complement(336000..337406)
                     /locus_tag="PPUBIRD1_0290"
                     /codon_start=1
                     /transl_table=11
                     /product="Two component, sigma54 specific, transcriptional
                     regulator, Fis family"
                     /protein_id="YP_005928198.1"
                     /db_xref="GI:386009921"
                     /db_xref="GeneID:12518523"
                     /translation="MTTETLIDSRAQVILVDDDPHLRQALSQTLDLAGLKVVALAEAQ
                     GLAERIEADWPGVVVSDIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMR
                     AGAYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAML
                     RLREQIGALAGTRADVLILGETGAGKEVVARALHDLSSRSEGPFVAINAGALAESVVE
                     SELFGHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERL
                     GGNQLIPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLF
                     QHFADAASQRHGLSPHALQPAQRALLLRHDWPGNVRELQNAAERFALGLELALDGQAP
                     SAAAPAAPMLSGNLSEQVEQFERSLIAAELAQPHGSMRSLAEALGIPRKTLHDKLRKH
                     GLNFDGGSGGHDDQEDNR"
     misc_feature    complement(336048..337376)
                     /locus_tag="PPUBIRD1_0290"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     misc_feature    complement(337029..337367)
                     /locus_tag="PPUBIRD1_0290"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(337071..337076,337083..337085,
                     337140..337142,337200..337202,337224..337226,
                     337353..337358))
                     /locus_tag="PPUBIRD1_0290"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(337224..337226)
                     /locus_tag="PPUBIRD1_0290"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(337200..337208,337212..337217))
                     /locus_tag="PPUBIRD1_0290"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(337068..337076)
                     /locus_tag="PPUBIRD1_0290"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(336441..336905)
                     /locus_tag="PPUBIRD1_0290"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(336846..336869)
                     /locus_tag="PPUBIRD1_0290"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(336513..336515,336654..336656,
                     336843..336866))
                     /locus_tag="PPUBIRD1_0290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(336651..336668)
                     /locus_tag="PPUBIRD1_0290"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(336471..336473)
                     /locus_tag="PPUBIRD1_0290"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(336057..336179)
                     /locus_tag="PPUBIRD1_0290"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; cl17420"
                     /db_xref="CDD:266671"
     gene            complement(337403..339217)
                     /locus_tag="PPUBIRD1_0291"
                     /db_xref="GeneID:12518524"
     CDS             complement(337403..339217)
                     /locus_tag="PPUBIRD1_0291"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_005928199.1"
                     /db_xref="GI:386009922"
                     /db_xref="GeneID:12518524"
                     /translation="MIAKPTPPRRPRWRSLALLALSLAPLLWPLHHLAERYYQEELAS
                     QNRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQ
                     QTGAEVMYLMDVSGNTLAASNWDKHDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSA
                     KRGYFFAAAVRDRERIVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWR
                     FRATRTLTDAERQAIIAIQPYPTQAPQPLVLNPQAWITQTRDIKETGWQVSILAPRTL
                     VDRSVQTVMAIGAGTLLVLMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAERTADL
                     EGLNTRLKNAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSY
                     AENAEILLDHQRTEDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALD
                     DALALLAKRRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRR
                     LWLSAEQRDDCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRA
                     LGGELLLANHPEGGAMLTLQLRVAASGATLPNSEDPSA"
     misc_feature    complement(337445..339136)
                     /locus_tag="PPUBIRD1_0291"
                     /note="Signal transduction histidine kinase regulating
                     C4-dicarboxylate transport system [Signal transduction
                     mechanisms]; Region: COG4191"
                     /db_xref="CDD:226654"
     misc_feature    complement(337916..338116)
                     /locus_tag="PPUBIRD1_0291"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(337931..337933,337943..337945,
                     337952..337954,337964..337966,337973..337975,
                     337985..337987,338042..338044,338051..338053,
                     338063..338065,338072..338074,338084..338086,
                     338096..338098))
                     /locus_tag="PPUBIRD1_0291"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(338078..338080)
                     /locus_tag="PPUBIRD1_0291"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(337457..337765)
                     /locus_tag="PPUBIRD1_0291"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(337469..337471,337475..337480,
                     337493..337495,337499..337501,337547..337558,
                     337625..337630,337634..337636,337640..337642,
                     337646..337648,337724..337726,337733..337735,
                     337745..337747))
                     /locus_tag="PPUBIRD1_0291"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(337733..337735)
                     /locus_tag="PPUBIRD1_0291"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(337550..337552,337556..337558,
                     337628..337630,337634..337636))
                     /locus_tag="PPUBIRD1_0291"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(339260..339805)
                     /locus_tag="PPUBIRD1_0292"
                     /db_xref="GeneID:12518525"
     CDS             complement(339260..339805)
                     /locus_tag="PPUBIRD1_0292"
                     /EC_number="5.1.3.13"
                     /codon_start=1
                     /transl_table=11
                     /product="DTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="YP_005928200.1"
                     /db_xref="GI:386009923"
                     /db_xref="GeneID:12518525"
                     /translation="MNIIPTAIPEVLIIEPKVFADSRGFFFEAFNAREFSQQTGVNVA
                     FVQDNHSRSIKGVLRGLHYQVANTQGKLVRVVHGEIRDIAVDVRKSSPTFGKWVAVHL
                     SADNHRQLWIPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLDIDWGLQQ
                     PPLLSDKDKVGLPLAEAELLP"
     misc_feature    complement(339272..339802)
                     /locus_tag="PPUBIRD1_0292"
                     /note="dTDP-4-dehydrorhamnose 3,5-epimerase; Region: rmlC;
                     TIGR01221"
                     /db_xref="CDD:233319"
     gene            340082..341188
                     /gene="aguA"
                     /locus_tag="PPUBIRD1_0293"
                     /db_xref="GeneID:12518526"
     CDS             340082..341188
                     /gene="aguA"
                     /locus_tag="PPUBIRD1_0293"
                     /EC_number="3.5.3.12"
                     /note="Agmatine deiminase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein AguA"
                     /protein_id="YP_005928201.1"
                     /db_xref="GI:386009924"
                     /db_xref="GeneID:12518526"
                     /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQ
                     AAHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVI
                     NDHGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKLLEMERCQRYQTEGFVLEGGSI
                     HVDGEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLF
                     ATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILARI
                     FPDHEVVMIPGRELLLGGGNIHCLTQQQPAPVKR"
     misc_feature    340091..341176
                     /gene="aguA"
                     /locus_tag="PPUBIRD1_0293"
                     /note="agmatine deiminase; Provisional; Region: PRK13551"
                     /db_xref="CDD:184135"
     gene            complement(341645..343714)
                     /locus_tag="PPUBIRD1_0294"
                     /db_xref="GeneID:12518527"
     CDS             complement(341645..343714)
                     /locus_tag="PPUBIRD1_0294"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005928202.1"
                     /db_xref="GI:386009925"
                     /db_xref="GeneID:12518527"
                     /translation="MLVPCRLSPLTLGLSLLFSASLASAATTTLPESSVTADSEREKD
                     NPRVKEVSTATRTSTPVRYVPQAIDTVKTANVLDYGSNTLGKALEGIPNVSSGADTRF
                     DSVRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRV
                     SKAPEPGRRSTIEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFRDGIDGSR
                     QLFAPSISWQITPDLNWLVQYEYSRYNRTPDRGIPSVNGRPADVSRSATYGDNRDYID
                     DRAQSLRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVTGYNAGTNTLTRQRWQQDLN
                     TRNLFNNLEAEGDFDTLGLEHKLLLGLEFGNQRRDPLLYSAGSQSLPGLGKPSQPHNG
                     TLAVSSNNHTVVDSRGVYLQDQIRLNDQWQVLAGVRFDQFEVETTNKDGVREPQDSNS
                     TSPRLGVVYTPWRDHSFYASWSKTFSPVGGGLIGITPGAPGNTNKTDPEETRQKEIGV
                     KSDWLDQRLTTTLAIYELELYNRRTRDPNDPNIILLSGMQRSRGIELTATGNIVGNWY
                     VRGGIGLQDAIIVKDNNGQEGNRINDVAKRNGSLFVTWKPELGWYAETGLTLVGERYA
                     DNQNTTVLPGYGRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRSLV
                     VTGSYSF"
     misc_feature    complement(341648..343525)
                     /locus_tag="PPUBIRD1_0294"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    complement(341648..343513)
                     /locus_tag="PPUBIRD1_0294"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(343232..343258,343292..343324,
                     343349..343369,343385..343402,343436..343438,
                     343439..343459,343487..343513))
                     /locus_tag="PPUBIRD1_0294"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(342716..342718,342794..342796))
                     /locus_tag="PPUBIRD1_0294"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            344189..345508
                     /gene="oprQ"
                     /locus_tag="PPUBIRD1_0295"
                     /db_xref="GeneID:12518528"
     CDS             344189..345508
                     /gene="oprQ"
                     /locus_tag="PPUBIRD1_0295"
                     /note="outer membrane porin"
                     /codon_start=1
                     /transl_table=11
                     /product="OprQ"
                     /protein_id="YP_005928203.1"
                     /db_xref="GI:386009926"
                     /db_xref="GeneID:12518528"
                     /translation="MLKTRISLVALAMIAATQAQANDQADSKGFIEDSHANVLLRNAY
                     INRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGV
                     DFFKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLP
                     ESFTGTLITSKEIQGLELNAGRFTQEARKSAERRDGGGLKSINVLGGSYKFTDNFTAS
                     LYTADNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDINNKYVKAAGLNGDSNTIW
                     SLAATYAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAED
                     ERSWQLGYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYV
                     VQDGPAKDLSIKLRSSFLRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
     misc_feature    344270..345502
                     /gene="oprQ"
                     /locus_tag="PPUBIRD1_0295"
                     /note="outer membrane porin, OprD family; Region: OprD;
                     pfam03573"
                     /db_xref="CDD:252035"
     gene            complement(345634..346590)
                     /locus_tag="PPUBIRD1_0296"
                     /db_xref="GeneID:12518529"
     CDS             complement(345634..346590)
                     /locus_tag="PPUBIRD1_0296"
                     /codon_start=1
                     /transl_table=11
                     /product="Integrase catalytic subunit"
                     /protein_id="YP_005928204.1"
                     /db_xref="GI:386009927"
                     /db_xref="GeneID:12518529"
                     /translation="MGKYTEQFKLTAITAYLDGSNGFRKVAQHLGIDFSLLRRWVARY
                     QANNGIGPGSHGRRYSSDFKQQVLSYMHEHRLSLRQTAAHFGLGQSSQIGIWQRQYYS
                     GSPAPSTAIKPRKPIDVSKKIKPVNSVVRPKKYRSYRGTVGKVAANVLERNFVAQRPN
                     QKWVTDVTEFKVAQQKLYLSPVMDLYNGEIVAYEMASRPCYSLVGNMLGKALDCLGEK
                     PKLVLHSDQGWHYQQAQYRRKLSECGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLK
                     RFESIDELRAGLDEYIHYYNHDRIKLRLNGLSPVEYRAQAAA"
     misc_feature    complement(346327..346590)
                     /locus_tag="PPUBIRD1_0296"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(<346453..346584)
                     /locus_tag="PPUBIRD1_0296"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    complement(<346195..346422)
                     /locus_tag="PPUBIRD1_0296"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(345775..346125)
                     /locus_tag="PPUBIRD1_0296"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(345643..345807)
                     /locus_tag="PPUBIRD1_0296"
                     /note="Integrase core domain; Region: rve_2; pfam13333"
                     /db_xref="CDD:257663"
     gene            complement(346695..348365)
                     /locus_tag="PPUBIRD1_0297"
                     /db_xref="GeneID:12518530"
     CDS             complement(346695..348365)
                     /locus_tag="PPUBIRD1_0297"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase (NADPH)"
                     /protein_id="YP_005928205.1"
                     /db_xref="GI:386009928"
                     /db_xref="GeneID:12518530"
                     /translation="MKHSLPSHYACLVLCLVFTFASLPLLAQHAWLWPVTLITALLSL
                     VGLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYA
                     RAKNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRMPYSASIF
                     NISAMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGC
                     RTEDGRFDPQRFAEQARSAQVKMIEIKLSQGAKPGHGGILPGHKVSPEIAETRGVRAG
                     EDCISPAAHSAFRTPVELLQFVAGLRELSGGKPVGFKFCLGHPWEFMGIAKAMLATGI
                     TPDFIVVDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIV
                     SAFDIASVLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPD
                     KAERVASFHRNTLHALAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPG
                     ELLSGSIESEFYARMWRMARSDSFAPETGDTATRTVASRLRHEETEPA"
     misc_feature    complement(346893..348275)
                     /locus_tag="PPUBIRD1_0297"
                     /note="Glutamate synthase domain 2 [Amino acid transport
                     and metabolism]; Region: GltB; COG0069"
                     /db_xref="CDD:223147"
     misc_feature    complement(346899..348161)
                     /locus_tag="PPUBIRD1_0297"
                     /note="Glutamate synthase (GltS) FMN-binding domain.  GltS
                     is a complex iron-sulfur flavoprotein that catalyzes the
                     reductive synthesis of L-glutamate from 2-oxoglutarate and
                     L-glutamine via intramolecular channelling of ammonia, a
                     reaction in the plant, yeast...; Region: GltS_FMN;
                     cd02808"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(347073..347075,347088..347090,
                     347106..347108,347130..347135,347196..347198,
                     347202..347204,347319..347327,347427..347429,
                     347553..347555,347613..347615,347631..347633,
                     347736..347738,347787..347789,347868..347879))
                     /locus_tag="PPUBIRD1_0297"
                     /note="active site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(347130..347135,347196..347198,
                     347202..347204,347322..347327,347427..347429,
                     347631..347633,347736..347738,347787..347789,
                     347868..347879))
                     /locus_tag="PPUBIRD1_0297"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(347319..347324,347553..347555,
                     347613..347615))
                     /locus_tag="PPUBIRD1_0297"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239202"
     misc_feature    complement(order(347073..347075,347088..347090,
                     347106..347108))
                     /locus_tag="PPUBIRD1_0297"
                     /note="3Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239202"
     gene            complement(348567..349934)
                     /locus_tag="PPUBIRD1_0298"
                     /db_xref="GeneID:12518531"
     CDS             complement(348567..349934)
                     /locus_tag="PPUBIRD1_0298"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Integral membrane sensor signal transduction
                     histidine kinase"
                     /protein_id="YP_005928206.1"
                     /db_xref="GI:386009929"
                     /db_xref="GeneID:12518531"
                     /translation="MRWFHRLWPRTLFGQLLLIMVSGTLVIQLMSSSIWFDVRFAQAL
                     EVPVRLVAARSAPLIAQADCHGGTLQAPSHYQLRCVESLPAQEHDERRGHRRVELLLQ
                     QALKYELGRAQDVRLMNVQLTDELGQPIVWRSLFGLRTAQAHIQFAVPLPDGQWLTVA
                     GQELQGWSGESAWVLISDYLLRVYALRIVAVLLVCLVAVRLCLRPLRRLADAARGLGS
                     NLEQPPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMRLRL
                     ERLHDDEHRQRLRQNITQMDDMIGQVLDYLRAGEQQNLQQVDLDRLVARQCADLATAE
                     EPLTVHGKAGSLRVDALLLQRCLQNLLVNALRYAKNISVTLERATTGVFIHIDDCGPG
                     IAPGLLATITDPFVRGDGSRNQASGGYGLGLSIAQRIAASHGGELMLSNRESGGLRVS
                     ILLPG"
     misc_feature    complement(348573..349919)
                     /locus_tag="PPUBIRD1_0298"
                     /note="osmolarity sensor protein; Provisional; Region:
                     envZ; PRK09467"
                     /db_xref="CDD:236531"
     misc_feature    complement(349014..349166)
                     /locus_tag="PPUBIRD1_0298"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(349029..349031,349041..349043,
                     349050..349052,349062..349064,349071..349073,
                     349083..349085,349110..349112,349119..349121,
                     349131..349133,349140..349142,349152..349154,
                     349164..349166))
                     /locus_tag="PPUBIRD1_0298"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(349146..349148)
                     /locus_tag="PPUBIRD1_0298"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(348576..348878)
                     /locus_tag="PPUBIRD1_0298"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(348588..348590,348594..348599,
                     348612..348614,348618..348620,348666..348677,
                     348756..348761,348765..348767,348771..348773,
                     348777..348779,348837..348839,348846..348848,
                     348858..348860))
                     /locus_tag="PPUBIRD1_0298"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(348846..348848)
                     /locus_tag="PPUBIRD1_0298"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(348669..348671,348675..348677,
                     348759..348761,348765..348767))
                     /locus_tag="PPUBIRD1_0298"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(349936..350655)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /db_xref="GeneID:12518532"
     CDS             complement(349936..350655)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="winged helix family two component transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GltR"
                     /protein_id="YP_005928207.1"
                     /db_xref="GI:386009930"
                     /db_xref="GeneID:12518532"
                     /translation="MSTTLLVVDDDDEIRELLCDYLTDAGYNVLAAADGQQMRDQLAR
                     HKVELVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAK
                     PFEPRELIARIKAVLRRPQRLGTSAEEPVVDAQLFAGFRLEHVKRLLTRPDGETLTLP
                     RSDYRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGAA
                     QILTIRNEGYLLSIAPLAAGA"
     misc_feature    complement(349972..350643)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="osmolarity response regulator; Provisional; Region:
                     ompR; PRK09468"
                     /db_xref="CDD:181883"
     misc_feature    complement(350305..350640)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(350347..350352,350359..350361,
                     350416..350418,350473..350475,350497..350499,
                     350626..350631))
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(350497..350499)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(350473..350481,350485..350490))
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(350344..350352)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(349966..350250)
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(349975..349977,349990..349992,
                     350026..350031,350053..350055,350062..350064,
                     350116..350121,350176..350178))
                     /gene="gltR"
                     /locus_tag="PPUBIRD1_0299"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            350820..353093
                     /locus_tag="PPUBIRD1_0300"
                     /db_xref="GeneID:12518533"
     CDS             350820..353093
                     /locus_tag="PPUBIRD1_0300"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005928208.1"
                     /db_xref="GI:386009931"
                     /db_xref="GeneID:12518533"
                     /translation="MFTPFSQSGNCLKPLAFCVAVAISGGAVAANGKPLELDATQIED
                     SALLPADDAGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIHTIEQALET
                     APGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMDLYERIDIV
                     RGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNLPLSEDGRL
                     RSRFVMTQQDANSFRDNQSERSRAALANFAFDLDDATTLGAGYQYEYNKVVGGGWGAN
                     IPIWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLKAAQATTEA
                     LNHRGLAKVNSAGRGSYGGYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSGPFQLFGRT
                     HQAMVGYNDSRTVGWSPQYTCTMVGGGMTSAPALGCQFRANNGFPVTDWHNGVDDDYD
                     LIASRTGLHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVAGERSSQEE
                     NGIVTPYLGAVYDLNDNYSVYASYTDIFTPQTSETSSGSKVEPIRGQSYETGIKGEWF
                     DGRLNASAAYFRTKQENKAVLDGDLTTPTGGNAYKAGSGQETDGIDLEVAGALTPNWN
                     VYAGYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQTNIRAISSP
                     AGQPTNGVSNGATDVNWSGYAIWNAMAKYQLTDETSVSLNANNLFDKHYYTQYGFYAG
                     AIYGDPRNLSLTVSTAF"
     misc_feature    350847..353090
                     /locus_tag="PPUBIRD1_0300"
                     /note="Outer membrane receptor for ferric coprogen and
                     ferric-rhodotorulic acid [Inorganic ion transport and
                     metabolism]; Region: FhuE; COG4773"
                     /db_xref="CDD:227114"
     misc_feature    351054..353090
                     /locus_tag="PPUBIRD1_0300"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(351054..351083,351111..351140,351174..351191,
                     351210..351212,351213..351221,351222..351224,
                     351270..351302,351336..351362)
                     /locus_tag="PPUBIRD1_0300"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    order(351849..351851,351930..351932)
                     /locus_tag="PPUBIRD1_0300"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(353258..353464)
                     /locus_tag="PPUBIRD1_0301"
                     /db_xref="GeneID:12518534"
     CDS             complement(353258..353464)
                     /locus_tag="PPUBIRD1_0301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928209.1"
                     /db_xref="GI:386009932"
                     /db_xref="GeneID:12518534"
                     /translation="MAKRFPTTPRHPERICWGCDLYCPAKALACGNGADRTMHPVELF
                     GEDWDSFEGQLEKPIDPGQAVKPR"
     misc_feature    complement(353309..353464)
                     /locus_tag="PPUBIRD1_0301"
                     /note="Protein of unknown function (DUF3079); Region:
                     DUF3079; pfam11278"
                     /db_xref="CDD:151719"
     gene            353648..355255
                     /locus_tag="PPUBIRD1_0302"
                     /db_xref="GeneID:12518535"
     CDS             353648..355255
                     /locus_tag="PPUBIRD1_0302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928210.1"
                     /db_xref="GI:386009933"
                     /db_xref="GeneID:12518535"
                     /translation="MPHSTGKRGVSYDPPQRRQRRDIPSIVRRVTLGVVVVWLALVAS
                     LGGWIVQRLTAEELDNLAAGAEYEAQITGRVVDRLFTEMASVANMVARQSEVIQLAAR
                     YRHDPPGFAALTREERASKFTRDPLVRSVGDFMDRLASDLHYGRIYMNNLSDDTVTAS
                     NWAESFSIVGQIYTGRAYLIDALRTGSGEMFGIARLNKTPSYFVASRIDDADGKPLGS
                     VTVKFDAPDIALYLTGRHIALIVNRQGRVTTASSELFMLRNVVTLLPPDIRRPLDGDE
                     EPGEPMDIRAVADAGQANQWLIDGHPYLVHRQPLNDAQYQLLTLAKLDHLQPMRQQYY
                     WTGASVAALGLILILLSSRVAGQMLLRRQEERYAANYDALTGLKNRRAILAALHRHFA
                     LAKRTGQGVLVAFIDLDEFKAINDTYGHEVGDKFLIESSRRLQGGLRASDELGRWGGD
                     EFVVIGLTASVHPDEMAKTAAAMRRRLVPLLIGSYEFDDCRFDYAGASFGITSVDPAA
                     TSLQAALKVADQLMYADKEVRRGLRRV"
     misc_feature    354755..355240
                     /locus_tag="PPUBIRD1_0302"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(354866..354868,354995..354997)
                     /locus_tag="PPUBIRD1_0302"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(354881..354883,354890..354895,354905..354907,
                     354917..354919,354983..354985,354989..355000)
                     /locus_tag="PPUBIRD1_0302"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(354971..354973,355061..355063)
                     /locus_tag="PPUBIRD1_0302"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(355337..355412)
                     /locus_tag="PPUBIRD1_t0063"
                     /note="tRNA-Thr3"
                     /db_xref="GeneID:12518536"
     tRNA            complement(355337..355412)
                     /locus_tag="PPUBIRD1_t0063"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:12518536"
     gene            complement(355511..355759)
                     /locus_tag="PPUBIRD1_0303"
                     /db_xref="GeneID:12518537"
     CDS             complement(355511..355759)
                     /locus_tag="PPUBIRD1_0303"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928211.1"
                     /db_xref="GI:386009934"
                     /db_xref="GeneID:12518537"
                     /translation="MTRATPLALLTFALALTGCAGGTSPHPNSNLGWNHPGMQLGGDN
                     GLPLRTEAPCRKRGCDNDKLFFNPGKSEPSVTTMHRGW"
     gene            356284..356574
                     /locus_tag="PPUBIRD1_0304"
                     /db_xref="GeneID:12518538"
     CDS             356284..356574
                     /locus_tag="PPUBIRD1_0304"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928212.1"
                     /db_xref="GI:386009935"
                     /db_xref="GeneID:12518538"
                     /translation="MKTIDADPNSPKSITTAGVETFLAAGNPSLNLLRVEPGIPIDAA
                     YEHVSILMGYIKHLVREGDMEDDHKFLGAADYLCDMAKALMNDIEIAKGKAH"
     misc_feature    356329..356556
                     /locus_tag="PPUBIRD1_0304"
                     /note="Protein of unknown function (DUF3077); Region:
                     DUF3077; pfam11275"
                     /db_xref="CDD:204621"
     gene            complement(356855..358060)
                     /locus_tag="PPUBIRD1_0305"
                     /db_xref="GeneID:12518539"
     CDS             complement(356855..358060)
                     /locus_tag="PPUBIRD1_0305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928213.1"
                     /db_xref="GI:386009936"
                     /db_xref="GeneID:12518539"
                     /translation="MPSPLHSHHLSTRFQALDQFLIEHQQLWKPRPFTTLQLPWETTH
                     PELAAHLRQCSLADAEADSATDRLPAPFPQLAEQARQLATLGSLAQTNLPPAAHRLDV
                     AVPGRKWQQIEAFASHLAFREQPRHWLDWCSGKGHLGRRLLQPGQHLTCLEYDADLVA
                     AGQALSAHHHLQAQHVHQDVMASDSARHLADDKSVVALHACGDLHVRLLQLASQQGCR
                     QLAIAPCCYNRIAAQQYQALSTAAQASSLQLSLDDLGLPLSETVTAGARVRRQRDTSM
                     ARRLGFDLLQRQQRQSDEYLPTPSLPVAWLDKPFEQYCRDLAELKQLPVSGNPDWAML
                     EAAGWQRLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYDVRLGLFCDYPLTPRN
                     LLILAERDG"
     misc_feature    complement(357362..357742)
                     /locus_tag="PPUBIRD1_0305"
                     /note="Methyltransferase domain; Region: Methyltransf_32;
                     pfam13679"
                     /db_xref="CDD:257983"
     gene            complement(358172..358861)
                     /locus_tag="PPUBIRD1_0306"
                     /db_xref="GeneID:12518540"
     CDS             complement(358172..358861)
                     /locus_tag="PPUBIRD1_0306"
                     /codon_start=1
                     /transl_table=11
                     /product="Polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="YP_005928214.1"
                     /db_xref="GI:386009937"
                     /db_xref="GeneID:12518540"
                     /translation="MNWEVIFKWLPRLAEGAVLTLELVAIAVVAGLILAIPLGIARSS
                     RHWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTM
                     TLHTAAYIAEILRGALQSIPKGEIEAARALGMSRGKALFYIMLPRAARIGLPAYSNEV
                     ILMLKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFMLVQGFKLLE
                     RWLRVDACQGR"
     misc_feature    complement(358199..358861)
                     /locus_tag="PPUBIRD1_0306"
                     /note="ABC-type arginine/histidine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ArtM; COG4160"
                     /db_xref="CDD:226634"
     misc_feature    complement(358229..358804)
                     /locus_tag="PPUBIRD1_0306"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358229..358231,358238..358243,
                     358250..358255,358259..358264,358271..358276,
                     358304..358309,358346..358351,358358..358369,
                     358388..358390,358397..358402,358442..358444,
                     358493..358495,358502..358507,358517..358519,
                     358523..358528,358535..358537,358541..358543,
                     358547..358552,358643..358645,358649..358654,
                     358661..358690,358694..358705,358733..358735,
                     358748..358753,358760..358765))
                     /locus_tag="PPUBIRD1_0306"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358352..358369,358643..358687))
                     /locus_tag="PPUBIRD1_0306"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358274..358276,358304..358306,
                     358313..358315,358349..358351,358565..358567,
                     358643..358645))
                     /locus_tag="PPUBIRD1_0306"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358421..358423,358433..358438,
                     358454..358492))
                     /locus_tag="PPUBIRD1_0306"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(358861..359553)
                     /locus_tag="PPUBIRD1_0307"
                     /db_xref="GeneID:12518541"
     CDS             complement(358861..359553)
                     /locus_tag="PPUBIRD1_0307"
                     /codon_start=1
                     /transl_table=11
                     /product="Polar amino acid ABC transporter, inner membrane
                     subunit"
                     /protein_id="YP_005928215.1"
                     /db_xref="GI:386009938"
                     /db_xref="GeneID:12518541"
                     /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSP
                     LKPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIA
                     LGLCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNL
                     FMILMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVLAMTGMHFM
                     EKRAARGFARAE"
     misc_feature    complement(358867..359544)
                     /locus_tag="PPUBIRD1_0307"
                     /note="ABC-type arginine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     ArtQ; COG4215"
                     /db_xref="CDD:226670"
     misc_feature    complement(358918..359418)
                     /locus_tag="PPUBIRD1_0307"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358918..358920,358927..358932,
                     358939..358944,358948..358953,358960..358965,
                     358993..358998,359035..359040,359047..359058,
                     359077..359079,359086..359091,359131..359133,
                     359182..359184,359191..359196,359206..359208,
                     359212..359217,359224..359226,359230..359232,
                     359239..359244,359338..359340,359344..359349,
                     359356..359385,359389..359400))
                     /locus_tag="PPUBIRD1_0307"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(359041..359058,359338..359382))
                     /locus_tag="PPUBIRD1_0307"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(358963..358965,358993..358995,
                     359002..359004,359038..359040,359257..359259,
                     359338..359340))
                     /locus_tag="PPUBIRD1_0307"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(359110..359112,359122..359127,
                     359143..359181))
                     /locus_tag="PPUBIRD1_0307"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(359608..360360)
                     /locus_tag="PPUBIRD1_0308"
                     /db_xref="GeneID:12518542"
     CDS             complement(359608..360360)
                     /locus_tag="PPUBIRD1_0308"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_005928216.1"
                     /db_xref="GI:386009939"
                     /db_xref="GeneID:12518542"
                     /translation="MHTYKKFLLAAAATLVMTANAMAAEKLRMGIEAAYPPFNNKDAS
                     GNVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAV
                     DFTEPYYSNKLQFIAPKNVDFKTDKASLKGKVIGTQRATLAGTYLEDNYPDVDVKLYD
                     TQENAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDT
                     KLRDDLNKALAEIKADGTYKKINDKYFPFSIE"
     misc_feature    complement(359626..360336)
                     /locus_tag="PPUBIRD1_0308"
                     /note="lysine-arginine-ornithine-binding periplasmic
                     protein; Region: 3A0103s03R; TIGR01096"
                     /db_xref="CDD:233269"
     misc_feature    complement(359626..360282)
                     /locus_tag="PPUBIRD1_0308"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(359821..359823,359935..359937,
                     360067..360069,360142..360144,360256..360258))
                     /locus_tag="PPUBIRD1_0308"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(359842..359844,359860..359862,
                     359872..359874))
                     /locus_tag="PPUBIRD1_0308"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(359731..359748)
                     /locus_tag="PPUBIRD1_0308"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(360372..361145)
                     /locus_tag="PPUBIRD1_0309"
                     /db_xref="GeneID:12518543"
     CDS             complement(360372..361145)
                     /locus_tag="PPUBIRD1_0309"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_005928217.1"
                     /db_xref="GI:386009940"
                     /db_xref="GeneID:12518543"
                     /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGS
                     GKSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLIAADNRQINRLRSEIGFVFQN
                     FNLWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQ
                     RAAIARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARH
                     VSSEVVFLHQGLVEEQGSPQQVFENPTSARCKQFMSSHR"
     misc_feature    complement(360375..361136)
                     /locus_tag="PPUBIRD1_0309"
                     /note="ABC-type histidine transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     HisP; COG4598"
                     /db_xref="CDD:226961"
     misc_feature    complement(360459..361124)
                     /locus_tag="PPUBIRD1_0309"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(361005..361028)
                     /locus_tag="PPUBIRD1_0309"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(360513..360515,360609..360614,
                     360843..360845,361002..361010,361014..361019))
                     /locus_tag="PPUBIRD1_0309"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(360843..360854)
                     /locus_tag="PPUBIRD1_0309"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(360657..360686)
                     /locus_tag="PPUBIRD1_0309"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(360609..360626)
                     /locus_tag="PPUBIRD1_0309"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(360591..360602)
                     /locus_tag="PPUBIRD1_0309"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(360507..360527)
                     /locus_tag="PPUBIRD1_0309"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            361777..363162
                     /gene="gabP"
                     /locus_tag="PPUBIRD1_0311"
                     /db_xref="GeneID:12518544"
     CDS             361777..363162
                     /gene="gabP"
                     /locus_tag="PPUBIRD1_0311"
                     /note="GABA permease"
                     /codon_start=1
                     /transl_table=11
                     /product="GabP"
                     /protein_id="YP_005928218.1"
                     /db_xref="GI:386009941"
                     /db_xref="GeneID:12518544"
                     /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGP
                     AVLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWV
                     LVIPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVL
                     AIIGFIAVGCAALFGFVPSSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEI
                     VTIAAAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVL
                     SRIGVPNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPH
                     VAVLLSTAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAVSQLRMRAQREARG
                     EKITFKMWLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRK
                     REAAGRAALDS"
     misc_feature    361801..363129
                     /gene="gabP"
                     /locus_tag="PPUBIRD1_0311"
                     /note="gamma-aminobutyrate permease; Region: GABAperm;
                     TIGR01773"
                     /db_xref="CDD:233567"
     gene            complement(363401..363844)
                     /locus_tag="PPUBIRD1_0312"
                     /db_xref="GeneID:12518545"
     CDS             complement(363401..363844)
                     /locus_tag="PPUBIRD1_0312"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928219.1"
                     /db_xref="GI:386009942"
                     /db_xref="GeneID:12518545"
                     /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKASAGDSASVEQVY
                     NKAMESGSYDAMFNKMKEAQEGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFN
                     AYRKWLDGADEETTMAWLESDEFQDAYIAASELVAKQQQQQKQFG"
     gene            complement(364500..364575)
                     /locus_tag="PPUBIRD1_t0062"
                     /note="tRNA-Phe1"
                     /db_xref="GeneID:12518546"
     tRNA            complement(364500..364575)
                     /locus_tag="PPUBIRD1_t0062"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:12518546"
     gene            complement(364666..364938)
                     /locus_tag="PPUBIRD1_0314"
                     /db_xref="GeneID:12518547"
     CDS             complement(364666..364938)
                     /locus_tag="PPUBIRD1_0314"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(2+)-trafficking protein"
                     /protein_id="YP_005928220.1"
                     /db_xref="GI:386009943"
                     /db_xref="GeneID:12518547"
                     /translation="MTRTVMCRKYLEELPGLERPPYPGAKGQYIFEHISQKAWADWQK
                     HQTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
     misc_feature    complement(364669..364938)
                     /locus_tag="PPUBIRD1_0314"
                     /note="oxidative damage protection protein; Provisional;
                     Region: PRK05408"
                     /db_xref="CDD:180059"
     gene            complement(364935..366002)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /db_xref="GeneID:12518548"
     CDS             complement(364935..366002)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="A/G-specific adenine glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="MutY protein"
                     /protein_id="YP_005928221.1"
                     /db_xref="GI:386009944"
                     /db_xref="GeneID:12518548"
                     /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQ
                     VSTVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGG
                     EFPRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKV
                     ANQLWATAERFTPQQRANHYTQAMMDMGATLCTRSKPSCLICPLQHGCEAHLHGEETR
                     YPEPKPRKALPQRRTLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAY
                     QHGLRLAGRHAMDGLTHTFSHFQLAIEPWLVHVDPVGEHVAEADWLWYNLATPPRLGL
                     AAPVKKLLERAADELIAGDAR"
     misc_feature    complement(364974..366002)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="adenine DNA glycosylase; Provisional; Region:
                     PRK10880"
                     /db_xref="CDD:182805"
     misc_feature    complement(365439..365912)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(365748..365750,365862..365864,
                     365871..365879))
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(365640..365663)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(365448..365450,365460..365462,
                     365631..365633))
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    complement(365589..365591)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    complement(365379..365429)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="Iron-sulfur binding domain of endonuclease III;
                     Region: EndIII_4Fe-2S; pfam10576"
                     /db_xref="CDD:256069"
     misc_feature    complement(364968..365282)
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="DNA glycosylase (MutY in bacteria and hMYH in
                     humans) is responsible for repairing misread  A*oxoG
                     residues to C*G by removing the inappropriately paired
                     adenine base from the DNA backbone. It belongs to the
                     Nudix hydrolase superfamily and is important...; Region:
                     DNA_Glycosylase_C; cd03431"
                     /db_xref="CDD:239523"
     misc_feature    complement(order(365112..365117,365124..365126,
                     365235..365243))
                     /gene="mutY"
                     /locus_tag="PPUBIRD1_0315"
                     /note="DNA binding and oxoG recognition site [nucleotide
                     binding]"
                     /db_xref="CDD:239523"
     gene            complement(365999..368251)
                     /locus_tag="PPUBIRD1_0316"
                     /db_xref="GeneID:12518549"
     CDS             complement(365999..368251)
                     /locus_tag="PPUBIRD1_0316"
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA family protein"
                     /protein_id="YP_005928222.1"
                     /db_xref="GI:386009945"
                     /db_xref="GeneID:12518549"
                     /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLAR
                     DKAHVELTLNGDIGWSLFPWLGLELHEASIATLNKPKEPFADLQMLGLSVRVLPLLRR
                     EVQMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAQNGAGTDAPAQAPAQAEQAPATS
                     DSNDRAIKLDIDSLTVNNARVQYTDAKTGHSYSAESIQLSTGPIHEGANIALKTSAFI
                     SASQPNIKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLLVD
                     LAANVASWNGLKVSANQLRALGELNLRDLDKAPQLSGGLSIAQFNLRTFLESIGHPLP
                     ATHDPAAFAKLELVTRLQGTPSSLALEDLAVKLDDSTFSGRVAVEDFAKQALRLQLKG
                     DTFDADRYLPAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDKLL
                     PVDRLRALDLQADLAFGSLTLDKLPIEGAQLKAVGQGGLLTLQTLRGALYNGTFEAKG
                     TVDVRPAVPQLGVNTNIQRVPVEHFIKAEGKEQTPPVKGLLTLTSDLTATGNSQKALV
                     DTLNGSANFAINDGVLVNANLEQQLCQAIATLNRKTLSSEPRGKDTPFQELRGSLVVR
                     NGVASNPDLKARIPGLTVNGHGDLDLRVLGMDYNIGVVVEGDQRAMPDPACQVNERYV
                     GVEVPLRCRGPLELGAKACRLDQNGLGKVAAKLAGNRLKDKIDEKLDEKLGDKVSPEL
                     KDALKGLFNR"
     misc_feature    complement(366353..368194)
                     /locus_tag="PPUBIRD1_0316"
                     /note="AsmA family; Region: AsmA; pfam05170"
                     /db_xref="CDD:253057"
     misc_feature    complement(366260..366826)
                     /locus_tag="PPUBIRD1_0316"
                     /note="AsmA-like C-terminal region; Region: AsmA_2;
                     pfam13502"
                     /db_xref="CDD:257822"
     gene            368520..370181
                     /locus_tag="PPUBIRD1_0317"
                     /db_xref="GeneID:12518550"
     CDS             368520..370181
                     /locus_tag="PPUBIRD1_0317"
                     /codon_start=1
                     /transl_table=11
                     /product="Major facilitator transporter"
                     /protein_id="YP_005928223.1"
                     /db_xref="GI:386009946"
                     /db_xref="GeneID:12518550"
                     /translation="MTSTVATGTLASEPGFLSKERIIARPGFNRWLVPPAALAIHLCI
                     GMAYGFSVFWLPLSQALGITAPVACAADMGFMARMFSAECDWPISMLSWIYTLFFVFL
                     GCSAAVLGGWLEHAGPRKAGLVSALCWCGGMLLSAIGVKTHQLWLMWLGSGVIGGIGL
                     GLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQ
                     SFVAMAAIYFVFMTAGALAYRVPPTGWKPEGWAAPLKNASNAMVTDRHVHVSVAWKTP
                     QFALIWLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLSTAQLAQIAAIAA
                     GFTGLLSLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVA
                     AFCIILSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLREYQ
                     LAAGVERAAAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGA
                     DGARSLEWKAAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
     misc_feature    368754..369953
                     /locus_tag="PPUBIRD1_0317"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    368775..370004
                     /locus_tag="PPUBIRD1_0317"
                     /note="oxalate/formate antiporter; Region:
                     oxa_formateAnti; TIGR04259"
                     /db_xref="CDD:234525"
     misc_feature    order(368802..368804,368811..368816,368823..368825,
                     368835..368840,368844..368849,368994..368999,
                     369006..369011,369018..369023,369030..369032,
                     369066..369071,369078..369083,369099..369101,
                     369384..369386,369393..369398,369405..369410,
                     369417..369419,369516..369518,369528..369530,
                     369540..369542,369549..369551,369561..369563,
                     369711..369713,369720..369725,369732..369734,
                     369744..369749,369756..369758,369789..369794,
                     369801..369806,369813..369818,369825..369827)
                     /locus_tag="PPUBIRD1_0317"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            370331..370963
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /db_xref="GeneID:12518551"
     CDS             370331..370963
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /EC_number="4.2.1.19"
                     /note="imidazoleglycerol-phosphate dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisB"
                     /protein_id="YP_005928224.1"
                     /db_xref="GI:386009947"
                     /db_xref="GeneID:12518551"
                     /translation="MKPFSPNDFAELVMVERKASVERNTLETQVKCSINLDGSGKARF
                     DIGVPFLEHMLDQIARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKG
                     IFRYGHAYVPLDEALSRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHA
                     LVTLHIDNLRGHNTHHQIETVFKAFGRALRMAITLDERMAGQMPSTKGCL"
     misc_feature    370385..370960
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /note="Imidazoleglycerol-phosphate dehydratase; Region:
                     IGPD; cd07914"
                     /db_xref="CDD:153419"
     misc_feature    order(370409..370411,370487..370489,370499..370501,
                     370508..370513,370565..370570,370577..370579,
                     370643..370645,370667..370672,370709..370711,
                     370781..370783,370853..370858,370865..370867)
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:153419"
     misc_feature    order(370475..370480,370487..370489,370553..370561,
                     370565..370570,370742..370756,370763..370765,
                     370769..370771,370778..370783,370844..370858)
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /note="4-fold oligomerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:153419"
     misc_feature    order(370487..370489,370565..370570,370577..370579,
                     370781..370783,370853..370858,370865..370867)
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /note="metal binding residues [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153419"
     misc_feature    order(370640..370642,370646..370648,370652..370660,
                     370664..370672,370676..370681,370691..370699,
                     370709..370711,370715..370717,370817..370819,
                     370823..370825,370829..370831,370835..370837,
                     370889..370891,370898..370900,370916..370918)
                     /gene="hisB"
                     /locus_tag="PPUBIRD1_0318"
                     /note="3-fold/trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:153419"
     gene            370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /db_xref="GeneID:12518552"
     CDS             370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="Imidazole glycerol phosphate synthase subunit hisH"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisH"
                     /protein_id="YP_005928225.1"
                     /db_xref="GI:386009948"
                     /db_xref="GeneID:12518552"
                     /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDASVIREADRV
                     VFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENTGVDCIGL
                     FPGQVRFFGKDLQEEGEHLKVPHMGWNEVSQTIDHPLWHDIPDRARFYFVHSYYINAG
                     KPGQVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFIAWDGRW"
     misc_feature    370973..371581
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in imidazole glycerol phosphate synthase (IGPS);
                     Region: GATase1_IGP_Synthase; cd01748"
                     /db_xref="CDD:153219"
     misc_feature    370973..371569
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="imidazole glycerol phosphate synthase subunit HisH;
                     Provisional; Region: hisH; PRK13142"
                     /db_xref="CDD:171871"
     misc_feature    order(371090..371113,371198..371212,371531..371533,
                     371537..371539)
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="putative active site [active]"
                     /db_xref="CDD:153219"
     misc_feature    371090..371113
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="oxyanion strand; other site"
                     /db_xref="CDD:153219"
     misc_feature    order(371204..371206,371531..371533,371537..371539)
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_0319"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153219"
     gene            371603..371863
                     /locus_tag="PPUBIRD1_0320"
                     /db_xref="GeneID:12518553"
     CDS             371603..371863
                     /locus_tag="PPUBIRD1_0320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928226.1"
                     /db_xref="GI:386009949"
                     /db_xref="GeneID:12518553"
                     /translation="MSRSKTKAPTITLAPEQEREALDTLKRFLEDRFELQLGSFEVAE
                     VLELFSKEIAPHYYNRAIADVQLHLKERFESIESDLWALEKP"
     misc_feature    371633..371860
                     /locus_tag="PPUBIRD1_0320"
                     /note="Uncharacterized conserved protein (DUF2164);
                     Region: DUF2164; pfam09932"
                     /db_xref="CDD:204345"
     gene            371891..372628
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_0321"
                     /db_xref="GeneID:12518554"
     CDS             371891..372628
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_0321"
                     /EC_number="5.3.1.16"
                     /note="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="HisA"
                     /protein_id="YP_005928227.1"
                     /db_xref="GI:386009950"
                     /db_xref="GeneID:12518554"
                     /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGC
                     RRLHLVDLNGAFEGQPVNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVI
                     IGTKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLAKRFEADG
                     VSAIVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGII
                     GAITGRAIYEGTLDVAEAQAFCDNYQG"
     misc_feature    371894..372604
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_0321"
                     /note="HisA.  Phosphoribosylformimino-5-aminoimidazole
                     carboxamide ribonucleotide (ProFAR) isomerase catalyzes
                     the fourth step in histidine biosynthesis, an
                     isomerisation of the aminoaldose moiety of ProFAR to the
                     aminoketose of PRFAR (N-(5'-phospho-D-1...; Region: HisA;
                     cd04732"
                     /db_xref="CDD:240083"
     misc_feature    order(371912..371914,372032..372034,372278..372280)
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_0321"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:240083"
     gene            372639..373409
                     /gene="hisF"
                     /locus_tag="PPUBIRD1_0322"
                     /db_xref="GeneID:12518555"
     CDS             372639..373409
                     /gene="hisF"
                     /locus_tag="PPUBIRD1_0322"
                     /note="Imidazole glycerol phosphate synthase subunit hisF"
                     /codon_start=1
                     /transl_table=11
                     /product="protein HisF"
                     /protein_id="YP_005928228.1"
                     /db_xref="GI:386009951"
                     /db_xref="GeneID:12518555"
                     /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQG
                     ADEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVS
                     INTAAVFNPEFVGEAAERFGSQCIVVAIDAKKVSGPGEAPRWEIFTHGGRKPTGLDAV
                     EWAKKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLAD
                     GILEGHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
     misc_feature    372651..373391
                     /gene="hisF"
                     /locus_tag="PPUBIRD1_0322"
                     /note="The cyclase subunit of imidazoleglycerol phosphate
                     synthase (HisF). Imidazole glycerol phosphate synthase
                     (IGPS) catalyzes the fifth step of histidine biosynthesis,
                     the formation of the imidazole ring. IGPS converts
                     N1-(5'-phosphoribulosyl)...; Region: HisF; cd04731"
                     /db_xref="CDD:240082"
     misc_feature    order(372696..372698,372789..372791,372885..372887,
                     372948..372953,373023..373025,373029..373031,
                     373086..373088,373167..373169,373182..373187,
                     373257..373265,373329..373334)
                     /gene="hisF"
                     /locus_tag="PPUBIRD1_0322"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240082"
     misc_feature    order(372759..372761,372774..372776,372840..372842,
                     372852..372854,372861..372863,372867..372869,
                     372924..372926,372933..372938,373008..373010,
                     373155..373157,373239..373241,373314..373316)
                     /gene="hisF"
                     /locus_tag="PPUBIRD1_0322"
                     /note="glutamase interaction surface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:240082"
     gene            complement(373584..374762)
                     /locus_tag="PPUBIRD1_0323"
                     /db_xref="GeneID:12518556"
     CDS             complement(373584..374762)
                     /locus_tag="PPUBIRD1_0323"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycine betaine/L-proline ABC transporter,
                     ATP-binding subunit"
                     /protein_id="YP_005928229.1"
                     /db_xref="GI:386009952"
                     /db_xref="GeneID:12518556"
                     /translation="MSIIRFEDVDVIFSNKPREALALLDQGQTREQILKQTGLVVGVE
                     KANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIANCSAAE
                     LKMMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQW
                     RNKKPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLS
                     KTIVFVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNV
                     LCGRSLMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQKWAPGQD
                     VELLERRPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG
                     "
     misc_feature    complement(373596..374753)
                     /locus_tag="PPUBIRD1_0323"
                     /note="choline ABC transporter, ATP-binding protein;
                     Region: ABC_choXWV_ATP; TIGR03415"
                     /db_xref="CDD:188317"
     misc_feature    complement(373935..374753)
                     /locus_tag="PPUBIRD1_0323"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(374562..374585)
                     /locus_tag="PPUBIRD1_0323"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(374085..374087,374184..374189,
                     374415..374417,374559..374567,374571..374576))
                     /locus_tag="PPUBIRD1_0323"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(374415..374426)
                     /locus_tag="PPUBIRD1_0323"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(374232..374261)
                     /locus_tag="PPUBIRD1_0323"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(374184..374201)
                     /locus_tag="PPUBIRD1_0323"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(374166..374177)
                     /locus_tag="PPUBIRD1_0323"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(374079..374099)
                     /locus_tag="PPUBIRD1_0323"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(374759..375604)
                     /locus_tag="PPUBIRD1_0324"
                     /db_xref="GeneID:12518557"
     CDS             complement(374759..375604)
                     /locus_tag="PPUBIRD1_0324"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycine betaine/L-proline ABC transporter,
                     permease protein"
                     /protein_id="YP_005928230.1"
                     /db_xref="GI:386009953"
                     /db_xref="GeneID:12518557"
                     /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTS
                     ALTFFNPFVLIALFAALAHFIQRKWALTAFVALSFLLILNLGYWQETMETLAQVTFAT
                     VVCVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLIST
                     VVFAIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCI
                     MLSLSMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELP
                     VRGEA"
     misc_feature    complement(374807..375325)
                     /locus_tag="PPUBIRD1_0324"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(374807..374812,374819..374824,
                     374828..374833,374840..374845,374873..374878,
                     374915..374920,374927..374938,374957..374959,
                     374966..374971,375011..375013,375062..375064,
                     375071..375076,375086..375088,375092..375097,
                     375104..375106,375110..375112,375116..375121,
                     375167..375169,375173..375178,375185..375214,
                     375218..375229,375254..375256,375269..375274,
                     375281..375286))
                     /locus_tag="PPUBIRD1_0324"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(374921..374938,375167..375211))
                     /locus_tag="PPUBIRD1_0324"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(374843..374845,374873..374875,
                     374882..374884,374918..374920,375134..375136,
                     375167..375169))
                     /locus_tag="PPUBIRD1_0324"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(374990..374992,375002..375007,
                     375023..375061))
                     /locus_tag="PPUBIRD1_0324"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(375689..376636)
                     /locus_tag="PPUBIRD1_0325"
                     /db_xref="GeneID:12518558"
     CDS             complement(375689..376636)
                     /locus_tag="PPUBIRD1_0325"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycine betaine/L-proline ABC transporter,
                     periplasmic binding protein"
                     /protein_id="YP_005928231.1"
                     /db_xref="GI:386009954"
                     /db_xref="GeneID:12518558"
                     /translation="MKGSPSLLLVALLSAPLLAQAAEPEQCQTVRFSDVGWTDITVTT
                     ATTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTV
                     ETVRANLENAKYTLAVPQALYDKGLKDFSDIPKFKKELNGKIYGIEPGNDGNRTIQSM
                     IDKNAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTG
                     GDEFFGPDFGKATVLTNTRKGYTQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPE
                     AAAKKWIKDNPGKLDAWLAGVTTVDGKPGLEAVKAKLTQ"
     misc_feature    complement(375698..376570)
                     /locus_tag="PPUBIRD1_0325"
                     /note="choline ABC transporter, periplasmic binding
                     protein; Region: ABC_choline_bnd; TIGR03414"
                     /db_xref="CDD:188316"
     gene            377089..378465
                     /gene="sda"
                     /locus_tag="PPUBIRD1_0326"
                     /db_xref="GeneID:12518559"
     CDS             377089..378465
                     /gene="sda"
                     /locus_tag="PPUBIRD1_0326"
                     /EC_number="4.3.1.17"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form"
                     /codon_start=1
                     /transl_table=11
                     /product="Sda"
                     /protein_id="YP_005928232.1"
                     /db_xref="GI:386009955"
                     /db_xref="GeneID:12518559"
                     /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVK
                     RIEVRLYGSLSATGIGHGTDNATIMGLMGEWPDAIDPTQIVPRIADLRETNTLQLDSR
                     LPIEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASG
                     VLDADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEEDIRAGLYKLWEAM
                     QECVNNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVN
                     EENAAGGRMVTAPTNGAAGIIPAVLHYYMRFSDEVDESSVVDYFLAAAAVGILCKKNA
                     SISGAEVGCQGEVGSACAMAAAGLAEVLGATPAQVENAAEIALEHNLGLTCDPVGGLV
                     QVPCIERNAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGG
                     LAVSAIEC"
     misc_feature    377095..378447
                     /gene="sda"
                     /locus_tag="PPUBIRD1_0326"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form; Region: sda_mono; TIGR00720"
                     /db_xref="CDD:188076"
     misc_feature    377119..377562
                     /gene="sda"
                     /locus_tag="PPUBIRD1_0326"
                     /note="Serine dehydratase beta chain; Region: SDH_beta;
                     pfam03315"
                     /db_xref="CDD:251868"
     misc_feature    377638..378450
                     /gene="sda"
                     /locus_tag="PPUBIRD1_0326"
                     /note="Serine dehydratase alpha chain; Region: SDH_alpha;
                     pfam03313"
                     /db_xref="CDD:251866"
     gene            379028..380065
                     /locus_tag="PPUBIRD1_0327"
                     /db_xref="GeneID:12518560"
     CDS             379028..380065
                     /locus_tag="PPUBIRD1_0327"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005928233.1"
                     /db_xref="GI:386009956"
                     /db_xref="GeneID:12518560"
                     /translation="MDNFTLISLASAVEPLRMANQLSGRELYRWHTLTIDGGQVWASD
                     GLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREHVTWLQAQARQSRRLGAVCTGSWA
                     LACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRLFTLDRNRFTSSGGTAPLDMMLHL
                     ISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGTNQPKLQEIVALMEANLEEP
                     IDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLKLRLIRARQLLKQTPMSIIEVASV
                     CGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVAMMPIPQAMTLSPHSGPMAALSQA
                     RNESTFASVRL"
     misc_feature    379028..379567
                     /locus_tag="PPUBIRD1_0327"
                     /note="AraC transcriptional regulators having an
                     N-terminal Type 1 glutamine amidotransferase
                     (GATase1)-like domain; Region: GATase1_AraC_ArgR_like;
                     cd03136"
                     /db_xref="CDD:153230"
     misc_feature    379031..379930
                     /locus_tag="PPUBIRD1_0327"
                     /note="Transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain
                     [Transcription]; Region: COG4977"
                     /db_xref="CDD:227311"
     misc_feature    379316..379318
                     /locus_tag="PPUBIRD1_0327"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153230"
     misc_feature    379658..379777
                     /locus_tag="PPUBIRD1_0327"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    379820..379930
                     /locus_tag="PPUBIRD1_0327"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(380187..380444)
                     /locus_tag="PPUBIRD1_0328"
                     /db_xref="GeneID:12518561"
     CDS             complement(380187..380444)
                     /locus_tag="PPUBIRD1_0328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928234.1"
                     /db_xref="GI:386009957"
                     /db_xref="GeneID:12518561"
                     /translation="MMHADLIDQDDLAGHLRSRGFDIPAGASAEQACEAVVRGLTEPN
                     ARALKGMVEQMYTGSATILPAVRQAIDKQLLPALAQFNKRA"
     gene            380815..382479
                     /locus_tag="PPUBIRD1_0329"
                     /db_xref="GeneID:12518562"
     CDS             380815..382479
                     /locus_tag="PPUBIRD1_0329"
                     /codon_start=1
                     /transl_table=11
                     /product="Ricin B lectin"
                     /protein_id="YP_005928235.1"
                     /db_xref="GI:386009958"
                     /db_xref="GeneID:12518562"
                     /translation="MKKNICMIIVLGATLIMASCSSSTPQTSTVASVVPQLFTLQPTQ
                     NRQMLQKTAKGHLKTLLADPANEEFTLVNVDASLIGGNTENIAITLPNRKAEKFNRRN
                     FNVLADGYEGWVGYQPSKWKAGRSGAEAEIDFDPEYYMSIIRLGNQLAGNFLVDGQRY
                     RLVYIGSDTHVLIKVDESKLPSEDALGVDVGFPASPALEESQQVSSAYSIIRLLFVST
                     VQSRAKNPNYRADLMLGLQDVNQIAKNSKVDITYEFAGFIDSAIDEVGKDFGTLLNEV
                     QYNNPAVNAKRVELRADLVSMYVANSEFCGAGKPSSNKTQGFSAINCITSLAHEIGHN
                     FGMTHNWDGQSDNYIHGYRYAPDGGNLRFRTQMSANCSPTCPRVPFYSNPRLSYQGQP
                     LGTVAHHDVARAINERRASIESFYPPMPGVLKNKGRLDQGSTHPCLQDFAGSSIQFVA
                     CSPGPQQKWTLEPWGEAGTFRIVAPGGKCMVARADNYVLAESCPATVKDGLLWMVSAQ
                     PDHTLKIQSYNRNLCLGSQPSLKPGPELLTCDNGRYQSWINLDIPQ"
     misc_feature    <381616..382011
                     /locus_tag="PPUBIRD1_0329"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:260167"
     misc_feature    order(381799..381804,381811..381813,381829..381831)
                     /locus_tag="PPUBIRD1_0329"
                     /note="active site"
                     /db_xref="CDD:238124"
     misc_feature    382072..382455
                     /locus_tag="PPUBIRD1_0329"
                     /note="Ricin-type beta-trefoil lectin domain; Region:
                     Ricin_B_lectin; pfam00652"
                     /db_xref="CDD:250032"
     misc_feature    382075..382458
                     /locus_tag="PPUBIRD1_0329"
                     /note="Ricin-type beta-trefoil; Carbohydrate-binding
                     domain formed from presumed gene triplication. The domain
                     is found in a variety of molecules serving diverse
                     functions such as enzymatic activity, inhibitory toxicity
                     and signal transduction. Highly specific...; Region:
                     RICIN; cd00161"
                     /db_xref="CDD:238092"
     misc_feature    order(382129..382131,382153..382155,382159..382161,
                     382180..382185,382255..382257,382279..382281,
                     382285..382287,382312..382317,382387..382389,
                     382423..382425,382447..382449)
                     /locus_tag="PPUBIRD1_0329"
                     /note="putative sugar binding sites [chemical binding];
                     other site"
                     /db_xref="CDD:238092"
     misc_feature    order(382183..382191,382315..382323,382447..382455)
                     /locus_tag="PPUBIRD1_0329"
                     /note="Q-X-W motif; other site"
                     /db_xref="CDD:238092"
     gene            complement(382524..382994)
                     /locus_tag="PPUBIRD1_0330"
                     /db_xref="GeneID:12518563"
     CDS             complement(382524..382994)
                     /locus_tag="PPUBIRD1_0330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928236.1"
                     /db_xref="GI:386009959"
                     /db_xref="GeneID:12518563"
                     /translation="MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGL
                     DADSRGQSGNSLFTLEAHINYLHEVKLATEVWVQTQIIGFDKKRLHLYHSLHRSGFDE
                     ALAASEQLLLHVDLAGPKAKPFGESSTHRLQSVVDDQRDLPTPAFTGRVIKIPS"
     misc_feature    complement(382650..382979)
                     /locus_tag="PPUBIRD1_0330"
                     /note="4-hydroxybenzoyl-CoA thioesterase (4HBT). Catalyzes
                     the final step in the 4-chlorobenzoate degradation pathway
                     in which 4-chlorobenzoate is converted to
                     4-hydroxybenzoate in certain soil-dwelling bacteria. 4HBT
                     forms a homotetramer with four active sites; Region: 4HBT;
                     cd00586"
                     /db_xref="CDD:238329"
     misc_feature    complement(order(382731..382742,382821..382823,
                     382827..382829,382899..382901))
                     /locus_tag="PPUBIRD1_0330"
                     /note="active site"
                     /db_xref="CDD:238329"
     gene            complement(383005..383970)
                     /locus_tag="PPUBIRD1_0331"
                     /db_xref="GeneID:12518564"
     CDS             complement(383005..383970)
                     /locus_tag="PPUBIRD1_0331"
                     /EC_number="1.1.1.45"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="YP_005928237.1"
                     /db_xref="GI:386009960"
                     /db_xref="GeneID:12518564"
                     /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQ
                     ALRKRIANAWPALEKQGLAPGASQDRLKFVATIEECVHDADFIQESAPERLDLKLELH
                     AKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT
                     SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDD
                     AIRFGAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDD
                     VVDGTSEQLGEHSIAALERYRDDTLLAVLEAVKTSKASHGMSFGD"
     misc_feature    complement(383008..383970)
                     /locus_tag="PPUBIRD1_0331"
                     /note="3-hydroxybutyryl-CoA dehydrogenase; Validated;
                     Region: PRK07066"
                     /db_xref="CDD:168796"
     misc_feature    complement(383422..383940)
                     /locus_tag="PPUBIRD1_0331"
                     /note="3-hydroxyacyl-CoA dehydrogenase, NAD binding
                     domain; Region: 3HCDH_N; pfam02737"
                     /db_xref="CDD:251505"
     misc_feature    complement(383155..383409)
                     /locus_tag="PPUBIRD1_0331"
                     /note="3-hydroxyacyl-CoA dehydrogenase, C-terminal domain;
                     Region: 3HCDH; pfam00725"
                     /db_xref="CDD:250086"
     gene            complement(384133..385017)
                     /locus_tag="PPUBIRD1_0332"
                     /db_xref="GeneID:12518565"
     CDS             complement(384133..385017)
                     /locus_tag="PPUBIRD1_0332"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928238.1"
                     /db_xref="GI:386009961"
                     /db_xref="GeneID:12518565"
                     /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGAT
                     VVHCHVRDPQTGRFSRDVNLYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAF
                     GPGTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELG
                     VKAELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANV
                     TWAGFGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMG
                     GRVLSPAEGREKMNLKRR"
     misc_feature    complement(384145..385005)
                     /locus_tag="PPUBIRD1_0332"
                     /note="Prokaryotic protein of unknown function (DUF849);
                     Region: DUF849; pfam05853"
                     /db_xref="CDD:253423"
     gene            complement(385141..386085)
                     /locus_tag="PPUBIRD1_0333"
                     /db_xref="GeneID:12518566"
     CDS             complement(385141..386085)
                     /locus_tag="PPUBIRD1_0333"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="YP_005928239.1"
                     /db_xref="GI:386009962"
                     /db_xref="GeneID:12518566"
                     /translation="MHSLIRRSLLPLALSSIVATPLFAAEPAACKNVRLGVVNWTDVI
                     ATSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDAN
                     QVKVLDKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQI
                     KAMITKNQFDLGKFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLG
                     DSQDALGPDEGRATVWTVTAPDYAERCPNAHRLLANLKFSAEDESRMMQPLLDHKDAL
                     ESARQWLKDHPEDKARWLEGVTTFDGKPAADNLKLTAN"
     misc_feature    complement(385156..386016)
                     /locus_tag="PPUBIRD1_0333"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            386233..387177
                     /locus_tag="PPUBIRD1_0334"
                     /db_xref="GeneID:12518567"
     CDS             386233..387177
                     /locus_tag="PPUBIRD1_0334"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_005928240.1"
                     /db_xref="GI:386009963"
                     /db_xref="GeneID:12518567"
                     /translation="METIAFLLVPGFSAMGFISAVEPLRVANRFGGQLYRWQVLSLDG
                     EAVLASNGMSINADAALGEGEPANILLVVAGFEPLANVAPKLLHALRRLNHEAVMLGG
                     IDTGAMVLAEAGLLEGYRATLHWEALEAFKERYPGLQATQELFEIDRSRITCAGGTAS
                     IDLMLHLIAQSHGSELAVKVSEQFVLGRIRQRQDHQRMQIGARYGISNKKLVHAIGEM
                     EKHIEPPLTTLELAAAIKVTRRQLERLFRMHLDATPSGFYLGLRLDKARQLLAQTDMS
                     VTEVSLACGFELPSYFTRRYKLRFGRCPREERRPSGTK"
     misc_feature    386242..387174
                     /locus_tag="PPUBIRD1_0334"
                     /note="Transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain
                     [Transcription]; Region: COG4977"
                     /db_xref="CDD:227311"
     misc_feature    386242..386793
                     /locus_tag="PPUBIRD1_0334"
                     /note="AraC transcriptional regulators having an
                     N-terminal Type 1 glutamine amidotransferase
                     (GATase1)-like domain; Region: GATase1_AraC_ArgR_like;
                     cd03136"
                     /db_xref="CDD:153230"
     misc_feature    386542..386544
                     /locus_tag="PPUBIRD1_0334"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153230"
     misc_feature    387046..387159
                     /locus_tag="PPUBIRD1_0334"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(387181..387798)
                     /locus_tag="PPUBIRD1_0335"
                     /db_xref="GeneID:12518568"
     CDS             complement(387181..387798)
                     /locus_tag="PPUBIRD1_0335"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928241.1"
                     /db_xref="GI:386009964"
                     /db_xref="GeneID:12518568"
                     /translation="MGDTSLDTRIFEERLSIKPAPWLTLDTWEDLQLCLRYSQAVANE
                     KYSMETQPQQWFTVARATLQSLKFTLFEHTHRTIVYEPNLLALSDVYSGYLPPPREKG
                     PWFKSLEENVQAALQSAGTRTFTVMNASSHLSIEMDHEGDHVPVAILFYAYCITDPVE
                     PTRKLNLVFDHLGARFNAAGFAPLREDLQARNREKLRAILERELD"
     gene            complement(387872..388564)
                     /locus_tag="PPUBIRD1_0336"
                     /db_xref="GeneID:12518569"
     CDS             complement(387872..388564)
                     /locus_tag="PPUBIRD1_0336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928242.1"
                     /db_xref="GI:386009965"
                     /db_xref="GeneID:12518569"
                     /translation="MADIKVEMEKIRKEGQERVAATGQTICIFADNVPANIAEDILAG
                     MRLMTELANKKFDKETQQREWYNFYNDGLIKFGWTMTGAAHAEDAIDEDNLTLAELIT
                     KSVTISVSADPRRAACARRVLQIVVQKPEVKAHLEKHSHSESGKSSNFVVAQCEMTPQ
                     GLPAMHMTSFQASYDSKVEREGALTRKVDKTSTRVYRASQQGTFSVRHFDAARDLVNE
                     KIKGDLGAFLAI"
     gene            complement(388703..389119)
                     /locus_tag="PPUBIRD1_0337"
                     /db_xref="GeneID:12518570"
     CDS             complement(388703..389119)
                     /locus_tag="PPUBIRD1_0337"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928243.1"
                     /db_xref="GI:386009966"
                     /db_xref="GeneID:12518570"
                     /translation="MKSMAWLVLLAIVSGAQAGEEESTPCDNVENDQQTFACAAFNKQ
                     VAERELQSAYDDLVARMRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSN
                     AYQIAWNSCIAQRSDERAEYLRSLGSQNSDEPAPED"
     misc_feature    complement(388751..389047)
                     /locus_tag="PPUBIRD1_0337"
                     /note="Protein of unknown function (DUF1311); Region:
                     DUF1311; pfam07007"
                     /db_xref="CDD:254020"
     gene            389405..390382
                     /locus_tag="PPUBIRD1_0338"
                     /db_xref="GeneID:12518571"
     CDS             389405..390382
                     /locus_tag="PPUBIRD1_0338"
                     /EC_number="3.4.13.19"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane dipeptidase"
                     /protein_id="YP_005928244.1"
                     /db_xref="GI:386009967"
                     /db_xref="GeneID:12518571"
                     /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVW
                     EGFKATVDNIASSQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQI
                     AYVDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHV
                     GSKTSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLA
                     KGIDSTIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFG
                     KIINPLGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
     misc_feature    389420..390367
                     /locus_tag="PPUBIRD1_0338"
                     /note="Membrane dipeptidase (Peptidase family M19);
                     Region: Peptidase_M19; pfam01244"
                     /db_xref="CDD:250472"
     misc_feature    order(389876..389878,389942..389944,390149..390151)
                     /locus_tag="PPUBIRD1_0338"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            390458..390988
                     /locus_tag="PPUBIRD1_0339"
                     /db_xref="GeneID:12518572"
     CDS             390458..390988
                     /locus_tag="PPUBIRD1_0339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928245.1"
                     /db_xref="GI:386009968"
                     /db_xref="GeneID:12518572"
                     /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHMGIEEV
                     LGADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDID
                     LDKGTCSVKLKHSAFVYVYGKCGRKVDYMFTGWFAGAMDQILAARGSKIRTVAEQVYG
                     GSEEGHEDGLFVTKPL"
     misc_feature    390785..390982
                     /locus_tag="PPUBIRD1_0339"
                     /note="V4R domain; Region: V4R; cl15268"
                     /db_xref="CDD:246915"
     gene            391004..393064
                     /locus_tag="PPUBIRD1_0340"
                     /db_xref="GeneID:12518573"
     CDS             391004..393064
                     /locus_tag="PPUBIRD1_0340"
                     /codon_start=1
                     /transl_table=11
                     /product="Oxidoreductase, FMN-binding protein"
                     /protein_id="YP_005928246.1"
                     /db_xref="GI:386009969"
                     /db_xref="GeneID:12518573"
                     /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKY
                     YEEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIM
                     IQITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAK
                     EGGLDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDF
                     CVGMRICGDEFHPDGLSHEDMKQIAAYYDATGMLDFIGVVGSGCDTHNTLANVIPNMS
                     YPPEPFLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLI
                     AKIKMGQIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRK
                     VVVVGAGPAGMEAARVAAERGHDVTLFEKRDQIGGQITIAAKAPQRDQIAGITRWYQL
                     ELARLKVDLRLGTAADVAAIQDLRPDVIVLAVGGHSFLEQNEHWGAAEGLVVSSWDVL
                     DGKVAPGKNVLVYDTICEFTGMSVADFIADKGSQVEIVTDDIKPGVAMGGTTFPTYYR
                     SMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEELY
                     YALKEGSRNKGQIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRL
                     CKDF"
     misc_feature    391019..393046
                     /locus_tag="PPUBIRD1_0340"
                     /note="mycofactocin system FadH/OYE family oxidoreductase
                     2; Region: mycofact_OYE_2; TIGR03997"
                     /db_xref="CDD:234436"
     misc_feature    391019..392059
                     /locus_tag="PPUBIRD1_0340"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 3. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_3_FMN; cd04734"
                     /db_xref="CDD:240085"
     misc_feature    order(391076..391078,391082..391084,391181..391183,
                     391313..391315,391526..391528,391670..391672,
                     391973..391978)
                     /locus_tag="PPUBIRD1_0340"
                     /note="putative active site [active]"
                     /db_xref="CDD:240085"
     misc_feature    order(391076..391078,391082..391084,391181..391183,
                     391313..391315,391670..391672,391973..391978)
                     /locus_tag="PPUBIRD1_0340"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240085"
     misc_feature    order(391520..391522,391526..391528)
                     /locus_tag="PPUBIRD1_0340"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240085"
     misc_feature    391526..391528
                     /locus_tag="PPUBIRD1_0340"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240085"
     misc_feature    392195..>392293
                     /locus_tag="PPUBIRD1_0340"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     gene            393243..395195
                     /locus_tag="PPUBIRD1_0341"
                     /db_xref="GeneID:12518574"
     CDS             393243..395195
                     /locus_tag="PPUBIRD1_0341"
                     /codon_start=1
                     /transl_table=11
                     /product="Iron-sulfur cluster-binding protein"
                     /protein_id="YP_005928247.1"
                     /db_xref="GI:386009970"
                     /db_xref="GeneID:12518574"
                     /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRPSKVNLIGGLLA
                     MPRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAVLAILVHGFGLQSKILGYALLVAT
                     VIMFTGAIFVFKRRLNPPSRLSKGPWMRLPKSLLAFAVSFFIATLPVAGILPANTGGW
                     VMVAVLGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLD
                     LEDPNAPLGVEKPVDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIG
                     LAGGTDAQFAGSPYPGKPIGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIE
                     HVDAIVDMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLQLLSE
                     VKATEVLFWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEA
                     TFQQLAKRNIQTLAKYKFQRIVTCDPHSFHVLKNEYGALGGDYQVQHHSTYIAELIAA
                     KKLNLGQHKGGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGG
                     GGAPITDIPGKQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELV
                     ADVLIEEDASTVPKPQTAKREPAEVH"
     misc_feature    393243..393908
                     /locus_tag="PPUBIRD1_0341"
                     /note="Domain of unknown function (DUF3483); Region:
                     DUF3483; pfam11982"
                     /db_xref="CDD:192905"
     misc_feature    393945..395135
                     /locus_tag="PPUBIRD1_0341"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    393966..394241
                     /locus_tag="PPUBIRD1_0341"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    394434..394691
                     /locus_tag="PPUBIRD1_0341"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    394803..395066
                     /locus_tag="PPUBIRD1_0341"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            395195..396427
                     /locus_tag="PPUBIRD1_0342"
                     /db_xref="GeneID:12518575"
     CDS             395195..396427
                     /locus_tag="PPUBIRD1_0342"
                     /codon_start=1
                     /transl_table=11
                     /product="Electron transfer flavoprotein, alpha
                     subunit-like protein"
                     /protein_id="YP_005928248.1"
                     /db_xref="GI:386009971"
                     /db_xref="GeneID:12518575"
                     /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTSWMGPNGIIRKNP
                     HAIAAGFVGPAGIKRIDRSGAQQGTGAGGRRTAAAEVKLPLHQVAAPAFYIAVVPDMV
                     GGRLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKESNFSTAGVDRLLVIEGEAFEGYA
                     PEQLVQGLRAVDNQFAPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQVKDGQCIG
                     RAGAGQQDLQRAVPRLILAAAECAEPVSETRHEALPVELSTSVVRSLPRIEDLGSVAV
                     DPATIAMAEAEFIVSGGNGVKDWDLYHKATAALGATEGASRVAVDDGFMPRNRQVGAT
                     GTWVTARVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILK
                     ALIEAVDNYRSGGQRDAA"
     misc_feature    order(395474..395479,395513..395524,395585..395587)
                     /locus_tag="PPUBIRD1_0342"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     misc_feature    395477..396397
                     /locus_tag="PPUBIRD1_0342"
                     /note="Electron transfer flavoprotein, alpha subunit
                     [Energy production and conversion]; Region: FixB; COG2025"
                     /db_xref="CDD:224936"
     misc_feature    395477..>395749
                     /locus_tag="PPUBIRD1_0342"
                     /note="Electron transfer flavoprotein domain; Region: ETF;
                     pfam01012"
                     /db_xref="CDD:250293"
     misc_feature    396041..396268
                     /locus_tag="PPUBIRD1_0342"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            396450..397208
                     /locus_tag="PPUBIRD1_0343"
                     /db_xref="GeneID:12518576"
     CDS             396450..397208
                     /locus_tag="PPUBIRD1_0343"
                     /codon_start=1
                     /transl_table=11
                     /product="Electron transfer flavoprotein,
                     alpha/beta-subunit-like protein"
                     /protein_id="YP_005928249.1"
                     /db_xref="GI:386009972"
                     /db_xref="GeneID:12518576"
                     /translation="MISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVVHAGD
                     PQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGEGSGM
                     LPFLLAEKLGWPLIVGLAEVESIDNGTAQVLQALPRGQRRRLKVRLPLLATVDNAAPK
                     PRQSAFGPARRGVLAARNVAIVEDELLAEAELQPARPRPKRLKVIKAKSGADRMKAAT
                     AKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
     misc_feature    396462..397205
                     /locus_tag="PPUBIRD1_0343"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases, ATP sulphurylases Universal
                     Stress Response protein and electron transfer flavoprotein
                     (ETF). The domain forms a apha/beta/apha fold which  binds
                     to Adenosine nucleotide; Region: AANH_like; cl00292"
                     /db_xref="CDD:260331"
     misc_feature    order(396507..396515,396570..396572,396576..396578)
                     /locus_tag="PPUBIRD1_0343"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238942"
     gene            complement(398762..400054)
                     /locus_tag="PPUBIRD1_0344"
                     /db_xref="GeneID:12518577"
     CDS             complement(398762..400054)
                     /locus_tag="PPUBIRD1_0344"
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske (2Fe-2S) domain-containing protein"
                     /protein_id="YP_005928250.1"
                     /db_xref="GI:386009973"
                     /db_xref="GeneID:12518577"
                     /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLF
                     QIDMQEIFHKEWLIAGMTCEIPAKGNYITLQIGKNPIIVVRGAEGKVHAFHNVCRHRG
                     SRLCVSEKGKVAKLVCPYHQWTYELDGRLLFAGTEMGADFDMNQYGLKPVNVKVAGGY
                     IFISLAENPPAIDEFLATLDHYMEPYDMENTKVAVQTTLMEKANWKLVLENNRECYHC
                     NGSHPELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRM
                     PLLKGTVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPIS
                     AQETMVTTKWLVHKDAVEGVDYNPENMRKVWDATNDQDRRLAEENQRGINSTAYQPGP
                     YSKTYEFGVVNFIDWYSGRLLNNLGAEPAPYLKEVQAQ"
     misc_feature    complement(398786..399961)
                     /locus_tag="PPUBIRD1_0344"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    complement(399542..399889)
                     /locus_tag="PPUBIRD1_0344"
                     /note="Rieske non-heme iron oxygenase (RO) family,
                     N-terminal Rieske domain of the oxygenase alpha subunit;
                     The RO family comprise a large class of aromatic
                     ring-hydroxylating dioxygenases found predominantly in
                     microorganisms. These enzymes enable...; Region:
                     Rieske_RO_Alpha_N; cd03469"
                     /db_xref="CDD:239551"
     misc_feature    complement(order(399686..399688,399692..399694,
                     399701..399703,399752..399757,399761..399763))
                     /locus_tag="PPUBIRD1_0344"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239551"
     misc_feature    complement(398819..399502)
                     /locus_tag="PPUBIRD1_0344"
                     /note="C-terminal catalytic domain of GbcA (glycine
                     betaine catabolism A) from Pseudomonas aeruginosa PAO1 and
                     related aromatic ring hydroxylating dioxygenases; Region:
                     RHO_alpha_C_GbcA-like; cd08884"
                     /db_xref="CDD:176893"
     misc_feature    complement(order(398831..398833,398843..398845,
                     398852..398854,398864..398866,398870..398878,
                     398909..398923,398927..398935,399044..399049,
                     399392..399394,399404..399409,399413..399415,
                     399422..399427,399434..399436,399446..399451))
                     /locus_tag="PPUBIRD1_0344"
                     /note="putative alpha subunit interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176893"
     misc_feature    complement(order(398939..398941,398948..398953,
                     398969..398974,398981..398983,399071..399073,
                     399077..399079,399098..399100,399104..399106,
                     399128..399130,399134..399139,399389..399391,
                     399401..399406,399410..399415,399419..399424))
                     /locus_tag="PPUBIRD1_0344"
                     /note="putative active site [active]"
                     /db_xref="CDD:176893"
     misc_feature    complement(order(398948..398953,398969..398974,
                     398981..398983,399071..399073,399077..399079,
                     399098..399100,399104..399106,399128..399130,
                     399134..399139,399389..399391,399401..399406,
                     399410..399415,399419..399424))
                     /locus_tag="PPUBIRD1_0344"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176893"
     misc_feature    complement(order(398939..398941,399389..399391,
                     399404..399406))
                     /locus_tag="PPUBIRD1_0344"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:176893"
     gene            400350..401450
                     /locus_tag="PPUBIRD1_0346"
                     /db_xref="GeneID:12518578"
     CDS             400350..401450
                     /locus_tag="PPUBIRD1_0346"
                     /codon_start=1
                     /transl_table=11
                     /product="Oxidoreductase FAD-binding domain-containing
                     protein"
                     /protein_id="YP_005928251.1"
                     /db_xref="GI:386009974"
                     /db_xref="GeneID:12518578"
                     /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPI
                     MFFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMH
                     EGLELPVHGPVGLFNAIDFPSGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSA
                     RSPKDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYME
                     RVVFCCGPTPYMTAVKRLLEAVGFDMANYHEESFGATPAEAKADAVEHAEQAADAPEL
                     DVSDLNLVEFIGSEKSIRIAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVE
                     MEHNGGITEEDEAEGYILSCCSVPKGDVRIDY"
     misc_feature    400389..401264
                     /locus_tag="PPUBIRD1_0346"
                     /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
                     family 1 [Energy production and conversion]; Region: Hmp;
                     COG1018"
                     /db_xref="CDD:223949"
     misc_feature    400410..401105
                     /locus_tag="PPUBIRD1_0346"
                     /note="Iron-sulfur binding ferredoxin reductase (FNR)
                     proteins combine the FAD and NAD(P) binding regions of FNR
                     with an iron-sulfur binding cluster domain.
                     Ferredoxin-NADP+ (oxido)reductase is an FAD-containing
                     enzyme that catalyzes the reversible electron...; Region:
                     FNR_iron_sulfur_binding_1; cd06215"
                     /db_xref="CDD:99811"
     misc_feature    order(400506..400508,400548..400559,400599..400607,
                     400611..400613,400623..400631,400746..400748,
                     400755..400757,401097..401099,401103..401105)
                     /locus_tag="PPUBIRD1_0346"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(400548..400550,400554..400559)
                     /locus_tag="PPUBIRD1_0346"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(400620..400622,400629..400631,400638..400640,
                     400659..400661,400683..400685,400689..400691)
                     /locus_tag="PPUBIRD1_0346"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(400731..400733,400743..400754,400758..400760)
                     /locus_tag="PPUBIRD1_0346"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(400746..400751,400824..400832,401022..401027)
                     /locus_tag="PPUBIRD1_0346"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    401211..401444
                     /locus_tag="PPUBIRD1_0346"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(401283..401288,401295..401297,401304..401306,
                     401310..401321,401406..401411)
                     /locus_tag="PPUBIRD1_0346"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(401295..401297,401310..401312,401319..401321,
                     401409..401411)
                     /locus_tag="PPUBIRD1_0346"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            complement(401559..403184)
                     /locus_tag="PPUBIRD1_0347"
                     /db_xref="GeneID:12518579"
     CDS             complement(401559..403184)
                     /locus_tag="PPUBIRD1_0347"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_005928252.1"
                     /db_xref="GI:386009975"
                     /db_xref="GeneID:12518579"
                     /translation="MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAI
                     EQVSVPSIKILDELTALNLRMRTLSYRLLLNREPATQRDTLDLLDQRNSQIDRARQAY
                     LPMIVAADEQAAFDQYGQLLNQYRQLESRMRTLSQADRLDELRDLLNRDLLANSEQIN
                     KVMDTLVRINTDQTRATNEKAANQYAGAFALVIGLLVAATVLTFACAFLLTRSIVKPI
                     EEALKCAEQVADGDLTHVIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASA
                     AEELNAVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTG
                     DGRDLVMETVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNA
                     AIEAARAGEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTE
                     RAESTLNIARGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLS
                     VQSATGAHQTSAASAELSRLAVDLNGLVARFRT"
     misc_feature    complement(402630..403172)
                     /locus_tag="PPUBIRD1_0347"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(401562..402701)
                     /locus_tag="PPUBIRD1_0347"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    complement(402402..402545)
                     /locus_tag="PPUBIRD1_0347"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(402408..402413,402420..402425,
                     402429..402434,402441..402446,402450..402455,
                     402501..402503,402507..402512,402519..402524,
                     402528..402533,402540..402545))
                     /locus_tag="PPUBIRD1_0347"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(401670..402269)
                     /locus_tag="PPUBIRD1_0347"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(401673..401678,401685..401687,
                     401694..401699,401706..401708,401715..401720,
                     401724..401729,401736..401741,401745..401750,
                     401757..401759,401766..401771,401778..401780,
                     401787..401792,401799..401804,401808..401813,
                     401820..401822,401829..401834,401841..401843,
                     401850..401855,401892..401897,401904..401909,
                     401913..401918,401925..401930,401937..401939,
                     401946..401951,401958..401960,401967..401969,
                     401979..401981,402000..402002,402009..402011,
                     402021..402023,402030..402035,402042..402044,
                     402051..402053,402060..402065,402072..402077,
                     402084..402086,402093..402098,402102..402104,
                     402114..402119,402123..402128,402135..402137,
                     402144..402149,402156..402161,402168..402170,
                     402177..402182,402189..402191,402198..402203,
                     402207..402212,402219..402221,402228..402233,
                     402240..402245))
                     /locus_tag="PPUBIRD1_0347"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(401934..402035)
                     /locus_tag="PPUBIRD1_0347"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            403451..403681
                     /locus_tag="PPUBIRD1_0348"
                     /db_xref="GeneID:12518580"
     CDS             403451..403681
                     /locus_tag="PPUBIRD1_0348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928253.1"
                     /db_xref="GI:386009976"
                     /db_xref="GeneID:12518580"
                     /translation="MLEASLNQIEQLVSDLMQKNAQLIEQNTALGQELAQAKEENETL
                     QLSLMEQEEKNGATAARIQALVERASAGVVGA"
     gene            403678..403980
                     /locus_tag="PPUBIRD1_0349"
                     /db_xref="GeneID:12518581"
     CDS             403678..403980
                     /locus_tag="PPUBIRD1_0349"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928254.1"
                     /db_xref="GI:386009977"
                     /db_xref="GeneID:12518581"
                     /translation="MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNKALNET
                     KRQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAEQ"
     misc_feature    403708..403956
                     /locus_tag="PPUBIRD1_0349"
                     /note="Cell division protein ZapA; Region: ZapA;
                     pfam05164"
                     /db_xref="CDD:253055"
     gene            404162..406099
                     /locus_tag="PPUBIRD1_0350"
                     /db_xref="GeneID:12518582"
     CDS             404162..406099
                     /locus_tag="PPUBIRD1_0350"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_005928255.1"
                     /db_xref="GI:386009978"
                     /db_xref="GeneID:12518582"
                     /translation="MRIWRKSIQLQLITSMGAALLASILVVVIIFTVALNRLTDRYLV
                     DTALPASIEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEDPAQVPQFIEYLTAA
                     KQRNHAFTTLFASTETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERFINIDIDGA
                     TGELALFIDYRVEKEGKLVGVAGMGLRMTELSKLIHDFSFGEHGKVFLVRNDGLIQVH
                     PDAAFSGKRQLAEQLGADAAKGVMTGDESLRSSRFSRDGERYLALGLPLRDLNWTLVA
                     EVPESEIYAQMHQAVWLTSLIGGAVALVSLLLVVLLARGLVRPIRRVTAALVQIGGGA
                     GDLSHRLDDTRQDELGDLARGFNRFLDSQRSLIGEVLSTSERLRRAVEQVTQVVDNTA
                     ERSGRQQEMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVQRSIRG
                     IEGMSGDIGKAADAVSQLADEVASVDEVLAVIRSISEQTNLLALNAAIEAARAGEMGR
                     GFAVVADEVRTLARRTQLSTDEVQQMIQRLKLGAGSAVSSMQAGQQATGSGVESSQRT
                     GASLSAITDQVEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVRGCRE
                     ECQALRGLADDLARQMGGFRL"
     misc_feature    404630..404845
                     /locus_tag="PPUBIRD1_0350"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:251508"
     misc_feature    405113..405247
                     /locus_tag="PPUBIRD1_0350"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(405119..405124,405128..405133,405140..405145,
                     405149..405151,405203..405208,405212..405217,
                     405224..405229,405233..405238,405245..405247)
                     /locus_tag="PPUBIRD1_0350"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    405308..406093
                     /locus_tag="PPUBIRD1_0350"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    405389..405988
                     /locus_tag="PPUBIRD1_0350"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    order(405413..405418,405425..405430,405437..405439,
                     405446..405451,405455..405460,405467..405469,
                     405476..405481,405488..405490,405497..405502,
                     405509..405514,405521..405523,405530..405535,
                     405539..405544,405554..405556,405560..405565,
                     405572..405574,405581..405586,405593..405598,
                     405605..405607,405614..405616,405623..405628,
                     405635..405637,405647..405649,405656..405658,
                     405677..405679,405689..405691,405698..405700,
                     405707..405712,405719..405721,405728..405733,
                     405740..405745,405749..405754,405761..405766,
                     405803..405808,405815..405817,405824..405829,
                     405836..405838,405845..405850,405854..405859,
                     405866..405871,405878..405880,405887..405892,
                     405899..405901,405908..405913,405917..405922,
                     405929..405934,405938..405943,405950..405952,
                     405959..405964,405971..405973,405980..405985)
                     /locus_tag="PPUBIRD1_0350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    405623..405724
                     /locus_tag="PPUBIRD1_0350"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(406132..407172)
                     /locus_tag="PPUBIRD1_0351"
                     /db_xref="GeneID:12518583"
     CDS             complement(406132..407172)
                     /locus_tag="PPUBIRD1_0351"
                     /EC_number="4.1.2.5"
                     /codon_start=1
                     /transl_table=11
                     /product="Low specificity L-threonine aldolase"
                     /protein_id="YP_005928256.1"
                     /db_xref="GI:386009979"
                     /db_xref="GeneID:12518583"
                     /translation="MTDKSQQFASDNYSGICPEAWAAMEKANRGHDRAYGDDQWTERA
                     SEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFS
                     NGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAI
                     SATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILF
                     FNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVS
                     DLPGVELMFPVEANGVFLQMPEHAIEALRGKGWRFYTFIGSGGARFMCSWDTEEARVR
                     ELAADIRTIIGG"
     misc_feature    complement(406150..407154)
                     /locus_tag="PPUBIRD1_0351"
                     /note="Low-specificity threonine aldolase (TA). This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I).  TA
                     catalyzes the conversion of L-threonine or
                     L-allo-threonine to glycine and acetaldehyde in a...;
                     Region: TA_like; cd06502"
                     /db_xref="CDD:99748"
     misc_feature    complement(406279..407154)
                     /locus_tag="PPUBIRD1_0351"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(406237..406239,406441..406446,
                     406474..406479,406486..406491,406534..406536,
                     406552..406557,406849..406857,406879..406902,
                     406954..406956,406975..406980,406987..406989,
                     407095..407103,407110..407112,407128..407139,
                     407146..407148))
                     /locus_tag="PPUBIRD1_0351"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99748"
     misc_feature    complement(order(406552..406554,406561..406563,
                     406642..406644,406651..406653,406744..406746,
                     406969..406971,406978..406983))
                     /locus_tag="PPUBIRD1_0351"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99748"
     misc_feature    complement(406552..406554)
                     /locus_tag="PPUBIRD1_0351"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99748"
     gene            407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /db_xref="GeneID:12518584"
     CDS             407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /EC_number="2.1.2.1"
                     /note="Serine hydroxymethyltransferase 1"
                     /codon_start=1
                     /transl_table=11
                     /product="GlyA protein"
                     /protein_id="YP_005928257.1"
                     /db_xref="GI:386009980"
                     /db_xref="GeneID:12518584"
                     /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSKRVM
                     QAQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSAN
                     GAVYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGIDTNTGLIDYDEVE
                     RLAVEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPI
                     PFADVVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCF
                     KEALEPGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDAD
                     AALGRAHITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDN
                     LGDADVEADVAKNVAALCADFPVYR"
     misc_feature    407527..408723
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    order(407530..407532,407536..407538,407557..407562,
                     407587..407589,407602..407604,407656..407658,
                     407710..407715,407737..407739,407782..407784,
                     407803..407805,407908..407913,408289..408291,
                     408343..408345)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(407599..407601,407659..407661,407689..407691,
                     407788..407793,407872..407874,408022..408024,
                     408097..408099,408106..408108,408181..408186,
                     408202..408204,408583..408585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(407599..407601,407872..407874,408184..408186,
                     408583..408585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    order(407665..407667,407686..407688,407857..407859,
                     407869..407871,407875..407877,408265..408267,
                     408535..408537)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_0353"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            408766..410016
                     /gene="soxB"
                     /locus_tag="PPUBIRD1_0354"
                     /db_xref="GeneID:12518585"
     CDS             408766..410016
                     /gene="soxB"
                     /locus_tag="PPUBIRD1_0354"
                     /EC_number="1.5.3.1"
                     /note="sarcosine oxidase, beta subunit family"
                     /codon_start=1
                     /transl_table=11
                     /product="protein SoxB"
                     /protein_id="YP_005928258.1"
                     /db_xref="GI:386009981"
                     /db_xref="GeneID:12518585"
                     /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHG
                     LATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEG
                     LSQDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNTAQVAAEIPYL
                     DCSKNTRYPILGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGAV
                     IGVETNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIM
                     SNAVHGYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNR
                     QWGGIVDTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLA
                     APFSMDRFYNGALIDEHGAAAVAH"
     misc_feature    408772..409989
                     /gene="soxB"
                     /locus_tag="PPUBIRD1_0354"
                     /note="sarcosine oxidase, beta subunit family,
                     heterotetrameric form; Region: soxB; TIGR01373"
                     /db_xref="CDD:233383"
     misc_feature    408910..409926
                     /gene="soxB"
                     /locus_tag="PPUBIRD1_0354"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            410031..410366
                     /gene="soxD"
                     /locus_tag="PPUBIRD1_0355"
                     /db_xref="GeneID:12518586"
     CDS             410031..410366
                     /gene="soxD"
                     /locus_tag="PPUBIRD1_0355"
                     /EC_number="1.5.3.1"
                     /note="sarcosine oxidase, delta subunit family"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxD"
                     /protein_id="YP_005928259.1"
                     /db_xref="GI:386009982"
                     /db_xref="GeneID:12518586"
                     /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPNACSDEEWGTYM
                     FYRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTASGKATSAAS
                     TVKGQGEKV"
     misc_feature    410031..410315
                     /gene="soxD"
                     /locus_tag="PPUBIRD1_0355"
                     /note="Sarcosine oxidase delta subunit [Amino acid
                     transport and metabolism]; Region: SoxD; COG4311"
                     /db_xref="CDD:226761"
     gene            410363..413377
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /db_xref="GeneID:12518587"
     CDS             410363..413377
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /EC_number="1.5.3.1"
                     /note="Sarcosine oxidase subunit alpha"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxA_2"
                     /protein_id="YP_005928260.1"
                     /db_xref="GI:386009983"
                     /db_xref="GeneID:12518587"
                     /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANG
                     VDIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTN
                     GWPNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQND
                     PDSYDYMNRHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDTRETLDG
                     KPAADWVNAVVKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRH
                     RVHRVRAKRVVLAAGAHERPLVYGNNDVPGNMLAGAVSTYVRRYGVAPGRKLVLSTNN
                     DHAYRAALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVIEAKGSKHVT
                     GARVAAIDVQAHKVTSPGEILECDLIASSGGYSPIVHLASHLGGRPVWRDDILGFVPG
                     DAPQKRECVGGINGVYALGDVIADGFEGGVRAATEAGFKATVGTLPKTVARKEEATVA
                     LFLVPHDKGTKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLG
                     NINGLAIAARSIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHV
                     KNGAEFEDVGQWKRPWYFPKAGEDIHAAVTRECKAVRDSVGLLDASTLGKIDIQGPDA
                     REFLNRIYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARV
                     LQWMELYHQTEWPELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTW
                     KEGNVGGVPARVFRISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHV
                     LRAEKGFIIVGQDTDGSMNPDDLNMSWCVGRNKPFSWIGLRGMNREDCVRENRKQLVG
                     LKPVDPTQWLPEGAQLVFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMG
                     ERVYSPQADGSVIEAEIVSSVFFDPKGERQNV"
     misc_feature    410381..413374
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /note="sarcosine oxidase, alpha subunit family,
                     heterotetrameric form; Region: soxA; TIGR01372"
                     /db_xref="CDD:233382"
     misc_feature    410408..410671
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_4; pfam13510"
                     /db_xref="CDD:257830"
     misc_feature    412358..413011
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /note="Aminomethyltransferase folate-binding domain;
                     Region: GCV_T; pfam01571"
                     /db_xref="CDD:250713"
     misc_feature    413087..413332
                     /gene="soxA_2"
                     /locus_tag="PPUBIRD1_0356"
                     /note="Glycine cleavage T-protein C-terminal barrel
                     domain; Region: GCV_T_C; pfam08669"
                     /db_xref="CDD:254962"
     gene            413547..414179
                     /gene="soxG"
                     /locus_tag="PPUBIRD1_0357"
                     /db_xref="GeneID:12518588"
     CDS             413547..414179
                     /gene="soxG"
                     /locus_tag="PPUBIRD1_0357"
                     /note="sarcosine oxidase, gamma subunit family"
                     /codon_start=1
                     /transl_table=11
                     /product="SoxG"
                     /protein_id="YP_005928261.1"
                     /db_xref="GI:386009984"
                     /db_xref="GeneID:12518588"
                     /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRER
                     KFLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANKDMSLQWVGPDEWLLIVPGG
                     QELAVEQKLRAALEGQHIQVVNVSGGQSLLELRGPNVRDVLMKSTSYDVHPNNFPVGK
                     AVGTVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
     misc_feature    413727..414155
                     /gene="soxG"
                     /locus_tag="PPUBIRD1_0357"
                     /note="Sarcosine oxidase, gamma subunit family; Region:
                     SoxG; pfam04268"
                     /db_xref="CDD:113055"
     gene            414191..415048
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /db_xref="GeneID:12518589"
     CDS             414191..415048
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /EC_number="3.5.1.10"
                     /note="formyltetrahydrofolate deformylase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein PurU"
                     /protein_id="YP_005928262.1"
                     /db_xref="GI:386009985"
                     /db_xref="GeneID:12518589"
                     /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDR
                     QSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHC
                     LNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQV
                     IEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMV
                     GATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVF
                     LNANRTVVL"
     misc_feature    414191..415045
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="formyltetrahydrofolate deformylase; Reviewed;
                     Region: PRK13011"
                     /db_xref="CDD:237266"
     misc_feature    414215..414427
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="N-terminal ACT domain of formyltetrahydrofolate
                     deformylase (F4HF-DF; formyltetrahydrofolate hydrolase);
                     Region: ACT_F4HF-DF; cd04875"
                     /db_xref="CDD:153147"
     misc_feature    414458..415045
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="Formyltetrahydrofolate deformylase (Formyl-FH4
                     hydrolase), C-terminal hydrolase domain; Region:
                     FMT_core_Formyl-FH4-Hydrolase_C; cd08648"
                     /db_xref="CDD:187717"
     misc_feature    order(414476..414478,414491..414496,414701..414724,
                     414737..414739,414764..414775,414797..414799,
                     414857..414859,414863..414868,414875..414880)
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="putative active site [active]"
                     /db_xref="CDD:187717"
     misc_feature    order(414491..414496,414704..414709,414767..414769,
                     414773..414775,414965..414967)
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187717"
     misc_feature    order(414701..414703,414710..414712,414716..414724,
                     414737..414739,414764..414766,414863..414868,
                     414875..414880)
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187717"
     misc_feature    order(414764..414766,414770..414772,414878..414880)
                     /gene="purU"
                     /locus_tag="PPUBIRD1_0358"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187717"
     gene            415350..416549
                     /locus_tag="PPUBIRD1_0359"
                     /db_xref="GeneID:12518590"
     CDS             415350..416549
                     /locus_tag="PPUBIRD1_0359"
                     /EC_number="1.2.1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutathione-independent formaldehyde
                     dehydrogenase"
                     /protein_id="YP_005928263.1"
                     /db_xref="GI:386009986"
                     /db_xref="GeneID:12518590"
                     /translation="MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVST
                     NICGSDQHMVRGRTTAQVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCR
                     SCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAME
                     KIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGD
                     LNPARLAHAKSQGFEVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAK
                     HEAPATVLNSLMQVTRVAGNIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSF
                     HTGQTPTMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDP
                     HKMWGAA"
     misc_feature    415353..416534
                     /locus_tag="PPUBIRD1_0359"
                     /note="formaldehyde dehydrogenase,
                     glutathione-independent; Region: fdhA_non_GSH; TIGR02819"
                     /db_xref="CDD:234025"
     misc_feature    415359..416525
                     /locus_tag="PPUBIRD1_0359"
                     /note="Pseudomonas putida aldehyde-dismutating
                     formaldehyde dehydrogenase (PFDH); Region: PFDH_like;
                     cd08282"
                     /db_xref="CDD:176242"
     misc_feature    order(415488..415496,415503..415505,415629..415631,
                     415857..415859,415869..415871,415929..415931,
                     415935..415943,415998..416006,416016..416018,
                     416058..416060,416133..416138,416148..416153,
                     416196..416198,416247..416255,416358..416366,
                     416487..416489)
                     /locus_tag="PPUBIRD1_0359"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:176242"
     misc_feature    order(415488..415490,415494..415496,415551..415553,
                     415857..415859)
                     /locus_tag="PPUBIRD1_0359"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176242"
     misc_feature    order(415641..415646,415650..415652,415659..415661,
                     415683..415685)
                     /locus_tag="PPUBIRD1_0359"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176242"
     gene            418185..418760
                     /locus_tag="PPUBIRD1_0360"
                     /db_xref="GeneID:12518591"
     CDS             418185..418760
                     /locus_tag="PPUBIRD1_0360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928264.1"
                     /db_xref="GI:386009987"
                     /db_xref="GeneID:12518591"
                     /translation="MKAFTLATLMTLAASPVFAFNLSDAANAVSAMQNQQQQGQVQAP
                     EAQANLLNTLGSQLNITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGAN
                     ALGGLSGLGDLLGKNSESQSALSNALGNNVENRSDLDNAFKALGMDTGMIGQFAPLIL
                     QYLGQQGIAGSLLQNLGSLWTTPAPLAQPSV"
     misc_feature    418200..418715
                     /locus_tag="PPUBIRD1_0360"
                     /note="Protein of unknown function VcgC/VcgE (DUF2780);
                     Region: DUF2780; pfam11075"
                     /db_xref="CDD:256279"
     gene            complement(418858..420207)
                     /locus_tag="PPUBIRD1_0361"
                     /db_xref="GeneID:12518592"
     CDS             complement(418858..420207)
                     /locus_tag="PPUBIRD1_0361"
                     /codon_start=1
                     /transl_table=11
                     /product="Amino acid permease-associated region"
                     /protein_id="YP_005928265.1"
                     /db_xref="GI:386009988"
                     /db_xref="GeneID:12518592"
                     /translation="MANPPSSNPAQLRRVLGLPALVFFGLVYMVPLTIFTTYGIVTEL
                     TGGRTAGAYLVTLVAMLFTAASYSFMVKRFPVAGSAYSYTNMAFGPNVGFLAGWSLLL
                     DYLFLPMINYLLIGLFLNIAFPAVPAWAFVLACIALVTVLNVVGINSVAKTSNLIVGA
                     QIVFIGVFVALSCQTLAGQPLDLLSPLIGDGSKPGFGHLMAGAAVLCLSFLGFDAVST
                     LAEECRDARRDVPRAIILTTLFAGLLFTVLAYVSQLVLPGSSFANADAAANEVMFKAG
                     GQFLTNFFTAAYVAGSLGSALASQAAVSRILFTMGRDNVLPRRSFGYLSPRFGTPVFA
                     IALVSAFSLLALVIDLSTLASLISFGALVAFSAVNLTVVKTHLMDDASQRNFIGLLSY
                     GLVPLVGLGLTLWLWTSLSALTLVIGLCWFALGLAYLAVLTAGFRRPVRLVDFSEAV"
     misc_feature    complement(418930..420174)
                     /locus_tag="PPUBIRD1_0361"
                     /note="amino acid transporter; Region: 2A0306; TIGR00909"
                     /db_xref="CDD:129987"
     misc_feature    complement(419092..>419583)
                     /locus_tag="PPUBIRD1_0361"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(420447..421334)
                     /locus_tag="PPUBIRD1_0362"
                     /db_xref="GeneID:12518593"
     CDS             complement(420447..421334)
                     /locus_tag="PPUBIRD1_0362"
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid/glycerol acyltransferase"
                     /protein_id="YP_005928266.1"
                     /db_xref="GI:386009989"
                     /db_xref="GeneID:12518593"
                     /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYAS
                     WAVMWVAETWSEIDKAIFALCIPTQWDIRGVENLRKDTSYLAVSNHQTWVDIPALIES
                     LNRRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKA
                     ACELFKRQPVTVVNYLEGTRFTEAKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDAL
                     LDVTIVYPGNKAPGFWDLLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWV
                     NQLWVAKDQRIEQLRAEMG"
     misc_feature    complement(420582..421157)
                     /locus_tag="PPUBIRD1_0362"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LCLAT1-like; Region:
                     LPLAT_LCLAT1-like; cd07990"
                     /db_xref="CDD:153252"
     misc_feature    complement(order(420795..420803,420984..420995,
                     421050..421052,421056..421058,421065..421067))
                     /locus_tag="PPUBIRD1_0362"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153252"
     gene            421517..422017
                     /locus_tag="PPUBIRD1_0363"
                     /db_xref="GeneID:12518594"
     CDS             421517..422017
                     /locus_tag="PPUBIRD1_0363"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928267.1"
                     /db_xref="GI:386009990"
                     /db_xref="GeneID:12518594"
                     /translation="MKPLLALLSLLALPVMAAEPTLYGRYENIALPELGETLKAKMDT
                     GAFTASLSAKDIELFTRDGDEWVRFRLATKDSDGKVYEHKVSRISKIKGRADEEDEGD
                     APEVSKRPVVDLELCLGDVKRTVEVNLVDRSNFNYPLLVGSKALREFKAAVNPAKKFT
                     AGKPGC"
     misc_feature    421520..422005
                     /locus_tag="PPUBIRD1_0363"
                     /note="Uncharacterized protein conserved in archaea
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG4067"
                     /db_xref="CDD:226553"
     gene            422070..422837
                     /locus_tag="PPUBIRD1_0364"
                     /db_xref="GeneID:12518595"
     CDS             422070..422837
                     /locus_tag="PPUBIRD1_0364"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator CreB"
                     /protein_id="YP_005928268.1"
                     /db_xref="GI:386009991"
                     /db_xref="GeneID:12518595"
                     /translation="MWSQAPASPVFAGKPAPTLPTFKIARPDAMPHILIVEDEAAIAD
                     TLVYALQADGHSTEWVTLGSAALDQQRQRPADLVILDIGLPDISGFETCRQLRRFTEV
                     PVMFLSARDGEIDRVVGLEIGADDYVVKPFSPREVAARVRAILKRMAPRAEAAGGTSL
                     FQLDTLRMQITYRSQPLTLTRHEFRLLQCLLEQPQRVFSREQLLDALGVASDVGYERT
                     IDSHIKSLRAKLRQVAGDAEPIQTHRGLGYSYSPEHA"
     misc_feature    422157..422825
                     /locus_tag="PPUBIRD1_0364"
                     /note="DNA-binding response regulator CreB; Provisional;
                     Region: PRK11083"
                     /db_xref="CDD:236838"
     misc_feature    422169..422504
                     /locus_tag="PPUBIRD1_0364"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(422178..422183,422310..422312,422334..422336,
                     422391..422393,422448..422450,422457..422462)
                     /locus_tag="PPUBIRD1_0364"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    422310..422312
                     /locus_tag="PPUBIRD1_0364"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(422319..422324,422328..422336)
                     /locus_tag="PPUBIRD1_0364"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    422457..422465
                     /locus_tag="PPUBIRD1_0364"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    422550..422813
                     /locus_tag="PPUBIRD1_0364"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(422607..422609,422664..422669,422721..422723,
                     422730..422732,422754..422759,422793..422795,
                     422808..422810)
                     /locus_tag="PPUBIRD1_0364"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            422837..424273
                     /locus_tag="PPUBIRD1_0365"
                     /db_xref="GeneID:12518596"
     CDS             422837..424273
                     /locus_tag="PPUBIRD1_0365"
                     /EC_number="2.7.13.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Sensory histidine kinase CreC"
                     /protein_id="YP_005928269.1"
                     /db_xref="GI:386009992"
                     /db_xref="GeneID:12518596"
                     /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVD
                     TANLLAEILRDDVKAGTLNQGRLPEVLEAYGSRSPGAQIWGLAKNQVSHRIYVTDAKG
                     IVLLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPNDESTSVMHVGAPIIDNGKI
                     IGVVTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRKLAGYAQ
                     AVSEGERAELPHYKGGELANLAQAVERMRTQLEGKAYVERYVHTLTHELKSPLAAIRG
                     ASELLQGEDMPADQRARFAGNIERESERLQQMIERLLNLARVEQMQALEDEQQVALAA
                     LVDELLLAHAARIEGAGLQVRQRVPATLRLLCDPFLMRQALANLLDNALDFTPEGGTL
                     LFDLERAGERVALSVFNQGQAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVM
                     QLHGGALAVDNVDGGVRVRLWLPLRRIS"
     misc_feature    422837..424264
                     /locus_tag="PPUBIRD1_0365"
                     /note="sensory histidine kinase CreC; Provisional; Region:
                     PRK11100"
                     /db_xref="CDD:236846"
     misc_feature    423038..423334
                     /locus_tag="PPUBIRD1_0365"
                     /note="Sensory domain of two-component sensor kinase;
                     Region: Cache_3; pfam14827"
                     /db_xref="CDD:258964"
     misc_feature    423452..423589
                     /locus_tag="PPUBIRD1_0365"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(423452..423457,423464..423469,423473..423478,
                     423485..423490,423494..423496,423539..423544,
                     423548..423553,423560..423565,423569..423574,
                     423581..423586)
                     /locus_tag="PPUBIRD1_0365"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    423605..423787
                     /locus_tag="PPUBIRD1_0365"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    order(423611..423613,423623..423625,423635..423637,
                     423644..423646,423656..423658,423665..423667,
                     423716..423718,423728..423730,423737..423739,
                     423749..423751,423758..423760,423770..423772)
                     /locus_tag="PPUBIRD1_0365"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    423629..423631
                     /locus_tag="PPUBIRD1_0365"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    423947..424252
                     /locus_tag="PPUBIRD1_0365"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(423965..423967,423977..423979,423986..423988,
                     424055..424057,424061..424063,424067..424069,
                     424073..424078,424154..424165,424211..424213,
                     424217..424219,424229..424234,424238..424240)
                     /locus_tag="PPUBIRD1_0365"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    423977..423979
                     /locus_tag="PPUBIRD1_0365"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(424067..424069,424073..424075,424154..424156,
                     424160..424162)
                     /locus_tag="PPUBIRD1_0365"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            424381..425709
                     /locus_tag="PPUBIRD1_0366"
                     /db_xref="GeneID:12518597"
     CDS             424381..425709
                     /locus_tag="PPUBIRD1_0366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928270.1"
                     /db_xref="GI:386009993"
                     /db_xref="GeneID:12518597"
                     /translation="MNKTLGFKLGMIAMLMLLLLIPLLLINGLIDDRQAMRDGVLRDI
                     AQSTSFDQQLSGPLLVVPYRKYQRRWIEKDGARTQETSTITGHLYFLPETFDADLGVD
                     TELRARGIYQARLFHAKGRISGRFKLPAHWGIDKDFDDYRFDKPFLVVGISDIRGIKS
                     ALELSMDEQKVPFEPGTQLDWMRGGVHASLPGLDGLQARAFSYGFDLALQGTGQLHVV
                     PVGRTSSVNMRANWPHPSFVGSYLPNRREIDAQGFSAHWQTSFFATNLEDALRQCAVG
                     GQCADFSERTFGVSFVDPVDQYLKSERAIKYALLFIALTFAGFFLFEVMKNLSVHPVQ
                     YILVGVALAFFYLLLLSLSEHIGFGLAYGLSASACVLLIGFYLSHVLRSRGRGVGFAA
                     GLAALYALLYGLLSAEDYALLMGSLLCFGLLGVFMVMTRRLDWARVGRAA"
     misc_feature    424471..425691
                     /locus_tag="PPUBIRD1_0366"
                     /note="inner membrane protein; Provisional; Region:
                     PRK11715"
                     /db_xref="CDD:236960"
     gene            complement(425876..426490)
                     /locus_tag="PPUBIRD1_0367"
                     /db_xref="GeneID:12518598"
     CDS             complement(425876..426490)
                     /locus_tag="PPUBIRD1_0367"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_005928271.1"
                     /db_xref="GI:386009994"
                     /db_xref="GeneID:12518598"
                     /translation="MTLFHSPLSPFVRKVMVVLHETGQLERVQLQPVNISPVSGDPQL
                     NLDNPIGKIPALRLEDGTVLHDSRVICEYLDMQHVGLPLLPREGSARWRRMTLVSQAD
                     AIMDAAVSSRYESFLRPEDKRWDGWLQAQGDKIRRSLANLEQEHLPELISGFDLAAIG
                     VACALGYLDLRQPGFGWRERQPGLAAWYAEVVKRPSMVATAPVA"
     misc_feature    complement(425885..426490)
                     /locus_tag="PPUBIRD1_0367"
                     /note="putative glutathione S-transferase; Provisional;
                     Region: PRK10357"
                     /db_xref="CDD:182405"
     misc_feature    complement(426266..426490)
                     /locus_tag="PPUBIRD1_0367"
                     /note="GST_N family, unknown subfamily 3; composed of
                     uncharacterized bacterial proteins with similarity to
                     GSTs. GSTs are cytosolic dimeric proteins involved in
                     cellular detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of...; Region:
                     GST_N_3; cd03049"
                     /db_xref="CDD:239347"
     misc_feature    complement(order(426275..426280,426287..426289,
                     426428..426433,426440..426445,426449..426454,
                     426458..426460))
                     /locus_tag="PPUBIRD1_0367"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239347"
     misc_feature    complement(order(426290..426295,426329..426337,
                     426458..426460))
                     /locus_tag="PPUBIRD1_0367"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239347"
     misc_feature    complement(order(426275..426277,426284..426289,
                     426293..426298,426335..426337))
                     /locus_tag="PPUBIRD1_0367"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239347"
     misc_feature    complement(425885..426205)
                     /locus_tag="PPUBIRD1_0367"
                     /note="C-terminal, alpha helical domain of an unknown
                     subfamily 6 of Glutathione S-transferases; Region:
                     GST_C_6; cd03205"
                     /db_xref="CDD:198314"
     misc_feature    complement(order(426068..426070,426077..426082,
                     426089..426091,426101..426103,426110..426112,
                     426119..426130,426134..426136,426149..426154,
                     426173..426175,426182..426187,426191..426199,
                     426203..426205))
                     /locus_tag="PPUBIRD1_0367"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198314"
     misc_feature    complement(order(425885..425896,425900..425905,
                     425915..425917,425990..425992,426002..426004,
                     426011..426016,426023..426025,426152..426154,
                     426173..426178,426185..426187,426197..426199))
                     /locus_tag="PPUBIRD1_0367"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198314"
     misc_feature    complement(order(425990..425992,425999..426001,
                     426158..426163,426170..426175,426185..426187))
                     /locus_tag="PPUBIRD1_0367"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198314"
     gene            complement(426503..427171)
                     /gene="msrA"
                     /locus_tag="PPUBIRD1_0368"
                     /db_xref="GeneID:12518599"
     CDS             complement(426503..427171)
                     /gene="msrA"
                     /locus_tag="PPUBIRD1_0368"
                     /EC_number="1.8.4.11"
                     /note="Peptide methionine sulfoxide reductase msrA"
                     /codon_start=1
                     /transl_table=11
                     /product="protein MsrA"
                     /protein_id="YP_005928272.1"
                     /db_xref="GI:386009995"
                     /db_xref="GeneID:12518599"
                     /translation="MVLRSEILVNKNVMPTAEQALPGRDTPMSLPEFHYVFKDTPLLG
                     PFFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHT
                     EVVLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDIGTQYRSAIYCTSPEQLEQAKA
                     SRDAYQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPDGYCGIGGTGVCLPPS
                     LQGN"
     misc_feature    complement(426521..427159)
                     /gene="msrA"
                     /locus_tag="PPUBIRD1_0368"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK00058"
                     /db_xref="CDD:234604"
     gene            complement(427340..430030)
                     /locus_tag="PPUBIRD1_0370"
                     /db_xref="GeneID:12518600"
     CDS             complement(427340..430030)
                     /locus_tag="PPUBIRD1_0370"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase/phosphodiesterase with
                     PAS/PAC and GAF sensor(s)"
                     /protein_id="YP_005928273.1"
                     /db_xref="GI:386009996"
                     /db_xref="GeneID:12518600"
                     /translation="MKSQPDAASRVAAEVVTQLPVPSRLGMLRFERLNEASWAMLYLD
                     PACERQFGLQTGELCALIDAPYASLMEPEARYRLHDEIQLQLAQRGYYRVRYTLHTPS
                     TSLRLLEAGEAYKQHNRQLLRGYLSVLDDQQEETGETGASDLESRNNRLQLALQLNQR
                     TQQEQLEHLERVRGQQDLILRLARHRYSADNSLLEAAQLITQSACEIYKVDCASIWHL
                     EDQRLEPIIAWYRDAQEHRQPEAIDASRFPDYLDALHASRAIDAHNAGHDPRTRALAQ
                     SMRPENKAMLDASIRVDGQVIGVLCLEQSGQPRAWQSDEIAFAGELADQFAQVITNHK
                     RRAAASALHLFQRAVEQSASAFLLVNRDGRVEYVNPSFTAITQYSTDEVQGRQLGELP
                     ALENLSELLFDSPSSLAMGNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGI
                     YEDVTQTKLAQQRIERLAYTDNLTNLGNRPAFIRSLDERFARDGESSMCLLLVDIDNF
                     KRINDSLGHQTGDKLLISLARRLRNSLHSGGILARFASNEFAVLLDDTSLEDGQGVAQ
                     QLLCTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLMKNAGLALHKAKANGKHQVQ
                     VFTEVLNAEASYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGLEALLRWNHPER
                     GMIRPDQFISVAEETGLIIPIGKWVVRQACCMSQQLRKAGLGNLHVAINLSPKQFSDP
                     DLVASISTILKEEALPPHLLELELTEGLLLEASEDTHRQLDELKALGLTLAMDDFGTG
                     YSSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMAHNLKLKVVAEGIETPE
                     QLAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA"
     misc_feature    complement(429014..429508)
                     /locus_tag="PPUBIRD1_0370"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(428669..428977)
                     /locus_tag="PPUBIRD1_0370"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(428663..428968)
                     /locus_tag="PPUBIRD1_0370"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(428756..428758,428771..428773,
                     428849..428860,428897..428899,428915..428917,
                     428927..428929))
                     /locus_tag="PPUBIRD1_0370"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(428729..428731,428735..428737,
                     428819..428824,428831..428833,428855..428857,
                     428867..428869))
                     /locus_tag="PPUBIRD1_0370"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(428159..428626)
                     /locus_tag="PPUBIRD1_0370"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(428390..428392,428519..428521))
                     /locus_tag="PPUBIRD1_0370"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(428387..428398,428402..428404,
                     428468..428470,428480..428482,428492..428497,
                     428504..428506))
                     /locus_tag="PPUBIRD1_0370"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(428330..428332,428414..428416))
                     /locus_tag="PPUBIRD1_0370"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(427385..428107)
                     /locus_tag="PPUBIRD1_0370"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(430392..432032)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /db_xref="GeneID:12518601"
     CDS             complement(430392..432032)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /EC_number="2.3.1.12"
                     /note="dihydrolipoamide acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="AceF"
                     /protein_id="YP_005928274.1"
                     /db_xref="GI:386009997"
                     /db_xref="GeneID:12518601"
                     /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASM
                     EIPAPKAGVIKELKVKLGDRLKEGDELLVLEAEGAAAAAPEAPAAAAAPAAAPAPAAE
                     AAPAAPAAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASM
                     EIPSPAAGVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPAPAAAPAPAKAEAAPAA
                     APAAAAPAAAPAPAATAPAAGSNAKVHAGPAVRQLAREFGVELGAVAATGPHGRILKE
                     DVQVYVKAMMQKAKEAPAAAGATGGAGIPPIPAVDFSKFGEVEEVALTRLMQVGAANL
                     HRSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPD
                     FNSSLAPSGKAIIRKKYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKAR
                     TKKLSADEMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPK
                     LMLPLSLSYDHRVINGAAAARFTKRLGDVLGDIRTMLL"
     misc_feature    complement(430395..432020)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="dihydrolipoamide acetyltransferase; Reviewed;
                     Region: PRK11855"
                     /db_xref="CDD:237000"
     misc_feature    complement(431811..432020)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    complement(order(431892..431894,431904..431921,
                     431940..431942))
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    complement(431910..431912)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    complement(431463..431681)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="Lipoyl domain of the dihydrolipoyl acyltransferase
                     component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid
                     dehydrogenase multienzyme complexes, like pyruvate
                     dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH)
                     and branched-chain 2-oxo acid...; Region: lipoyl_domain;
                     cd06849"
                     /db_xref="CDD:133458"
     misc_feature    complement(order(431544..431546,431556..431573,
                     431592..431594))
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="E3 interaction surface; other site"
                     /db_xref="CDD:133458"
     misc_feature    complement(431562..431564)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="lipoyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133458"
     misc_feature    complement(431196..431306)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="e3 binding domain; Region: E3_binding; pfam02817"
                     /db_xref="CDD:251550"
     misc_feature    complement(430395..431033)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_0371"
                     /note="2-oxoacid dehydrogenases acyltransferase (catalytic
                     domain); Region: 2-oxoacid_dh; pfam00198"
                     /db_xref="CDD:249671"
     gene            complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /db_xref="GeneID:12518602"
     CDS             complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /EC_number="1.2.4.1"
                     /note="Pyruvate dehydrogenase E1 component"
                     /codon_start=1
                     /transl_table=11
                     /product="AceE"
                     /protein_id="YP_005928275.1"
                     /db_xref="GI:386009998"
                     /db_xref="GeneID:12518602"
                     /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGS
                     QLPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHI
                     SSFASSATLYDIGFNYFFQAPTDEHGGDLVFFQGHASPGVYARAFMEGRISEDQMNNF
                     RQEVDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQK
                     VWCFMGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGV
                     FRGGGWNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVREHFFN
                     TPELKAMVEDLSDEEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGA
                     GEAKNTAHNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAA
                     LGGFVPQRRAKSFSVPTPPLETLKAILDGSGDREISTTMAFVRILAQLVKDKDIGQRI
                     VPIIPDEARTFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAG
                     AMSSFIAAGTSYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRT
                     TLNGEGLQHEDGHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYIT
                     VMNESYQQPAMPAGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILRE
                     EFNVGADVWSVTSFNELRRDGLAVERANRLKPGQKPQQTYVEQCLNGRKGPVIASTDY
                     MKLFAEQIRQWVPSKEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGE
                     IEPKVVADAIVKFGIDPDKRNPLDC"
     misc_feature    complement(432049..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /note="pyruvate dehydrogenase subunit E1; Reviewed;
                     Region: aceE; PRK09405"
                     /db_xref="CDD:236500"
     misc_feature    complement(433333..434484)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /note="Thiamine pyrophosphate (TPP) family, E1 of E. coli
                     PDC-like subfamily, TPP-binding module; composed of
                     proteins similar to the E1 component of the Escherichia
                     coli pyruvate dehydrogenase multienzyme complex (PDC). PDC
                     catalyzes the oxidative...; Region: TPP_E1_EcPDC_like;
                     cd02017"
                     /db_xref="CDD:238975"
     misc_feature    complement(order(433855..433857,433864..433869,
                     433876..433878,433900..433902,433912..433920,
                     433966..433968,433978..433980,433987..433989,
                     433996..434007,434125..434133,434137..434139,
                     434164..434166,434170..434172,434176..434181,
                     434200..434211,434398..434406))
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238975"
     misc_feature    complement(order(433534..433536,433921..433923,
                     433927..433929,434002..434004,434011..434019,
                     434125..434127,434131..434133,434281..434283,
                     434287..434289,434380..434382))
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_0372"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238975"
     gene            435075..438008
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /db_xref="GeneID:12518603"
     CDS             435075..438008
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /EC_number="2.7.7.42"
                     /note="Glutamate-ammonia-ligase adenylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GlnE"
                     /protein_id="YP_005928276.1"
                     /db_xref="GI:386009999"
                     /db_xref="GeneID:12518603"
                     /translation="MRLPLPSDLPATLQPLVTRNQQFISDAVAGHPELDLQAWSPLHR
                     QQFDQVAAASEFVLSLAQREPAMLFALLASGELERRYAPGELRGQIAATAQAAQSEDE
                     LARNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFG
                     TPIGNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLDNQEFFT
                     RLGQRLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAM
                     IKARVVAGDQAAGAQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMAENIK
                     LGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYE
                     FLRYTEHAIQAIADRQTQMLPEGETDQARVAYVLGFADWQSFHDQLMYWRGRIDWHFR
                     QVIADPDDEDGEGELVVGGEWSPLWEQAQDEEAAGRQLQEAGFKQPAEALRRLAGLRS
                     SPQLRSMQRIGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTE
                     NPGALRRLLTLCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRI
                     PEDDLEQQMEALRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWR
                     QTVARHGQPKRSDGSLCDPGFIIIGYGKMGGLELGHGSDLDLVFIHDGDPQAETDGAK
                     PIDSAQFFTRLGQRIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNE
                     AWTWEHQALVRARVLVGCKQVGAAFEGVRAKVLGQARDLEKLRAEVSEMRAKMRDNLG
                     TKATAAGTAANAFDAGVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRI
                     LEELEQANLMPASDAVLLREVYKAFRSASHRQALQKEAGVIDAAQFADERREVRRIWG
                     ELGLS"
     misc_feature    435081..437996
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="bifunctional glutamine-synthetase
                     adenylyltransferase/deadenyltransferase; Reviewed; Region:
                     PRK11072"
                     /db_xref="CDD:236836"
     misc_feature    435414..435971
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(435645..435647,435651..435653,435795..435797)
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    436020..436433
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; pfam08335"
                     /db_xref="CDD:254738"
     misc_feature    436986..437546
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    order(437235..437237,437241..437243,437388..437390)
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    437700..>437909
                     /gene="glnE"
                     /locus_tag="PPUBIRD1_0374"
                     /note="GlnD PII-uridylyltransferase; Region:
                     GlnD_UR_UTase; cl19627"
                     /db_xref="CDD:267980"
     gene            438211..439260
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_0375"
                     /db_xref="GeneID:12518604"
     CDS             438211..439260
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_0375"
                     /note="lipopolysaccharide heptosyltransferase II"
                     /codon_start=1
                     /transl_table=11
                     /product="WaaF"
                     /protein_id="YP_005928277.1"
                     /db_xref="GI:386010000"
                     /db_xref="GeneID:12518604"
                     /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPI
                     LERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIP
                     KRTGWRGEMRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPNLQIEAQS
                     RDAALAKFGLELDRPVLALCPGAEFGEAKRWPAEHYAAVADAMIRQGWQVWLFGSKND
                     HPVGEQIRDRLIPGLREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRP
                     LVAVYGSTSPGFTPPLAEQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALH
                     SLSGPDLIDTVAEVD"
     misc_feature    438214..439215
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_0375"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(438745..438750,438847..438849,438955..438960,
                     438994..438996,439003..439008,439015..439017)
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_0375"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            439261..440319
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_0376"
                     /db_xref="GeneID:12518605"
     CDS             439261..440319
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_0376"
                     /note="lipopolysaccharide heptosyltransferase I"
                     /codon_start=1
                     /transl_table=11
                     /product="WaaC"
                     /protein_id="YP_005928278.1"
                     /db_xref="GI:386010001"
                     /db_xref="GeneID:12518605"
                     /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEI
                     PSWHPAVDQVIPVAIRRWRKNLWQTIKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWL
                     TRYVKAPVAGLDRYSAREGWASRFYDRPLSVATGQHAVERVRQLFAMALAYDLPEGIG
                     NYGLDLDRLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPA
                     EKARAERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTISLF
                     GPTNPGLTGAYGRTQIHQASDWPCAPCLQKKCTYKPRADDLARFDLKREWPLCFTRLN
                     PEHVASRLSALLLAEDVR"
     misc_feature    439264..440292
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_0376"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(439798..439803,439897..439899,439990..439995,
                     440029..440031,440038..440043,440050..440052)
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_0376"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            440319..441443
                     /gene="waaG"
                     /locus_tag="PPUBIRD1_0377"
                     /db_xref="GeneID:12518606"
     CDS             440319..441443
                     /gene="waaG"
                     /locus_tag="PPUBIRD1_0377"
                     /note="lipopolysaccharide core biosynthesis protein WaaG"
                     /codon_start=1
                     /transl_table=11
                     /product="WaaG"
                     /protein_id="YP_005928279.1"
                     /db_xref="GI:386010002"
                     /db_xref="GeneID:12518606"
                     /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGD
                     IPPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGC
                     FEDKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVE
                     RFHLLPPGISQDRRAPANAAEIRAEFRKEFNLGDDDLLLVQIGSGFKTKGVDRSLKAL
                     AALPSALRKRTRLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADLLIH
                     PAYNENTGTVLLEALVAGLPVLVSKVCGYAHYIAEADSGLVLDEPFEQDQLNGYLQRM
                     LEDPQARASWSRNGLAFADSADLYSMPQHAADVILGQKTA"
     misc_feature    440319..441422
                     /gene="waaG"
                     /locus_tag="PPUBIRD1_0377"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    440328..441422
                     /gene="waaG"
                     /locus_tag="PPUBIRD1_0377"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            441440..442246
                     /gene="waaP"
                     /locus_tag="PPUBIRD1_0378"
                     /db_xref="GeneID:12518607"
     CDS             441440..442246
                     /gene="waaP"
                     /locus_tag="PPUBIRD1_0378"
                     /note="lipopolysaccharide kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="WaaP"
                     /protein_id="YP_005928280.1"
                     /db_xref="GI:386010003"
                     /db_xref="GeneID:12518607"
                     /translation="MKLILAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTEVA
                     GEGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWRAIQRLHEVGVPTMTAVAYGERG
                     NNPAAQHSFIITEELAPTISLEDFSIDWVKQPPEPRLKRALIAEVAKMTGGMHRAGVN
                     HRDCYICHFLLHTDRPVTADDFKLSVIDLHRAQTRARISRRWRDKDLAALYFSALDIG
                     LTQRDKLRFLRGYFQRPLRQVLKDEAALLAWLERKAQKLYDRKQRYGDAL"
     misc_feature    441440..442243
                     /gene="waaP"
                     /locus_tag="PPUBIRD1_0378"
                     /note="lipopolysaccharide core heptose(I) kinase RfaP;
                     Provisional; Region: PRK15123"
                     /db_xref="CDD:237915"
     gene            442246..442980
                     /locus_tag="PPUBIRD1_0379"
                     /db_xref="GeneID:12518608"
     CDS             442246..442980
                     /locus_tag="PPUBIRD1_0379"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipopolysaccharide kinase"
                     /protein_id="YP_005928281.1"
                     /db_xref="GI:386010004"
                     /db_xref="GeneID:12518608"
                     /translation="MASWTLAPGYEHLAADFGSLDAVFALQGERLTRDPLSEVVRIER
                     DGINYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERNGLAF
                     GRGAMITRELPRTEDLSALAEHNDARLADRAWVDHVSRQLARHTRVMHEHRFAHNDLK
                     WRNLLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQ
                     YRGRDRLNVRDKKRIHRVLGFFEGRE"
     misc_feature    442303..442800
                     /locus_tag="PPUBIRD1_0379"
                     /note="Lipopolysaccharide kinase (Kdo/WaaP) family;
                     Region: Kdo; cl17488"
                     /db_xref="CDD:266722"
     misc_feature    <442639..442968
                     /locus_tag="PPUBIRD1_0379"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     gene            442977..443729
                     /locus_tag="PPUBIRD1_0380"
                     /db_xref="GeneID:12518609"
     CDS             442977..443729
                     /locus_tag="PPUBIRD1_0380"
                     /codon_start=1
                     /transl_table=11
                     /product="Lipopolysaccharide kinase"
                     /protein_id="YP_005928282.1"
                     /db_xref="GI:386010005"
                     /db_xref="GeneID:12518609"
                     /translation="MTDYLASADLALLKRHGLDNFEALWALQLDAVDEPNTGRGGWSS
                     VFRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLRIPALQAVFYGE
                     RKQGGTHRAILMTRALDEWADLDSLLAQWPRLGEAERTGILQACGQLARTLHSAGQVH
                     GCFYPKHIFLRQRREGWDAQLIDLEKTRPLLFGMRDRLKDLEPLLRRAQAWRVQDVRT
                     LLATYLGQPADGALVDTWLQRLTQRRREKEAR"
     misc_feature    443040..443645
                     /locus_tag="PPUBIRD1_0380"
                     /note="Lipopolysaccharide kinase (Kdo/WaaP) family;
                     Region: Kdo; cl17488"
                     /db_xref="CDD:266722"
     gene            443729..445171
                     /locus_tag="PPUBIRD1_0381"
                     /db_xref="GeneID:12518610"
     CDS             443729..445171
                     /locus_tag="PPUBIRD1_0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928283.1"
                     /db_xref="GI:386010006"
                     /db_xref="GeneID:12518610"
                     /translation="MRLSELKDAGRSPALPLSITLVDAAGSADLQLLSLLRVLPGQRY
                     VGAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPTLLADGLKEGEGGWL
                     LFEFLDGAQSLADAWAAVENLPVLADEQHLVLGEALTAVAHMHARGLWQEDLHLDNLL
                     RHAGKLYLIDGAGIRAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLAN
                     AEHALPLEALQKQVDKVRNWRQKDYLDKAGRECSLFSVQRTLSGLQAIRRSEVQAMQP
                     VLEQADALIDKGHLYKTGGAASVARIEVNGRQLVIKRYNIKNTAHWFKRFWRPSRAWH
                     SWIEGHRLEFLDIATPRPLAVLEQRVLGLRSRAYLVTEFVDGPDLTACFAPYVESGDA
                     PEEQVDALVHVMQQLIRERISHGDFKGHNLFWHNGQWSLIDLDAMCQHATQLSFAPAY
                     ARDRARLLRNWPNGSALHQRLDRLLPKLVD"
     misc_feature    443864..444238
                     /locus_tag="PPUBIRD1_0381"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    order(443873..443875,443894..443896,443900..443902,
                     443987..443989,444038..444049,444185..444187,
                     444197..444202,444206..444208,444233..444238)
                     /locus_tag="PPUBIRD1_0381"
                     /note="active site"
                     /db_xref="CDD:240159"
     misc_feature    order(443873..443875,443894..443896,443900..443902,
                     443987..443989,444038..444049,444185..444187,
                     444197..444202,444206..444208,444233..444238)
                     /locus_tag="PPUBIRD1_0381"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:240159"
     misc_feature    <444746..445105
                     /locus_tag="PPUBIRD1_0381"
                     /note="Lipopolysaccharide kinase (Kdo/WaaP) family;
                     Region: Kdo; cl17488"
                     /db_xref="CDD:266722"
     gene            complement(445190..447976)
                     /locus_tag="PPUBIRD1_0382"
                     /db_xref="GeneID:12518611"
     CDS             complement(445190..447976)
                     /locus_tag="PPUBIRD1_0382"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928284.1"
                     /db_xref="GI:386010007"
                     /db_xref="GeneID:12518611"
                     /translation="MRPLEQLEQIDRQIGDLLDGIPTLALQHPINPDTRTWLHGELAS
                     FWTTADEHGETPRQKLLALRKALMLAEVELRLGDETLGYRSADQLWACLQQPLPSQRR
                     HMPLAKRPQVYRVLLEGLRPNWRSYLPGTLIIVAGTAEGHMLTPQDAAGAALLCSLSQ
                     GIEAFDSLGALHQELCERLEDPLQSRPLLHLYTDTQADRARRSQRLRYDWYADSLLEA
                     QIDSVIETQRQRLSDTSLWSNGSPDQHTRIHKALALWPEVGAKPILQTRYSQLLEKNL
                     PNWLRNTSAQGLSHMMQAMQTLVAIAEQAAAPGVLSLNDFKQRNSLLAWANARLRERL
                     SHDLGYDTDPREIKIVVVRARRTGAIMHPFALSSYVTYAGMRRVGHEMVEMVEEINTL
                     EEIALKNLPWFDTDYWLTARVIHAHGKAMPAGLTPQYVKHMVRELNVGDSYAKYLHTQ
                     LISSRAGKWRLTAHSKVNRARMHAEAVKARYAGHFGEDPFEHGYNWVRAVLDQPHNAL
                     RAPVAGYPVTVRQLNIMGHTLQGVLLLNSLPYKSPACVLYTPDAPDRRAWRRFRTTRE
                     LLRTLRQQPALRAYVAQRLPLLPAATVQRLLDKGRLSTHLTTPEVKDDLFFDYYMAEA
                     RALIAQADADSMTTSEVNAESVMALSWRLLDFISLLLPNRALLVLSIGRMAIDILDGI
                     EAFNQEDVEGVMRHSYQALSHLNDAGTSFLGSRVLRRSLRGIPKQPPLPLPARFQAQP
                     DSSSLRYRIDGIYGEGVYEQSSAFGGLSLYFVKDSNNRYYQVSFDGYRWRAIDPDQPD
                     AYLQQPLKRKADGQWVIDSPVLWYDGLPDLTQLLQDCYLQTPVAGLPVNIEQGLFQAD
                     EQLYLALENGQLPVRRHLLPDHYHLQIAVASNAGVVPWAVLRHENGQWLIRVRQAGRS
                     SDWLTLPDQPPPAH"
     gene            complement(448226..449338)
                     /locus_tag="PPUBIRD1_0384"
                     /db_xref="GeneID:12518612"
     CDS             complement(448226..449338)
                     /locus_tag="PPUBIRD1_0384"
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY-associated TM helix domain-containing
                     protein"
                     /protein_id="YP_005928285.1"
                     /db_xref="GI:386010008"
                     /db_xref="GeneID:12518612"
                     /translation="MKSPTIRRWSLIHTWSSLVCTLFLLLLAVTGLPLIFHHELEHLL
                     GDAPELREMPAGTPHLDLQQLVLKAEQHRPGEVMQYFGYDEDEPNGVVAITAATAGTD
                     PNLSHTFMLDARTGEAVAMPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAI
                     VSGTVLYAPFMRRLEFGTVRHKKSRRLRWLDLHNLIGVVTLAWALTVSVTGVISALSD
                     LVIAAWRNDSLAAMVAPYRDAPPLVERAPATRLLDIAEQAAPGMRPDFIAFPGTRFSS
                     EHHYAVFMNGATHLSSHLFTPVLIDARTLAVTAVGNRPWYMDAMGLSQPLHFGDYGGR
                     PMQILWALLDVLTIIVLGSGLYLWWGKQRKPREARA"
     misc_feature    complement(448232..449338)
                     /locus_tag="PPUBIRD1_0384"
                     /note="Uncharacterized iron-regulated membrane protein
                     [Function unknown]; Region: PiuB; COG3182"
                     /db_xref="CDD:225723"
     misc_feature    complement(448688..448939)
                     /locus_tag="PPUBIRD1_0384"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_2;
                     pfam13703"
                     /db_xref="CDD:258001"
     gene            complement(449395..451827)
                     /locus_tag="PPUBIRD1_0385"
                     /db_xref="GeneID:12518613"
     CDS             complement(449395..451827)
                     /locus_tag="PPUBIRD1_0385"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="YP_005928286.1"
                     /db_xref="GI:386010009"
                     /db_xref="GeneID:12518613"
                     /translation="MSRAVDHILRPSLMALAIGLAAPLTSPVLFAAEQSTSRAYNLPS
                     APLATTLNQIASQAGIALAIDPALVSGRTSAPVSGQYDGLGALQAALSGTGLQLQQST
                     AGSYSLVAVPDGTLALPETTVNATSTSEIAWGPVEGYVAKRTAAGTKTDTALVEVPRS
                     ISVATREQMKDRGVHSLDDAVRYMPGIVSASFGSDTRYDWMRVRGFEPTQFLDGLPLP
                     RGVYANPKAETWNLDRLALLRGPASSIYGQTPPGGLLDMVSRRPQAESAHEIELQYGS
                     DNHRQINFASTGKIDDEGRFLYGVSGVIRDSGTQIDHIDNKRYNIAPSLTWNIDEDTT
                     LTFLTQFTRDDTGATSQFRPIQGTKIDMPFGKISHHKNLGDPDYEFYDRTYYALGYAF
                     EHRINDVWQFRQNLRYTKSDLSFQTITPGSYNKSSPPVQDDGTVSRMSTNTDEDISQF
                     AVDNNFQADFATGDIDHTLLIGLDHQRINTNYLSIFDFNVPDSNVNNPVYGLPITRPD
                     RSTAFYDYNQKTRQTGLYVQDQMALGNWRLTLGGREDWVHTGTKFFNQGDATNTQRDK
                     KFSGNAAISYVFDSGFVPYLSYAESFQPSSNASVSASDSFKPTEGKQWELGVKYQPPG
                     SNTLLSAAVYDLTQKNVSVTNTVGGVTITSQTGEVKVRGLELEAVSDVTDNLKVIAAY
                     TLAKSEVQDGDFKGNRLQLMPNQQASIWGDYTWHSGVLDGFGIGLGARYTGNTYGDQG
                     NTYLGKAKAYTVFDGSVHYDLGRLNGSLKGASVAVTATNLLNKDYLSTCDSYYCYYGD
                     ERSVVASATYKF"
     misc_feature    complement(451498..451650)
                     /locus_tag="PPUBIRD1_0385"
                     /note="Secretin and TonB N terminus short domain; Region:
                     STN; smart00965"
                     /db_xref="CDD:198033"
     misc_feature    complement(449398..451566)
                     /locus_tag="PPUBIRD1_0385"
                     /note="ferrichrome outer membrane transporter;
                     Provisional; Region: PRK10044"
                     /db_xref="CDD:236643"
     misc_feature    complement(449398..451350)
                     /locus_tag="PPUBIRD1_0385"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(451051..451077,451111..451143,
                     451177..451197,451210..451227,451261..451266,
                     451270..451293,451321..451350))
                     /locus_tag="PPUBIRD1_0385"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(450493..450495,450589..450591))
                     /locus_tag="PPUBIRD1_0385"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(452080..453036)
                     /locus_tag="PPUBIRD1_0387"
                     /db_xref="GeneID:12518614"
     CDS             complement(452080..453036)
                     /locus_tag="PPUBIRD1_0387"
                     /codon_start=1
                     /transl_table=11
                     /product="Anti-FecI sigma factor, FecR"
                     /protein_id="YP_005928287.1"
                     /db_xref="GI:386010010"
                     /db_xref="GeneID:12518614"
                     /translation="MSNLPVSSRVLEAAIAWKLSLGDSSGTPDERSEFMRWHAASEEH
                     ARAWRQLGAMDQRVSAAAGPARQALLQSRASLRRRIGKVGGGLAGTFLLGALLAWVGA
                     PSLAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGAQRVIVLHQGEISV
                     ETGHQDPRPLLVRTEDGRLRPLGTRFLVRREAGGTRLEVLQASVAAMPHDSGDEQVLR
                     EGQQVLMNANGLGEVGTVPAGADAWTRGMLVVDNVRLGDLLATLGQYRSGYLGVDAKV
                     ADLRVTGSFPLTNTDLALASLVPALPVKIERHTQWWVNVTSK"
     misc_feature    complement(452083..453015)
                     /locus_tag="PPUBIRD1_0387"
                     /note="Fe2+-dicitrate sensor, membrane component
                     [Inorganic ion transport and metabolism / Signal
                     transduction mechanisms]; Region: FecR; COG3712"
                     /db_xref="CDD:226235"
     misc_feature    complement(452422..452703)
                     /locus_tag="PPUBIRD1_0387"
                     /note="FecR protein; Region: FecR; pfam04773"
                     /db_xref="CDD:252792"
     gene            complement(453033..453551)
                     /locus_tag="PPUBIRD1_0388"
                     /db_xref="GeneID:12518615"
     CDS             complement(453033..453551)
                     /locus_tag="PPUBIRD1_0388"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="YP_005928288.1"
                     /db_xref="GI:386010011"
                     /db_xref="GeneID:12518615"
                     /translation="MSSAQSPHADLVGALYRDHRGWLLAWLQRSMACRQRAEDLSQDT
                     FVRLLGREQLDTPREPRAFLAAVAKGLMFDHFRRAALEQAYLAELALIPEAEQPSPEM
                     QHLILEDLKAIDRLLGKLSSKARAAFLHSRLDGMGHAEIAERLGVSVSRVRQYIAQGM
                     RQCYVALYGEPT"
     misc_feature    complement(453036..453551)
                     /locus_tag="PPUBIRD1_0388"
                     /note="RNA polymerase sigma factor; Reviewed; Region:
                     PRK12523"
                     /db_xref="CDD:183572"
     misc_feature    complement(453312..453509)
                     /locus_tag="PPUBIRD1_0388"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(453063..453224)
                     /locus_tag="PPUBIRD1_0388"
                     /note="Sigma-70, region 4; Region: Sigma70_r4_2;
                     pfam08281"
                     /db_xref="CDD:203898"
     misc_feature    complement(order(453072..453074,453078..453083,
                     453087..453095,453099..453104,453108..453110,
                     453138..453143,453159..453161,453189..453191))
                     /locus_tag="PPUBIRD1_0388"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(453699..454409)
                     /locus_tag="PPUBIRD1_0389"
                     /db_xref="GeneID:12518616"
     CDS             complement(453699..454409)
                     /locus_tag="PPUBIRD1_0389"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="YP_005928289.1"
                     /db_xref="GI:386010012"
                     /db_xref="GeneID:12518616"
                     /translation="MSLFAWLRPSAPELDHATRQRLARLPKPVPLGVCTLREQRWVVL
                     DLETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPSAL
                     AAGCDPAEALLDLLDFIGNSPVLAFHAPFDQRMLARALKESLGYRLQSPFLDIAELAP
                     MLNPDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQ
                     LEQRLRGWRRRKMQSHGL"
     misc_feature    complement(453804..454286)
                     /locus_tag="PPUBIRD1_0389"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(453831..453833,453846..453848,
                     454014..454022,454026..454031,454260..454262,
                     454266..454277))
                     /locus_tag="PPUBIRD1_0389"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(453831..453833,453846..453848,
                     454017..454022,454026..454031,454260..454262,
                     454266..454277))
                     /locus_tag="PPUBIRD1_0389"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    complement(order(453831..453833,453846..453848,
                     454014..454016,454269..454271,454275..454277))
                     /locus_tag="PPUBIRD1_0389"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            complement(454406..456343)
                     /locus_tag="PPUBIRD1_0390"
                     /db_xref="GeneID:12518617"
     CDS             complement(454406..456343)
                     /locus_tag="PPUBIRD1_0390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928290.1"
                     /db_xref="GI:386010013"
                     /db_xref="GeneID:12518617"
                     /translation="MSKKDAYSQAGKTAVLQNIQGTLQFLQRFPPFNQMEHSHLAFLV
                     EQCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLAKPGVETTFEITSGECFP
                     LAALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQ
                     VRQRAVETLGTQYSLNTPLGELAMRHPVVCSANTPLREAVRLMHEQQVGSIVVVDPQR
                     YPIGIFTLRDLRQVVATIDADLGAAIDRHMTAKPFYLPPQASAFDAAMAMTERHIAHV
                     CLVENRRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAH
                     GASSTQITQIITLLNDHTVCRVIELALAERGDPGVPFSWLCFGSEGRREQTLHTDQDN
                     GILFEAVDSAEADAIRARLLPLAQYINQCLAQCGFTLCMGNVMAGNPELCLSRSEWAR
                     RFAGFVREASPENLLGSSIYFDLRVVWGDEQGCEQLRQGLLAQVADNRIFQRMMADNA
                     LRQRPPVGRLREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGIAACNTLERL
                     RQLVAKGVIEPLDGAAYEEAYHFIQQTRMQQHQRQIRDNLPYSNRLDPDSLNHLDRRI
                     LRESLRQAQRLQSSLALRYQL"
     misc_feature    complement(454409..456274)
                     /locus_tag="PPUBIRD1_0390"
                     /note="Predicted signal-transduction protein containing
                     cAMP-binding and CBS domains [Signal transduction
                     mechanisms]; Region: COG2905"
                     /db_xref="CDD:225457"
     misc_feature    complement(455936..456253)
                     /locus_tag="PPUBIRD1_0390"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(455999..456007,456035..456040))
                     /locus_tag="PPUBIRD1_0390"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(455936..455944)
                     /locus_tag="PPUBIRD1_0390"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(455456..455791)
                     /locus_tag="PPUBIRD1_0390"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with either the CAP_ED (cAMP receptor protein effector
                     domain) family of transcription factors and the DUF294
                     domain or the PB1 (Phox and Bem1p) domain; Region:
                     CBS_pair_CAP-ED_DUF294_PBI_assoc2; cd04800"
                     /db_xref="CDD:240113"
     misc_feature    complement(454865..455377)
                     /locus_tag="PPUBIRD1_0390"
                     /note="Nucleotidyltransferase (NT) domain of Escherichia
                     coli adenylyltransferase (GlnE), Escherichia coli uridylyl
                     transferase (GlnD), and similar proteins; Region:
                     NT_GlnE_GlnD_like; cd05401"
                     /db_xref="CDD:143391"
     misc_feature    complement(order(455045..455047,455171..455173,
                     455177..455179))
                     /locus_tag="PPUBIRD1_0390"
                     /note="metal binding triad; metal-binding site"
                     /db_xref="CDD:143391"
     misc_feature    complement(454415..454852)
                     /locus_tag="PPUBIRD1_0390"
                     /note="Putative nucleotidyltransferase substrate binding
                     domain; Region: DUF294_C; pfam10335"
                     /db_xref="CDD:150931"
     gene            456523..457005
                     /locus_tag="PPUBIRD1_0391"
                     /db_xref="GeneID:12518618"
     CDS             456523..457005
                     /locus_tag="PPUBIRD1_0391"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator receiver protein"
                     /protein_id="YP_005928291.1"
                     /db_xref="GI:386010014"
                     /db_xref="GeneID:12518618"
                     /translation="MLKRNFFDEMSMPEHTDILSDAEREALAVINQNAPVAARPLVLV
                     VDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLMITDLRMQPESGLDL
                     IRTIRASERAALSIIVVSGDTDVEEAVDVMHLGVVDFLLKPVDLGKLLELVNKELKIG
                     "
     misc_feature    456649..456987
                     /locus_tag="PPUBIRD1_0391"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(456658..456663,456793..456795,456817..456819,
                     456880..456882,456937..456939,456946..456951)
                     /locus_tag="PPUBIRD1_0391"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    456793..456795
                     /locus_tag="PPUBIRD1_0391"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(456802..456807,456811..456819)
                     /locus_tag="PPUBIRD1_0391"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    456946..456954
                     /locus_tag="PPUBIRD1_0391"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(457051..459228)
                     /gene="glcB"
                     /locus_tag="PPUBIRD1_0392"
                     /db_xref="GeneID:12518619"
     CDS             complement(457051..459228)
                     /gene="glcB"
                     /locus_tag="PPUBIRD1_0392"
                     /EC_number="2.3.3.9"
                     /note="Malate synthase G"
                     /codon_start=1
                     /transl_table=11
                     /product="GlcB"
                     /protein_id="YP_005928292.1"
                     /db_xref="GI:386010015"
                     /db_xref="GeneID:12518619"
                     /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIN
                     DLAPKNKALLAKRDELQAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATT
                     QNVDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGY
                     NKIRGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDAQL
                     IGFHGDAAAPTAVLLKHNGLHFEIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDS
                     VAAVDADDKVIVYRNWLGLMKGDLAESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGR
                     SLLFVRNVGHLMTNPAILDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRSGSVY
                     IVKPKMHGPEEVAFAAEIFSQVEDLLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAER
                     VAFINTGFLDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQ
                     IGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELA
                     SRTPASVDDILAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     NVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDPLYRPMAP
                     NFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
     misc_feature    complement(457069..459204)
                     /gene="glcB"
                     /locus_tag="PPUBIRD1_0392"
                     /note="Malate synthase G (MSG), monomeric enzyme present
                     in some bacteria. In general, malate synthase catalyzes
                     the Claisen condensation of glyoxylate and acetyl-CoA to
                     malyl-CoA , which hydrolyzes to malate and CoA. This
                     reaction is part of the glyoxylate...; Region:
                     malate_synt_G; cd00728"
                     /db_xref="CDD:238370"
     misc_feature    complement(order(457336..457338,457849..457851,
                     457855..457857,457933..457935,458209..458211))
                     /gene="glcB"
                     /locus_tag="PPUBIRD1_0392"
                     /note="active site"
                     /db_xref="CDD:238370"
     gene            459678..460196
                     /locus_tag="PPUBIRD1_0393"
                     /db_xref="GeneID:12518620"
     CDS             459678..460196
                     /locus_tag="PPUBIRD1_0393"
                     /codon_start=1
                     /transl_table=11
                     /product="ACT domain-containing protein"
                     /protein_id="YP_005928293.1"
                     /db_xref="GI:386010016"
                     /db_xref="GeneID:12518620"
                     /translation="MDHLVLTVIAPDKAGQVERIAQCIADHSGNWLESRMSRMAGQFA
                     GILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIV
                     RDITRLLAELQVNVERFSTEVRPAPMSSEPLFHADALLALPLTLPLDELQQKLESLAD
                     DLMVELKLRAED"
     misc_feature    459678..460181
                     /locus_tag="PPUBIRD1_0393"
                     /note="Glycine cleavage system regulatory protein [Amino
                     acid transport and metabolism]; Region: GcvR; COG2716"
                     /db_xref="CDD:225337"
     misc_feature    459684..459881
                     /locus_tag="PPUBIRD1_0393"
                     /note="ACT domain; Region: ACT_6; pfam13740"
                     /db_xref="CDD:205914"
     misc_feature    459945..460184
                     /locus_tag="PPUBIRD1_0393"
                     /note="ACT domains that comprise the Glycine Cleavage
                     System Transcriptional Repressor (GcvR) protein, and other
                     related domains; Region: ACT_GcvR_2; cd04869"
                     /db_xref="CDD:153141"
     gene            complement(460521..461408)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_0394"
                     /db_xref="GeneID:12518621"
     CDS             complement(460521..461408)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_0394"
                     /note="RarD protein, DMT superfamily transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RarD"
                     /protein_id="YP_005928294.1"
                     /db_xref="GI:386010017"
                     /db_xref="GeneID:12518621"
                     /translation="MHAANPRRGYILGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVL
                     WSALFGSLLLLVWKHPGWWRELRNNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEA
                     SLGYYINPLINVLLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALS
                     FGFYGLIRKQAPVAALPGLVVETWMLVPLAIGWLLLHPAAMSAQGAFYTSSEALWLMA
                     AGPVTLVPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVVLFDEHLSSSTLAAFMFI
                     WAGLAIYSVDAWLNLRKRS"
     misc_feature    complement(460524..461402)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_0394"
                     /note="Predicted permeases [General function prediction
                     only]; Region: RarD; COG2962"
                     /db_xref="CDD:225510"
     misc_feature    complement(460986..461357)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_0394"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(461473..462446)
                     /note="potential frameshift: common BLAST hit:
                     gi|148545640|ref|YP_001265742.1| serine/threonine protein
                     kinase"
     gene            complement(461473..462012)
                     /locus_tag="PPUBIRD1_0395"
                     /db_xref="GeneID:12518622"
     CDS             complement(461473..462012)
                     /locus_tag="PPUBIRD1_0395"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein kinase"
                     /protein_id="YP_005928295.1"
                     /db_xref="GI:386010018"
                     /db_xref="GeneID:12518622"
                     /translation="MDNFGHASLNTLLEGNFVPRELLPAFESVARDLLKRVEDIYART
                     PHQLIRLHGDLHPGNLMHRDEVYHVVDLDDCRMGPAVQDLWMMLAGNREERLGQLAEL
                     IDGYNEFHDFDPRELALIEPLRALRQLHYNAWLARRWDDPAFPPSFPWFGQPRYWGDQ
                     ILALREQMAALDEAPLKLF"
     misc_feature    complement(461479..>462009)
                     /locus_tag="PPUBIRD1_0395"
                     /note="serine/threonine protein kinase; Provisional;
                     Region: PRK11768"
                     /db_xref="CDD:236974"
     misc_feature    complement(461653..>461955)
                     /locus_tag="PPUBIRD1_0395"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     gene            complement(461985..462446)
                     /locus_tag="PPUBIRD1_0396"
                     /db_xref="GeneID:12518623"
     CDS             complement(461985..462446)
                     /locus_tag="PPUBIRD1_0396"
                     /codon_start=1
                     /transl_table=11
                     /product="Serine/threonine protein kinase"
                     /protein_id="YP_005928296.1"
                     /db_xref="GI:386010019"
                     /db_xref="GeneID:12518623"
                     /translation="MSHPFDTLTPDLVLDAVESLGFLSDARVLALNSYENRVYQVGIE
                     DAQPLIAKFYRPGRWSDAAILEEHAFTAELADCEVPVVAPMQHNDRTLFEHKGFRFTL
                     FPRRGGHAPNLATSTSCIAWASYLAACMPWAPASRSSTVRHWLWTTLATPR"
     misc_feature    complement(<462108..462446)
                     /locus_tag="PPUBIRD1_0396"
                     /note="serine/threonine protein kinase; Provisional;
                     Region: PRK11768"
                     /db_xref="CDD:236974"
     gene            complement(462605..463369)
                     /locus_tag="PPUBIRD1_0397"
                     /db_xref="GeneID:12518624"
     CDS             complement(462605..463369)
                     /locus_tag="PPUBIRD1_0397"
                     /codon_start=1
                     /transl_table=11
                     /product="ModE family transcriptional regulator"
                     /protein_id="YP_005928297.1"
                     /db_xref="GI:386010020"
                     /db_xref="GeneID:12518624"
                     /translation="MSLPPVLTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAA
                     WDAIDELNNLASQPLVKRSTGGRGGGGAHLSPEGERVLRLYQRLQALQAQILEAAEES
                     GDLDLLGRLMLRTSARNQLQGQVSGLRPEGRYDRVSLALGGGLEIDALITHDSTARLE
                     LTLGTMVVALLKAGWVRLLAEGEEAEAGSNCLCTKVEEVLAEVDGPSEVRLALGNGQT
                     LCAMADAHWLAAQQVVDGSVVRVQFHPSYVLIGVPA"
     misc_feature    complement(462620..463351)
                     /locus_tag="PPUBIRD1_0397"
                     /note="DNA-binding transcriptional regulator ModE;
                     Provisional; Region: PRK10676"
                     /db_xref="CDD:182640"
     misc_feature    complement(463007..463327)
                     /locus_tag="PPUBIRD1_0397"
                     /note="N-terminal domain of molybdenum-binding protein
                     [General function prediction only]; Region: ModE; COG2005"
                     /db_xref="CDD:224916"
     misc_feature    complement(462827..463033)
                     /locus_tag="PPUBIRD1_0397"
                     /note="TOBE domain; Region: TOBE; cl01440"
                     /db_xref="CDD:260939"
     gene            complement(463419..464150)
                     /locus_tag="PPUBIRD1_0398"
                     /db_xref="GeneID:12518625"
     CDS             complement(463419..464150)
                     /locus_tag="PPUBIRD1_0398"
                     /codon_start=1
                     /transl_table=11
                     /product="Competence protein ComF, putative"
                     /protein_id="YP_005928298.1"
                     /db_xref="GI:386010021"
                     /db_xref="GeneID:12518625"
                     /translation="MNCQLHWKRLVYKCSLINQKCLLCDEPAEQHYPLCITCEQALPW
                     LGDQCRHCALPLPMAGLTCAPCGRCLPAFDQVIALWHFGFPVDTLISRFKHNRQWPLG
                     RLMAELLGQGLLYRYAEGLPRPDLLLPVPLARRRLRERGFNQAGMLGRWLSSHVGVTC
                     NERLLVRTRETPAQQHLGAKARQRNLRQAFAVKGELEGKHVAIVDDVLTTGATAQAIA
                     QALRKAGARRVDVYCLARTPKPGYV"
     misc_feature    complement(463434..464054)
                     /locus_tag="PPUBIRD1_0398"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    complement(463425..463826)
                     /locus_tag="PPUBIRD1_0398"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(463440..463442,463512..463526,
                     463530..463538,463731..463733,463758..463760))
                     /locus_tag="PPUBIRD1_0398"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            464240..465298
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /db_xref="GeneID:12518626"
     CDS             464240..465298
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /EC_number="2.8.1.6"
                     /note="Biotin synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="protein BioB"
                     /protein_id="YP_005928299.1"
                     /db_xref="GI:386010022"
                     /db_xref="GeneID:12518626"
                     /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNL
                     DTSPEFYGSIITTRTYSERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANL
                     PEHPESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIE
                     QALVEQRSSEMFYDAATA"
     misc_feature    464261..465289
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /note="biotin synthase; Provisional; Region: PRK15108"
                     /db_xref="CDD:185063"
     misc_feature    464405..465004
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(464414..464416,464420..464422,464426..464428,
                     464432..464440,464552..464554,464558..464563,
                     464645..464647,464714..464716,464831..464833,
                     464924..464929)
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    464915..465193
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_0399"
                     /note="Biotin and Thiamin Synthesis associated domain;
                     Region: BATS; smart00876"
                     /db_xref="CDD:214877"
     gene            465300..466472
                     /locus_tag="PPUBIRD1_0400"
                     /db_xref="GeneID:12518627"
     CDS             465300..466472
                     /locus_tag="PPUBIRD1_0400"
                     /EC_number="2.3.1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_005928300.1"
                     /db_xref="GI:386010023"
                     /db_xref="GeneID:12518627"
                     /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCS
                     NDYLGLANHPEVIAAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALL
                     FSTGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDPASLASRL
                     DKAVGNTLVVTDGVFSMDGDLADLPALADVARARGAWLMVDDAHGLGTLGAQGGGIVE
                     HFGLGVDDVPVLIGTLGKACGTAGAFVAGSEALIEALVQFARPYIYTTSQPPALACAT
                     LKSLELLRRETWRREHLAALIRQFREGAQQLGLQLMDSPTPIQPIVIGDSAQALRLSR
                     LLRERGLLVTAIRPPTVPAGSARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
     misc_feature    465363..466436
                     /locus_tag="PPUBIRD1_0400"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    465408..466445
                     /locus_tag="PPUBIRD1_0400"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    order(465432..465434,465612..465620,465690..465692,
                     465813..465815,465825..465830,465900..465902,
                     465906..465911,465996..465998,466005..466007,
                     466374..466376)
                     /locus_tag="PPUBIRD1_0400"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    order(465612..465620,465690..465692,465813..465815,
                     465825..465827,465900..465902,465906..465911,
                     465996..465998,466005..466007)
                     /locus_tag="PPUBIRD1_0400"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    466005..466007
                     /locus_tag="PPUBIRD1_0400"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            466465..467196
                     /gene="bioH"
                     /locus_tag="PPUBIRD1_0401"
                     /db_xref="GeneID:12518628"
     CDS             466465..467196
                     /gene="bioH"
                     /locus_tag="PPUBIRD1_0401"
                     /EC_number="3.1.1.1"
                     /note="carboxylesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="BioH protein"
                     /protein_id="YP_005928301.1"
                     /db_xref="GI:386010024"
                     /db_xref="GeneID:12518628"
                     /translation="MRNRLVLLPGWGLGTAALEPLAASLRAQDARLQVELMPLPELAH
                     SDVQAWIDHLDRKLPNNVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPSFLARPD
                     WPHGMAEDTFGTFLDGCRNHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPDTDPLYL
                     ATGLEVLAKLDTREALQAYDGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSS
                     HAFLLEYPQELAAGIKSFLHESGDD"
     misc_feature    466477..467172
                     /gene="bioH"
                     /locus_tag="PPUBIRD1_0401"
                     /note="pimelyl-[acyl-carrier protein] methyl ester
                     esterase; Region: bioH; TIGR01738"
                     /db_xref="CDD:130799"
     gene            467189..468007
                     /locus_tag="PPUBIRD1_0402"
                     /db_xref="GeneID:12518629"
     CDS             467189..468007
                     /locus_tag="PPUBIRD1_0402"
                     /codon_start=1
                     /transl_table=11
                     /product="biotin biosynthesis protein BioC"
                     /protein_id="YP_005928302.1"
                     /db_xref="GI:386010025"
                     /db_xref="GeneID:12518629"
                     /translation="MTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVGLSL
                     LEQLPAGLQPSHWLDLGSGTGHFSRMLAERFAQASGVAVDIAEGMLLHARHVKGGAQY
                     HVVGDAERLPLRDGSIDLVFSSLAVQWCDQFASVLAEAQRVLCPGGVLAFSSLCVGTL
                     DELRASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELERCPHVLHYPDVRSLTHEL
                     KALGAHNLNPGRPSGLTGRARMQGLLQAYEAFRQPAGLPATYQVVYGVLRKPQV"
     misc_feature    467276..467995
                     /locus_tag="PPUBIRD1_0402"
                     /note="biotin biosynthesis protein BioC; Region: BioC;
                     TIGR02072"
                     /db_xref="CDD:233708"
     misc_feature    467360..467647
                     /locus_tag="PPUBIRD1_0402"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(467366..467386,467438..467443,467504..467512,
                     467558..467560)
                     /locus_tag="PPUBIRD1_0402"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            468018..468698
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_0403"
                     /db_xref="GeneID:12518630"
     CDS             468018..468698
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_0403"
                     /EC_number="6.3.3.3"
                     /note="dithiobiotin synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="BioD"
                     /protein_id="YP_005928303.1"
                     /db_xref="GI:386010026"
                     /db_xref="GeneID:12518630"
                     /translation="MSQAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGC
                     TMTPKGLRNSDALALIDESTVKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAA
                     MRNVLQQNADFTLIEGAGGWRVPLSGLENLSDLAVALRLPVILVVGVRLGCISHALLS
                     AEAIERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAE
                     HLQLDLLD"
     misc_feature    468024..468647
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_0403"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     misc_feature    468027..468695
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_0403"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     gene            468911..469207
                     /locus_tag="PPUBIRD1_0404"
                     /db_xref="GeneID:12518631"
     CDS             468911..469207
                     /locus_tag="PPUBIRD1_0404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928304.1"
                     /db_xref="GI:386010027"
                     /db_xref="GeneID:12518631"
                     /translation="MEITGSSAYYAGLSAIQTGQNRVDQAASQIANTTAERTATSQSS
                     DFQAERLRAVDRSQQMDLATSVVQQAVGKTEVELGAKVVKASDEMLGRIIDTYA"
     gene            469496..471301
                     /locus_tag="PPUBIRD1_0405"
                     /db_xref="GeneID:12518632"
     CDS             469496..471301
                     /locus_tag="PPUBIRD1_0405"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_005928305.1"
                     /db_xref="GI:386010028"
                     /db_xref="GeneID:12518632"
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILE
                     EGAKFCEQVLSPLNRVGDQEGCTWSESGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGG
                     QGLPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTAEQQHTYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEPQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLP
                     DAPAGTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGY
                     LIGPANKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPD
                     KAADPIIVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAF
                     LTPIAKAFMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARF
                     YFQRILPRTRTHVATMLSGANNLMAMDEEHFGLSY"
     misc_feature    469499..469600
                     /locus_tag="PPUBIRD1_0405"
                     /note="Acyl-CoA dehydrogenase N terminal; Region:
                     AcylCoA_DH_N; pfam12418"
                     /db_xref="CDD:257037"
     misc_feature    469505..471292
                     /locus_tag="PPUBIRD1_0405"
                     /note="acyl-CoA dehydrogenase; Provisional; Region:
                     PTZ00456"
                     /db_xref="CDD:185635"
     misc_feature    469619..470863
                     /locus_tag="PPUBIRD1_0405"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(469892..469894,469982..469984,469988..469990,
                     470084..470086,470090..470092,470810..470818,
                     470822..470824,470828..470830)
                     /locus_tag="PPUBIRD1_0405"
                     /note="active site"
                     /db_xref="CDD:173838"
     misc_feature    470894..471277
                     /locus_tag="PPUBIRD1_0405"
                     /note="Acetyl-CoA dehydrogenase C-terminal like; Region:
                     Acyl-CoA_dh_C; pfam12806"
                     /db_xref="CDD:257313"
     gene            471675..472958
                     /locus_tag="PPUBIRD1_0406"
                     /db_xref="GeneID:12518633"
     CDS             471675..472958
                     /locus_tag="PPUBIRD1_0406"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase"
                     /protein_id="YP_005928306.1"
                     /db_xref="GI:386010029"
                     /db_xref="GeneID:12518633"
                     /translation="MFRLNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPT
                     LVLLLGGAYCAVYRRQRELFLMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCL
                     LLPALFGLYGAWQERTHLLQDLVARGAVLFAVGSVAVALQQSYPEALLTWLAEIRWPA
                     LHGHWMSLIQMVYPLFLGVFILLVVQYLRAPRPLHAAQLIGLLGIFWMLPQTFILPFT
                     LNIMCSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDH
                     FKKFNDTHGHDVGDQVLRLVASRLSKVTGGGRAYRYGGEEFALVFAGKTAAECVPHVE
                     AVREVIANYVMHLRDQHNRPQDDTAGRQRRAGSTGGTVSVTISIGVAERQADHRNPEA
                     VLKSADQALYSAKGAGRNCVMVHGRQSLRGAVRTA"
     misc_feature    472401..472910
                     /locus_tag="PPUBIRD1_0406"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(472491..472493,472617..472619)
                     /locus_tag="PPUBIRD1_0406"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(472506..472508,472515..472520,472530..472532,
                     472542..472544,472611..472622)
                     /locus_tag="PPUBIRD1_0406"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(472596..472598,472677..472679)
                     /locus_tag="PPUBIRD1_0406"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            473083..474861
                     /locus_tag="PPUBIRD1_0407"
                     /db_xref="GeneID:12518634"
     CDS             473083..474861
                     /locus_tag="PPUBIRD1_0407"
                     /EC_number="1.3.8.1"
                     /codon_start=1
                     /transl_table=11
                     /product="Acyl-CoA dehydrogenase domain-containing
                     protein"
                     /protein_id="YP_005928307.1"
                     /db_xref="GI:386010030"
                     /db_xref="GeneID:12518634"
                     /translation="MADYKAPLRDMRFVLNEVFNVAEQWTQLPGLAEVVDADTAIAVL
                     EEAGKVTARTIAPLSRAADEEGCHWDNGAVRTPAGFIEAYNTYAEGGWVGVGGDPLFG
                     GMGMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKEKYLPNMYAGVW
                     AGSMCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKL
                     PDAPAGPKGISLFLVPKFLVNEDGSLGARNPATCGSIEHKMGIQASATCVMNFDEAVG
                     YIVGEPNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPTGPQAK
                     DKAADPIIVHPDVRRMLLTMKALIEGGRAFSTYVAMQLDSAKYSEDASVRKRSEELVA
                     LLTPVAKAFLTDLGLECAVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQAL
                     DLMGRKVVASGGAYYKLFSDEIRQFINRAGSELDEFTKPLGASLDQLDGLTEWVLQQA
                     KGNPNEIGAASVEYLHAFGYVAYGYMWALMARAAQAGEGDAPFYSGKLGTARFYFARL
                     LPRVDSLVASVKAGSESLYLLDAEQF"
     misc_feature    473086..473184
                     /locus_tag="PPUBIRD1_0407"
                     /note="Acyl-CoA dehydrogenase N terminal; Region:
                     AcylCoA_DH_N; pfam12418"
                     /db_xref="CDD:257037"
     misc_feature    473092..474828
                     /locus_tag="PPUBIRD1_0407"
                     /note="acyl-CoA dehydrogenase; Provisional; Region:
                     PTZ00456"
                     /db_xref="CDD:185635"
     misc_feature    473209..474456
                     /locus_tag="PPUBIRD1_0407"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(473482..473484,473572..473574,473578..473580,
                     473674..473676,473680..473682,474400..474408,
                     474412..474414,474418..474420)
                     /locus_tag="PPUBIRD1_0407"
                     /note="active site"
                     /db_xref="CDD:173838"
     misc_feature    474481..474849
                     /locus_tag="PPUBIRD1_0407"
                     /note="Acetyl-CoA dehydrogenase C-terminal like; Region:
                     Acyl-CoA_dh_C; pfam12806"
                     /db_xref="CDD:257313"
     gene            complement(475200..476123)
                     /locus_tag="PPUBIRD1_0408"
                     /db_xref="GeneID:12518635"
     CDS             complement(475200..476123)
                     /locus_tag="PPUBIRD1_0408"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_005928308.1"
                     /db_xref="GI:386010031"
                     /db_xref="GeneID:12518635"
                     /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLD
                     LSLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVR
                     PSLIPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGNLDIGISYLPPRQPGLHGLLL
                     YEDELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPQVQ
                     AEMNNMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDAQ
                     RQQASVELLRTLLEEETDARLLGASPLDVLA"
     misc_feature    complement(475278..476123)
                     /locus_tag="PPUBIRD1_0408"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(475938..476117)
                     /locus_tag="PPUBIRD1_0408"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(475305..475850)
                     /locus_tag="PPUBIRD1_0408"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(475425..475430,475434..475439,
                     475455..475472,475746..475766,475770..475772,
                     475782..475784,475791..475796,475800..475805))
                     /locus_tag="PPUBIRD1_0408"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            476335..477615
                     /locus_tag="PPUBIRD1_0409"
                     /db_xref="GeneID:12518636"
     CDS             476335..477615
                     /locus_tag="PPUBIRD1_0409"
                     /EC_number="2.6.1.11"
                     /codon_start=1
                     /transl_table=11
                     /product="Aminotransferase class-III"
                     /protein_id="YP_005928309.1"
                     /db_xref="GI:386010032"
                     /db_xref="GeneID:12518636"
                     /translation="MNLFNLRRSAPAAVAEPKCAPVIVPHATELSPERLMPGAERAAQ
                     VFVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNR
                     GLLGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITASQACHG
                     RSLGALSASDPLPCNRCEPGLPGFSKVPFNDLAVLHAEVDSRTVAIMLEPIQGEAGVI
                     PATQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG
                     VPLAALLARGKACCAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLR
                     EGLSRLTGRYGQGEVRGHGLLWALQLKENLARELVAAALHEGLLLNAPQVDVVRFSPA
                     LTVSKGNIDEMLLRLARAFARLHAQQQARREVPA"
     misc_feature    476440..477567
                     /locus_tag="PPUBIRD1_0409"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    476467..477567
                     /locus_tag="PPUBIRD1_0409"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(476707..476715,476806..476811,476815..476817,
                     476959..476961,477058..477060,477064..477069,
                     477145..477147)
                     /locus_tag="PPUBIRD1_0409"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(476710..476715,476806..476811,476959..476961,
                     477058..477060,477067..477069,477145..477147)
                     /locus_tag="PPUBIRD1_0409"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    477145..477147
                     /locus_tag="PPUBIRD1_0409"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            477763..477921
                     /locus_tag="PPUBIRD1_0410"
                     /db_xref="GeneID:12518637"
     CDS             477763..477921
                     /locus_tag="PPUBIRD1_0410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928310.1"
                     /db_xref="GI:386010033"
                     /db_xref="GeneID:12518637"
                     /translation="MDFIRIIIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     misc_feature    477763..477915
                     /locus_tag="PPUBIRD1_0410"
                     /note="Proteolipid membrane potential modulator; Region:
                     Pmp3; pfam01679"
                     /db_xref="CDD:250793"
     gene            complement(477984..479807)
                     /locus_tag="PPUBIRD1_0411"
                     /db_xref="GeneID:12518638"
     CDS             complement(477984..479807)
                     /locus_tag="PPUBIRD1_0411"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase S9 prolyl oligopeptidase"
                     /protein_id="YP_005928311.1"
                     /db_xref="GI:386010034"
                     /db_xref="GeneID:12518638"
                     /translation="MIETPVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWNEFRPAD
                     GACRIWHWLHYQARCLTPDGFSVRSRVYEYGGGSFCPGGDGLVFVNEKDQQVYTQPLD
                     DLLPRALTQDASCRYGDVQWHDGHVLAVEERHAEHVEHRLVALGDSSREVLAEGADFY
                     ASPTVSADGQRLAWIEWDRPAQPWTVTRLMCSVRDASGHWGPAQCVAAAEESLQQPRF
                     DAEGRLYCLSDRNGFWQPWGEVDGQWQALPAAPADHAAAPWQLGTCTWLALGPQSYLA
                     SWFEDGFGQLGLRGEDGRMERFASAYTRFRSLAMDSEHLYAIAASPISPPAVIAIDRS
                     NHEVRVLAGGAEILPAGQISLPQSIHYGSDGEQAHGFFYPPAQSKSAAPLVVFIHGGP
                     TSACYPVLDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALNQRWGESDVADACAVVE
                     YLAAQGLVDKQKAFIRGGSAGGYTTLCALAFHDVFRAGASLYGVSDPIALGRATHKFE
                     GDYLDWLIGDPQRDTERYRQRTPLLHAQRIKVPVIFFQGELDAVVVPEQTRAMLAALQ
                     ANGIDAEGYFYAQERHGFRKAENLAHALEEEWKFYCRVLAQ"
     misc_feature    complement(478056..478898)
                     /locus_tag="PPUBIRD1_0411"
                     /note="Esterase/lipase [Lipid metabolism]; Region: Aes;
                     COG0657"
                     /db_xref="CDD:223730"
     misc_feature    complement(477993..478616)
                     /locus_tag="PPUBIRD1_0411"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     pfam00326"
                     /db_xref="CDD:249771"
     gene            complement(479773..480933)
                     /locus_tag="PPUBIRD1_0412"
                     /db_xref="GeneID:12518639"
     CDS             complement(479773..480933)
                     /locus_tag="PPUBIRD1_0412"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein E"
                     /protein_id="YP_005928312.1"
                     /db_xref="GI:386010035"
                     /db_xref="GeneID:12518639"
                     /translation="MPNTGSSSPELPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDF
                     AAQGQELSTEQWFKVMAEAREMGAAQIGFSGGEPLVRQDLAELIGEARRLGYYTNLIT
                     SGIGLTEARIADFKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGY
                     PMVLNFVTHRHNIEKIDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTRAQLER
                     AERITNEYRDKLKAEGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHG
                     ARQLPVQFPNVRDHDLHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFM
                     LTGDASNADPVCAKSTEHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
     misc_feature    complement(479776..480915)
                     /locus_tag="PPUBIRD1_0412"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqE;
                     Provisional; Region: PRK05301"
                     /db_xref="CDD:235397"
     misc_feature    complement(480331..480858)
                     /locus_tag="PPUBIRD1_0412"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(480337..480342,480433..480435,
                     480556..480558,480625..480633,480703..480708,
                     480712..480714,480817..480825,480829..480831,
                     480835..480837,480841..480843))
                     /locus_tag="PPUBIRD1_0412"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(479896..480174)
                     /locus_tag="PPUBIRD1_0412"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            complement(480905..481180)
                     /gene="pqqD"
                     /locus_tag="PPUBIRD1_0413"
                     /db_xref="GeneID:12518640"
     CDS             complement(480905..481180)
                     /gene="pqqD"
                     /locus_tag="PPUBIRD1_0413"
                     /note="Coenzyme PQQ synthesis protein D 1"
                     /codon_start=1
                     /transl_table=11
                     /product="PqqD"
                     /protein_id="YP_005928313.1"
                     /db_xref="GI:386010036"
                     /db_xref="GeneID:12518640"
                     /translation="MSFDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNDSASLI
                     GGLIDGQRDVAAIISELEQQFPGVPEVADDIEQFMEVARAEHWIVLA"
     misc_feature    complement(480908..481171)
                     /gene="pqqD"
                     /locus_tag="PPUBIRD1_0413"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqD;
                     Provisional; Region: PRK02079"
                     /db_xref="CDD:179362"
     gene            complement(481177..481932)
                     /gene="pqqC"
                     /locus_tag="PPUBIRD1_0414"
                     /db_xref="GeneID:12518641"
     CDS             complement(481177..481932)
                     /gene="pqqC"
                     /locus_tag="PPUBIRD1_0414"
                     /EC_number="1.3.3.11"
                     /note="Pyrroloquinoline-quinone synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="PqqC"
                     /protein_id="YP_005928314.1"
                     /db_xref="GI:386010037"
                     /db_xref="GeneID:12518641"
                     /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQ
                     GWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQ
                     AVGLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDS
                     WPQHYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDIL
                     WSMLDAMSMAYELNRPPYHSVTQERVWHKGITL"
     misc_feature    complement(481204..481932)
                     /gene="pqqC"
                     /locus_tag="PPUBIRD1_0414"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqC;
                     Provisional; Region: PRK05157"
                     /db_xref="CDD:235353"
     gene            complement(482095..483006)
                     /gene="pqqB"
                     /locus_tag="PPUBIRD1_0415"
                     /db_xref="GeneID:12518642"
     CDS             complement(482095..483006)
                     /gene="pqqB"
                     /locus_tag="PPUBIRD1_0415"
                     /note="Coenzyme PQQ synthesis protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="PqqB"
                     /protein_id="YP_005928315.1"
                     /db_xref="GI:386010038"
                     /db_xref="GeneID:12518642"
                     /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIAL
                     SDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLRE
                     GCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP
                     LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLL
                     VDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPI
                     LDEDSPERAEVLRRGVEVAFDGMSIEL"
     misc_feature    complement(482098..483006)
                     /gene="pqqB"
                     /locus_tag="PPUBIRD1_0415"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqB;
                     Provisional; Region: PRK05184"
                     /db_xref="CDD:235361"
     gene            complement(483316..485616)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /db_xref="GeneID:12518643"
     CDS             complement(483316..485616)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /note="Coenzyme PQQ synthesis protein F"
                     /codon_start=1
                     /transl_table=11
                     /product="PqqF"
                     /protein_id="YP_005928316.1"
                     /db_xref="GI:386010039"
                     /db_xref="GeneID:12518643"
                     /translation="MPDAIRQLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPAKW
                     PGLAHFLEHLFFLGTLRFPLEDGLMRYVQALGGQVNASTRERATDFFFEVPPNALGGG
                     LERLCQMLAEPNLGIERQRREREVIHAEFIAWSRNPSAQQQFALLQSVSAKHPLGAFH
                     AGNRYTLALHDAAFQQALAGFHQRFYQGGQICLSLCGPQPLDELERLARQHAELFAAG
                     ERVPQMLPPPLPAIASSLTFTHQGLPSGAEHALELLFAYLEDSRPGTWLGALRERGWL
                     QRFTAERLYAFAGQLLWHLDLKLSADACPDEASALLQGWFKFIRQADREQLNHQFGLL
                     QRSRAHSASALELARRDSTGQPFAKLDTQGLQALGALLESLPGGDHGDWQLLPVDPLL
                     KADLPHAKTQPLPAAMKISDQLPPARQFAALYLRWHVPSPLRQPLERVLEQALAPLQE
                     RCDRASVQLQYSSAGEYWQLRCAGLPAAVLRAVEQALALMLKPPASCWLPCTAQPPAL
                     IPIRALLKQLPDAVRGSVPEVVPACTLTQQQLDSLWLHTEWHGMAAGFEDTALNALGT
                     ALLQCPGQGSRPSPLPSWANHRWQHAHVPGSEHALLLFCPLPAAKEAAGRLLAQLLQG
                     PVYQRLRVDLQLGYAVFSAFRQIEGVGGLLFGVQSPHTAQAQVLDHLLSLLRHGVTLD
                     PAARQALAGQFDEPAMADADVAEWAWQTHLATQADRLDVLRRSILTTRQTDLDHLLSD
                     LLDPGSAWLCLANAAAPDTSWQGENR"
     misc_feature    complement(483589..485601)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /note="coenzyme PQQ biosynthesis probable peptidase PqqF;
                     Region: PQQ_syn_pqqF; TIGR02110"
                     /db_xref="CDD:233732"
     misc_feature    complement(485179..485565)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    complement(<484927..485091)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     misc_feature    complement(483577..>483780)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_0416"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(485757..486551)
                     /locus_tag="PPUBIRD1_0417"
                     /db_xref="GeneID:12518644"
     CDS             complement(485757..486551)
                     /locus_tag="PPUBIRD1_0417"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilase/cyanide hydratase and apolipoprotein
                     N-acyltransferase"
                     /protein_id="YP_005928317.1"
                     /db_xref="GI:386010040"
                     /db_xref="GeneID:12518644"
                     /translation="MRIALYQGAPKPLDVPGNLQRLLHQAQLAAERGAQLLVCPEMFL
                     TGYNIGLAQVERLAEAADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDA
                     HGRSLSNYRKTHLFGELDRSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLAL
                     DGAELILVPTANMTPYDFTCQVTVRARAQENQCYLVYANYCGAEDEIQYCGQSSIIGP
                     DGSLLAMAGRDECQLLAELEHERVVQGRRAFPYLTDLRQELHLRKG"
     misc_feature    complement(485784..486548)
                     /locus_tag="PPUBIRD1_0417"
                     /note="Pseudomonas sp. MCI3434 R-amidase and related
                     proteins (putative class 13 nitrilases); Region:
                     R-amidase_like; cd07576"
                     /db_xref="CDD:143600"
     misc_feature    complement(order(486039..486041,486102..486107,
                     486111..486116,486192..486194,486204..486206,
                     486216..486218,486429..486431))
                     /locus_tag="PPUBIRD1_0417"
                     /note="putative active site [active]"
                     /db_xref="CDD:143600"
     misc_feature    complement(order(486114..486116,486216..486218,
                     486429..486431))
                     /locus_tag="PPUBIRD1_0417"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143600"
     misc_feature    complement(order(485784..485795,485916..485921,
                     485982..485987,485991..485999,486003..486008,
                     486081..486086,486093..486107,486111..486113,
                     486165..486167,486171..486176,486195..486197,
                     486204..486215))
                     /locus_tag="PPUBIRD1_0417"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143600"
     gene            complement(486566..488248)
                     /locus_tag="PPUBIRD1_0418"
                     /db_xref="GeneID:12518645"
     CDS             complement(486566..488248)
                     /locus_tag="PPUBIRD1_0418"
                     /EC_number="1.13.12.3"
                     /codon_start=1
                     /transl_table=11
                     /product="Amine oxidase"
                     /protein_id="YP_005928318.1"
                     /db_xref="GI:386010041"
                     /db_xref="GeneID:12518645"
                     /translation="MNKKNRHPADGKKPITIFGPDFPFAFDDWLEHPAGLGSIPAERH
                     GEEVAIVGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIVAELGGMR
                     FPVSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKPTDLPQLFHEVA
                     DAWADALESGAQFADIQQAIRDRDVPRLKELWNKLVPLWDDRTFYDFVATSRSFAKLS
                     FQHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHV
                     PERCVHWPEGTSLSTLHGGAPRTGVKRIARAADGRLAVTDNWGDTRHYSAVLATCQTW
                     LLTTQIDCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLLSMTLT
                     DRLTRGTYLFDNGNDKPGVICLSYSWMSDALKMLPHPVEKRVQLALDALKKIYPKTDI
                     AGHIIGDPITVSWEADPYFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGIFIAGD
                     DVSWTPAWVEGAVQTSLNAVWGIMNHFGGHTHPDNPGPGDVFNEIGPIALAD"
     misc_feature    complement(487898..488101)
                     /locus_tag="PPUBIRD1_0418"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    complement(486653..488086)
                     /locus_tag="PPUBIRD1_0418"
                     /note="Flavin containing amine oxidoreductase; Region:
                     Amino_oxidase; pfam01593"
                     /db_xref="CDD:250729"
     gene            complement(488588..489049)
                     /locus_tag="PPUBIRD1_0419"
                     /db_xref="GeneID:12518646"
     CDS             complement(488588..489049)
                     /locus_tag="PPUBIRD1_0419"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_005928319.1"
                     /db_xref="GI:386010042"
                     /db_xref="GeneID:12518646"
                     /translation="MSDSRSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNS
                     RLERLEKNKVISGYGVRLGQSVIGGGLQAYVGIKVQPRSGKDVVRRLSAMGQVQQLCA
                     VSGEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPL"
     misc_feature    complement(488603..489037)
                     /locus_tag="PPUBIRD1_0419"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    complement(488705..489025)
                     /locus_tag="PPUBIRD1_0419"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    complement(order(488876..488881,488897..488902,
                     488906..488911,488918..488923,488927..488938,
                     488963..488971,489011..489019))
                     /locus_tag="PPUBIRD1_0419"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(488960..488962,488969..488971))
                     /locus_tag="PPUBIRD1_0419"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            489237..489791
                     /locus_tag="PPUBIRD1_0420"
                     /db_xref="GeneID:12518647"
     CDS             489237..489791
                     /locus_tag="PPUBIRD1_0420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928320.1"
                     /db_xref="GI:386010043"
                     /db_xref="GeneID:12518647"
                     /translation="MNLDHLLECWRLEVSNKKRPGRPISLLFNVLRRARKDNKLRFLF
                     AYRLAQYLDARGGLARRHARRMQQRLNLKYGVDIDIGAQIAPGLRIAHLPGVVITRYV
                     SIGRNFFIRQNCSIGIKTLGLDEYALRIGDNVSMGANSCIVADRIDIGDDVVIGAMSL
                     VTRDIPPGMTFYNPRQVEMRPGGG"
     misc_feature    489456..489752
                     /locus_tag="PPUBIRD1_0420"
                     /note="Serine acetyltransferase (SAT): SAT catalyzes the
                     CoA-dependent acetylation of the side chain hydroxyl group
                     of L-serine to form O-acetylserine, as the first step of a
                     two-step biosynthetic pathway in bacteria and plants
                     leading to the formation of...; Region: LbH_SAT; cd03354"
                     /db_xref="CDD:100045"
     misc_feature    order(489459..489461,489465..489467,489510..489512,
                     489612..489614,489705..489707,489714..489716,
                     489720..489722)
                     /locus_tag="PPUBIRD1_0420"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100045"
     misc_feature    order(489507..489512,489567..489572,489588..489593,
                     489612..489617,489648..489650,489696..489698,
                     489702..489707,489714..489716,489720..489722,
                     489744..489746)
                     /locus_tag="PPUBIRD1_0420"
                     /note="active site"
                     /db_xref="CDD:100045"
     misc_feature    order(489507..489512,489588..489590,489612..489617)
                     /locus_tag="PPUBIRD1_0420"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100045"
     misc_feature    order(489567..489572,489588..489593,489648..489650,
                     489696..489698,489702..489707,489714..489716,
                     489720..489722,489744..489746)
                     /locus_tag="PPUBIRD1_0420"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100045"
     gene            complement(490133..490303)
                     /locus_tag="PPUBIRD1_0422"
                     /db_xref="GeneID:12518648"
     CDS             complement(490133..490303)
                     /locus_tag="PPUBIRD1_0422"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928321.1"
                     /db_xref="GI:386010044"
                     /db_xref="GeneID:12518648"
                     /translation="MVRGVYIQRSGAERMTLEVALKRYLSEIRPTKKPITQHADNRGK
                     VPYRYFKPNTLA"
     gene            complement(490356..490432)
                     /locus_tag="PPUBIRD1_t0061"
                     /note="tRNA-Met5"
                     /db_xref="GeneID:12518649"
     tRNA            complement(490356..490432)
                     /locus_tag="PPUBIRD1_t0061"
                     /product="tRNA-Met"
                     /db_xref="GeneID:12518649"
     gene            complement(490449..494192)
                     /locus_tag="PPUBIRD1_0423"
                     /db_xref="GeneID:12518650"
     CDS             complement(490449..494192)
                     /locus_tag="PPUBIRD1_0423"
                     /codon_start=1
                     /transl_table=11
                     /product="Sensory box protein"
                     /protein_id="YP_005928322.1"
                     /db_xref="GI:386010045"
                     /db_xref="GeneID:12518650"
                     /translation="MSLKPAILLLILILWNTTAGALTLTDEENAWLAAHPQLKLGVDA
                     SWPPFEFRDQEGRYQGLAADYIAMIQQRLGVTFKPVEPSSWTEVLVQARESRIDLLPG
                     IMSTPERQGFLAFTRPYLDFPIVILAHKGGAQPRKLADLYGLKIAVVENYAPHELLRT
                     HHPDLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQ
                     LAMAVPRDKSVLVGILDKVMADMSSSEISQIQQHWVGNVVDQRMFWSDLLVYGLPTVL
                     LLMAVLAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTY
                     SYVSPHAEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIR
                     ADGQPLWVRNIVSMIEHGHQPVMRGLMIDISETKRTEDALRLSEQKFASVFQQCPDIL
                     LIARHSDGCLLEVNEAFEEQIGLPPDQVIGRTATDLDLWGVEGSGPLLLERLHQGGIR
                     NLEMSFRRSNGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQQQLQTSEEKFAKA
                     FHASPDGLLLSRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRLVD
                     QLNRDGFVRDFTCHIRRSDGQIRLCELSARPLPITGVDCMLTIARDITERHLMQEKLQ
                     LAATVFENTAEGVLITDIDQRISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFY
                     LAMWHQLTAEGHWQGEIYNKRKNGELYPSWLTISAVRNSDREITHFVAVFADISSIKH
                     AQAKLDYQAHHDPLTGLPNRTLFENRLQGVLTCAQVSNRQGAVLFLDLDRFKHINDSL
                     GHPVGDLLLKGIAQRLKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACF
                     NAPFQAGEHEFFTSASIGISLYPQDGTDVSTLIRNADAAMYRSKAKGRNRVEAYTRDL
                     TAQASERIALEHELRRAVERNEMSLCFQPKLSLKTQSLVGAEALIRWSHPTFGEVPPE
                     HFIHLAEENGTILQLGDWVLEQACRQMQAWKQHYEPFGPLSINLAGAQLRHPHLARRI
                     EQLLKHHQLKAGDLQLEITENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSY
                     LKRLPLDILKIDKSFIRGLPDDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLA
                     AEGCEQIQGYIVSLPLPPEEFAAAFLRIALSDLSDGTGAKPSL"
     misc_feature    complement(493434..494081)
                     /locus_tag="PPUBIRD1_0423"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(493434..494081)
                     /locus_tag="PPUBIRD1_0423"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(493620..493622,493734..493736,
                     493866..493868,493938..493940,494055..494057))
                     /locus_tag="PPUBIRD1_0423"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(493641..493643,493659..493661,
                     493671..493673))
                     /locus_tag="PPUBIRD1_0423"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(493533..493550)
                     /locus_tag="PPUBIRD1_0423"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(492534..493205)
                     /locus_tag="PPUBIRD1_0423"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    complement(492927..493205)
                     /locus_tag="PPUBIRD1_0423"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(493008..493010,493023..493025,
                     493101..493112,493152..493154,493170..493172,
                     493182..493184))
                     /locus_tag="PPUBIRD1_0423"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(492987..492989,493071..493076,
                     493083..493085,493107..493109,493122..493124))
                     /locus_tag="PPUBIRD1_0423"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(492555..492854)
                     /locus_tag="PPUBIRD1_0423"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(490521..492821)
                     /locus_tag="PPUBIRD1_0423"
                     /note="cyclic-di-GMP phosphodiesterase; Provisional;
                     Region: PRK11359"
                     /db_xref="CDD:183097"
     misc_feature    complement(order(492636..492638,492651..492653,
                     492717..492719,492726..492731,492735..492737,
                     492774..492776,492792..492794,492804..492806))
                     /locus_tag="PPUBIRD1_0423"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(492609..492611,492615..492617,
                     492687..492692,492699..492701,492729..492731,
                     492744..492746))
                     /locus_tag="PPUBIRD1_0423"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(492180..492485)
                     /locus_tag="PPUBIRD1_0423"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(492261..492263,492276..492278,
                     492354..492365,492402..492404,492420..492422,
                     492432..492434))
                     /locus_tag="PPUBIRD1_0423"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(492234..492236,492240..492242,
                     492324..492329,492336..492338,492360..492362,
                     492372..492374))
                     /locus_tag="PPUBIRD1_0423"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(491814..492122)
                     /locus_tag="PPUBIRD1_0423"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(491901..491903,491916..491918,
                     491994..492005,492042..492044,492060..492062,
                     492072..492074))
                     /locus_tag="PPUBIRD1_0423"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(491874..491876,491880..491882,
                     491964..491969,491976..491978,492000..492002,
                     492012..492014))
                     /locus_tag="PPUBIRD1_0423"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(491298..491771)
                     /locus_tag="PPUBIRD1_0423"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(491529..491531,491658..491660))
                     /locus_tag="PPUBIRD1_0423"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(491526..491537,491541..491543,
                     491607..491609,491619..491621,491631..491636,
                     491643..491645))
                     /locus_tag="PPUBIRD1_0423"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(491466..491468,491553..491555))
                     /locus_tag="PPUBIRD1_0423"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(490521..491243)
                     /locus_tag="PPUBIRD1_0423"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(494320..496170)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /db_xref="GeneID:12518651"
     CDS             complement(494320..496170)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="RNA polymerase sigma factor rpoD"
                     /codon_start=1
                     /transl_table=11
                     /product="protein RpoD"
                     /protein_id="YP_005928323.1"
                     /db_xref="GI:386010046"
                     /db_xref="GeneID:12518651"
                     /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRL
                     SDVLSGYIDPDDNIAAPTEEVPIPGAKAAAAKEESDDDEEESESGDDEEEAESGPDPV
                     VAAQRFGAVSDQLQATSKVLKKNGRNHKESIEALQALADLFMPIKLVPKQFEVLVERV
                     RDALNRLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALG
                     EKNAAIVACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARRAKKEMVEANLRLVIS
                     IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQA
                     RTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPI
                     SMETPIGDDEDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRF
                     GIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
     misc_feature    complement(494323..496170)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="RNA polymerase sigma factor RpoD; Validated;
                     Region: PRK05658"
                     /db_xref="CDD:235549"
     misc_feature    complement(<495970..496155)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma-70 factor, region 1.1; Region: Sigma70_r1_1;
                     pfam03979"
                     /db_xref="CDD:252292"
     misc_feature    complement(495787..495882)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma-70 factor, region 1.2; Region: Sigma70_r1_2;
                     pfam00140"
                     /db_xref="CDD:249622"
     misc_feature    complement(495118..495756)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma-70, non-essential region; Region:
                     Sigma70_ner; pfam04546"
                     /db_xref="CDD:252662"
     misc_feature    complement(494815..495027)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(494557..494790)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma-70 region 3; Region: Sigma70_r3; pfam04539"
                     /db_xref="CDD:146934"
     misc_feature    complement(494365..494541)
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(494377..494379,494383..494388,
                     494392..494400,494404..494409,494413..494415,
                     494443..494448,494476..494478,494506..494508))
                     /gene="rpoD"
                     /locus_tag="PPUBIRD1_0424"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     misc_feature    complement(496238..498219)
                     /note="potential frameshift: common BLAST hit:
                     gi|148545674|ref|YP_001265776.1| DNA primase"
     gene            complement(496238..496507)
                     /gene="dnaG"
                     /locus_tag="PPUBIRD1_0425"
                     /db_xref="GeneID:12518652"
     CDS             complement(496238..496507)
                     /gene="dnaG"
                     /locus_tag="PPUBIRD1_0425"
                     /note="DNA primase"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaG"
                     /protein_id="YP_005928324.1"
                     /db_xref="GI:386010047"
                     /db_xref="GeneID:12518652"
                     /translation="MQLIARWHGTEQGRLLRALAEKEWLIVADNLEQQFFDTITSLSA
                     RQRERSLEQLLRKSRQSELTSEEKTQLLALLSRNVPAQTPTSSGA"
     misc_feature    complement(496283..>496507)
                     /gene="dnaG"
                     /locus_tag="PPUBIRD1_0425"
                     /note="DNA primase DnaG DnaB-binding; Region:
                     DnaG_DnaB_bind; pfam08278"
                     /db_xref="CDD:254704"
     gene            complement(496543..498219)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /db_xref="GeneID:12518653"
     CDS             complement(496543..498219)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="DNA primase"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaG_2"
                     /protein_id="YP_005928325.1"
                     /db_xref="GI:386010048"
                     /db_xref="GeneID:12518653"
                     /translation="MAGLIPQSFIDDLINRLDIVDVVSSRVQLKKTGKNYSACCPFHK
                     EKTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQG
                     RRDQKPRQPTDSPLYPLLDAASEFYRQALRSHPSRKAAVDYLKGRGLSGEIARDFGLG
                     FAPPGWDNLLKHLGADTLQQKVMIDAGLLIENAESGKRYDRFRDRVMFPIRDSRGRII
                     AFGGRVLGDDKPKYLNSPETPVFHKGQELYGLYEARKHNRNLDEIIVVEGYMDVIALA
                     QQGLRNAVATLGTATSEEHLKRLFRVVPSVLFCFDGDQAGRKAAWRALESTLSNLQDG
                     RRARFLFLPEGEDPDSLVRAEGTDAFMARINQHSQPLADYFFEQLGVEADPRSLEGKA
                     HMATLAAPLIEKIPGANLRQLMRNRLKEITGLDPQQVEQLAQQAPATSSMPDYDPGYD
                     YDAMASYTPDYGDMPQHDYAPVHQEQAWKPNKGAARSRGATNPGTRTAKAASPGSNAT
                     KHLPACQHRSSRPPWPRCAPCCTTHCWQARWKMPATSPTKNTCTASCWWR"
     misc_feature    complement(496960..498207)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="DNA primase, catalytic core; Region: dnaG;
                     TIGR01391"
                     /db_xref="CDD:233392"
     misc_feature    complement(497914..498207)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="CHC2 zinc finger; Region: zf-CHC2; pfam01807"
                     /db_xref="CDD:110780"
     misc_feature    complement(497458..497844)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:254701"
     misc_feature    complement(497194..497439)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="TOPRIM_DnaG_primases: The topoisomerase-primase
                     (TORPIM) nucleotidyl transferase/hydrolase domain found in
                     the active site regions of proteins similar to Escherichia
                     coli DnaG. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_DnaG_primases; cd03364"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(497275..497277,497281..497283,
                     497287..497289,497407..497409,497416..497421))
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="active site"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(497287..497289,497419..497421))
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(497359..497361,497389..497394,
                     497410..497415))
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173784"
     misc_feature    complement(496933..497109)
                     /gene="dnaG_2"
                     /locus_tag="PPUBIRD1_0426"
                     /note="DnaB-helicase binding domain of primase; Region:
                     DnaB_bind; pfam10410"
                     /db_xref="CDD:255968"
     gene            complement(498525..498740)
                     /gene="rpsU"
                     /locus_tag="PPUBIRD1_0427"
                     /db_xref="GeneID:12518654"
     CDS             complement(498525..498740)
                     /gene="rpsU"
                     /locus_tag="PPUBIRD1_0427"
                     /note="30S ribosomal protein S21"
                     /codon_start=1
                     /transl_table=11
                     /product="RpsU"
                     /protein_id="YP_005928326.1"
                     /db_xref="GI:386010049"
                     /db_xref="GeneID:12518654"
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRAVRLY"
     misc_feature    complement(498549..498740)
                     /gene="rpsU"
                     /locus_tag="PPUBIRD1_0427"
                     /note="30S ribosomal protein S21; Reviewed; Region: rpsU;
                     PRK00270"
                     /db_xref="CDD:234707"
     gene            498945..499970
                     /gene="gcp"
                     /locus_tag="PPUBIRD1_0428"
                     /db_xref="GeneID:12518655"
     CDS             498945..499970
                     /gene="gcp"
                     /locus_tag="PPUBIRD1_0428"
                     /note="Probable O-sialoglycoprotein endopeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_005928327.1"
                     /db_xref="GI:386010050"
                     /db_xref="GeneID:12518655"
                     /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVP
                     ELASRDHVKRMLPLIRQVLDEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAW
                     DIPAIGVHHMEGHLLAPMLEENPPEFPFVALLVSGGHTQLVRVDGIGQYELLGESLDD
                     AAGEAFDKTAKLIGLNYPGGPEIARLAEQGVPGRFVFPRPMTDRPGLEFSFSGLKTFA
                     LNTWQQCRNAGDDSEQTRCDLSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSAN
                     KALRASLEDMLGSIKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQQQDLAISVQARWP
                     MEQLPPL"
     misc_feature    498945..499967
                     /gene="gcp"
                     /locus_tag="PPUBIRD1_0428"
                     /note="UGMP family protein; Validated; Region: PRK09604"
                     /db_xref="CDD:236585"
     misc_feature    498951..>499271
                     /gene="gcp"
                     /locus_tag="PPUBIRD1_0428"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214; cl17884"
                     /db_xref="CDD:248438"
     gene            complement(499988..500557)
                     /locus_tag="PPUBIRD1_0429"
                     /db_xref="GeneID:12518656"
     CDS             complement(499988..500557)
                     /locus_tag="PPUBIRD1_0429"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_005928328.1"
                     /db_xref="GI:386010051"
                     /db_xref="GeneID:12518656"
                     /translation="MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNML
                     RLAGRKLAILTLLGDLCKGLLPVLLARAAGLDLHAQAWVGICAVLGHLFPLYFRFKGG
                     KGVATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEAL
                     LPISVLTVMIVWRHRNNLRDLFAGRERHF"
     misc_feature    complement(499991..500509)
                     /locus_tag="PPUBIRD1_0429"
                     /note="putative glycerol-3-phosphate acyltransferase PlsY;
                     Provisional; Region: PRK00220"
                     /db_xref="CDD:234691"
     gene            500641..500988
                     /gene="folB"
                     /locus_tag="PPUBIRD1_0430"
                     /db_xref="GeneID:12518657"
     CDS             500641..500988
                     /gene="folB"
                     /locus_tag="PPUBIRD1_0430"
                     /note="dihydroneopterin aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="FolB"
                     /protein_id="YP_005928329.1"
                     /db_xref="GI:386010052"
                     /db_xref="GeneID:12518657"
                     /translation="MFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGDDL
                     NLALDYASVSARIQAFAEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAVPAA
                     RGGVGVEIERGCL"
     misc_feature    500641..500979
                     /gene="folB"
                     /locus_tag="PPUBIRD1_0430"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(500641..500667,500683..500709,500929..500934,
                     500944..500970)
                     /gene="folB"
                     /locus_tag="PPUBIRD1_0430"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(500677..500685,500692..500694,500839..500850,
                     500923..500925,500962..500964)
                     /gene="folB"
                     /locus_tag="PPUBIRD1_0430"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            500979..501488
                     /locus_tag="PPUBIRD1_0431"
                     /db_xref="GeneID:12518658"
     CDS             500979..501488
                     /locus_tag="PPUBIRD1_0431"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_005928330.1"
                     /db_xref="GI:386010053"
                     /db_xref="GeneID:12518658"
                     /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQA
                     VGIKSGPFINFVVTGQTALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLH
                     GTFDGLVLPRAEILKNAFVLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFE
                     WRGLQLTP