GenomeNet

Database: RefSeq
Entry: NC_017530
LinkDB: NC_017530
Original site: NC_017530 
LOCUS       NC_017530            5731541 bp    DNA     circular CON 19-MAY-2017
DEFINITION  Pseudomonas putida BIRD-1, complete genome.
ACCESSION   NC_017530
VERSION     NC_017530.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603225
            Assembly: GCF_000183645.1
KEYWORDS    RefSeq.
SOURCE      Pseudomonas putida BIRD-1
  ORGANISM  Pseudomonas putida BIRD-1
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro-Tobias,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., Wu,X., van der Lelie,D., Gomez,M.J., Segura,A. and
            Ramos,J.L.
  TITLE     Complete genome of the plant growth-promoting rhizobacterium
            Pseudomonas putida BIRD-1
  JOURNAL   J. Bacteriol. 193 (5), 1290 (2011)
   PUBMED   21183676
REFERENCE   2  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., van der Lelie,D., Gomez,M.J. and Ramos,J.-L.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Estacion Experimental del Zaidin, CSIC, C/
            Profesor Albareda 1, Granada, Granada E-18008, Spain
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002290.
            Source DNA/bacterial strain available from Amalia Roca, Bioiliberis
            R&D, Pol gono Juncaril, c/ Capileira 7, 18220 Peligros, Granada,
            Spain; aroca@bio-iliberis.com.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 01:52:05
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,315
            CDS (total)                       :: 5,224
            Genes (coding)                    :: 5,110
            CDS (coding)                      :: 5,110
            Genes (RNA)                       :: 91
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 65
            ncRNAs                            :: 4
            Pseudo Genes (total)              :: 114
            Pseudo Genes (ambiguous residues) :: 0 of 114
            Pseudo Genes (frameshifted)       :: 57 of 114
            Pseudo Genes (incomplete)         :: 54 of 114
            Pseudo Genes (internal stop)      :: 17 of 114
            Pseudo Genes (multiple problems)  :: 14 of 114
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5731541
                     /organism="Pseudomonas putida BIRD-1"
                     /mol_type="genomic DNA"
                     /strain="BIRD-1"
                     /db_xref="taxon:931281"
     gene            complement(54..602)
                     /locus_tag="PPUBIRD1_RS00005"
                     /old_locus_tag="PPUBIRD1_0001"
     CDS             complement(54..602)
                     /locus_tag="PPUBIRD1_RS00005"
                     /old_locus_tag="PPUBIRD1_0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_085983386.1"
                     /translation="MPSIFMRAFFLFPLLLASTLAHAELPETDWLELMPKSDQKALEQ
                     MPEIDHNSPEAMGTFTAKGGLKQSKGLPAVMYSTKTVAAMNGKDIRLGGYPVPLESDA
                     KGNSTLFFLVPYPGACIHVPPPPPNQLVLVRYPKGLKIDDIYTPLWVSGKLKVEKVSN
                     DLADAAYALDAGKVRVVEDADL"
     gene            complement(636..881)
                     /locus_tag="PPUBIRD1_RS00010"
                     /old_locus_tag="PPUBIRD1_0002"
     CDS             complement(636..881)
                     /locus_tag="PPUBIRD1_RS00010"
                     /old_locus_tag="PPUBIRD1_0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017739000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GlsB/YeaQ/YmgE family stress response membrane
                     protein"
                     /protein_id="WP_012054121.1"
                     /translation="MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLAT
                     YGGQALGIYQAGQAAGFLGALIGAVVLLVIYGFIKKR"
     gene            complement(990..2072)
                     /locus_tag="PPUBIRD1_RS00015"
                     /old_locus_tag="PPUBIRD1_0003"
     CDS             complement(990..2072)
                     /locus_tag="PPUBIRD1_RS00015"
                     /old_locus_tag="PPUBIRD1_0003"
                     /EC_number="4.1.1.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589158.1"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide
                     synthase"
                     /protein_id="WP_014589158.1"
                     /translation="MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAPLGEHL
                     RADYGDQDHLRQLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAESLRIARDRLFEK
                     SMFRDLGIPTPAFADILSQADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTPEDVVG
                     TFAELGSVPCLLEGFVPFTGEVSLVAVRGRDGETRFYPLVHNTHESGILRLSVASQAH
                     PLQALAEDYVGRVLQKLDYVGVMAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQ
                     FENHLRAVAGLPLGSTAKVGESAMLNFIGEVPAVDKVVAIGDCHLHHYGKAFKVGRKV
                     GHATLRCHDMATLERKIAEVEALISN"
     gene            complement(2083..2574)
                     /gene="purE"
                     /locus_tag="PPUBIRD1_RS00020"
                     /old_locus_tag="PPUBIRD1_0004"
     CDS             complement(2083..2574)
                     /gene="purE"
                     /locus_tag="PPUBIRD1_RS00020"
                     /old_locus_tag="PPUBIRD1_0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_254113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-(carboxyamino)imidazole ribonucleotide mutase"
                     /protein_id="WP_003253304.1"
                     /translation="MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPD
                     LLFQYAEEAEGRGIEVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSI
                     VQMPAGVPVATLAIGRAGAVNAALLSASILGAKYPQYHAALKQFRTEQTDTVLDNPDP
                     RQA"
     gene            2844..3470
                     /locus_tag="PPUBIRD1_RS00025"
                     /old_locus_tag="PPUBIRD1_0005"
     CDS             2844..3470
                     /locus_tag="PPUBIRD1_RS00025"
                     /old_locus_tag="PPUBIRD1_0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589159.1"
                     /translation="MKTPCFFALSFGLVLSLQLPSASAAHSLTVTVYVHDDLADMHDG
                     QLNEDFFQHWLNEMRRFSQHPIEVIFQRKVKHITDIAYAGMPSEKLLDAFSQQVYAQK
                     RHRLYSLMDKHLLLTGNSYDHSGLNYNAGLAYFKQKTAIASVAAYGAAAHEVGHLLGA
                     THEDAELKFNGWVCETYTHPRVPARSNCYRYSDRNRANITEYLKDNSN"
     gene            complement(3462..4388)
                     /locus_tag="PPUBIRD1_RS00030"
                     /old_locus_tag="PPUBIRD1_0006"
     CDS             complement(3462..4388)
                     /locus_tag="PPUBIRD1_RS00030"
                     /old_locus_tag="PPUBIRD1_0006"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012054123.1"
                     /translation="MCFVNLESKWLEDFSALAATRSFSQAAERRFVTQPAFSRRIRSL
                     EAALGLQLVNRSRTPIELTEAGQLFLVTARTVVDQLSEILRHLHHLEGGQGEVVQVAA
                     AHSLASGFFPRWVAQLRNDGLNIATRLVATNVGDAVHALREGGCDLMLAFYDPDAALQ
                     MDAEIFPSLHMGTTEMLPVCAVDADGKPLFDLEGEGSVPLLAYTAGAFLGRSVNLLLR
                     QRNLRYTTVYETAMADSLKSMALEGMGIAWVPRLSMRGELERGELAICGGSQWHVPLE
                     IRLYRCALVRKANVRLLWRKLESSGAQGEASI"
     gene            4562..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_RS00035"
                     /old_locus_tag="PPUBIRD1_0008"
     CDS             4562..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_RS00035"
                     /old_locus_tag="PPUBIRD1_0008"
                     /EC_number="4.3.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010168341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_029380744.1"
                     /translation="MSSAASFRVEKDLLGTLEVPADAYYGIQTLRAANNFHLSGVPLS
                     HYPKLVVALAMVKQAAADANRELGHLSDAKHAAISAACARLIKGDFHDQFVVDMIQGG
                     AGTSTNMNANEVIANVALEAMGHQKGEYQYLHPNNDVNMAQSTNDAYPTAIRLGLLLG
                     HDALLASLDSLIQAFAAKGKEFDHVLKMGRTQLQDAVPMTLGQEFRAFATTMTEDLQR
                     LRSLAPELLTEINLGGTAIGTGINADPGYQALAVQRLATISGHPLVPAADLIEATSDM
                     GAFVLFSGMLKRTAVKLSKICNDLRLLSSGPRTGINEINLPARQPGSSIMPGKVNPVI
                     PEAVNQVAFAIMGNDLALTVAAEGGQLQLNVMEPLIAYKIFDSIRLLQRAMDMLREHC
                     IVGITANEQRCRELVEHSIGLVTALNPYIGYENATRIARVALESGRGVLELVREEKLL
                     DDAMLDDILRPENMIAPRLVPLKA"
     gene            6217..7209
                     /locus_tag="PPUBIRD1_RS00040"
                     /old_locus_tag="PPUBIRD1_0009"
     CDS             6217..7209
                     /locus_tag="PPUBIRD1_RS00040"
                     /old_locus_tag="PPUBIRD1_0009"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589161.1"
                     /translation="MLHSHLTTLNAVSLILNVFQADGCEASALLAGSGIGPADLGHAD
                     ARITTQQELQVCANAVARREDIGLELGQRMRVSCYGMLGYALLSSATLGDALRLALQY
                     PALLGTVFKLRLLDDGQRVWFSASDYHDSPALSAFNAEFCLVSLKVICDDLLGRPLPL
                     LGARFEHPRPGYHALYAEAFQCPIGFAAEDNAFAFERRWLDMPLPLADPITHKAMSER
                     CRRLNLEFTGRQAWLGRIRQLLAQQLDAAPGLEGLARQMNCSSRTLRRHLQALGSSYQ
                     QLLDELRFERAKQLLADEQMPIYRIAETLGFSETASFRHAFQRWSGVAPSHFRG"
     gene            7506..8549
                     /locus_tag="PPUBIRD1_RS00045"
                     /old_locus_tag="PPUBIRD1_0010"
     CDS             7506..8549
                     /locus_tag="PPUBIRD1_RS00045"
                     /old_locus_tag="PPUBIRD1_0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylpolyamine amidohydrolase"
                     /protein_id="WP_014589162.1"
                     /translation="MLTIYSDDHRLHHGRCELIDGKLMPCFEMPSRADHVLDQVKKRN
                     LGDIQGPTDFGRAPLLRVHSADYLDFFEGAWARWAALGHEGDLLPFTWPARTLRQVKP
                     TGLHGELGYYSFDAGAPITAGTWQAAYSAAQVALTAQAAIQQGAHAAFALCRPPGHHA
                     AGEVMGGYCYLNNAAIAAQAFLDQGRRKVAILDVDYHHGNGTQDIFYSRDDVFFASIH
                     GDPQDEFPFFLGYADETGEGAGQGYNINYPLPAGSDWTAWSAALEDACKRIASYDADV
                     LVISLGVDTFKDDPISQFKLDSPDYLEMGKRIGQLGKPTLFVMEGGYAVEEIGINAVN
                     VLEGFQRAQPGAR"
     gene            8549..9652
                     /locus_tag="PPUBIRD1_RS00050"
                     /old_locus_tag="PPUBIRD1_0011"
     CDS             8549..9652
                     /locus_tag="PPUBIRD1_RS00050"
                     /old_locus_tag="PPUBIRD1_0011"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019752811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003253292.1"
                     /translation="MVRLKRLLAPFIAATLFAGALHAQAEQRTLRVYNWFDYITPQTL
                     TAFQKDSGVKLVYDIFDTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRS
                     KLPNWQHLDPALMKLIEANDPGNKFAVPYMYGTVLIGFNPAKVKAALGDNAPVDSWDL
                     IFKEENIAKLKQCGVALLDSPSEILPLALQYLGLPPNSDKPADYKKAEELMLKIRPHI
                     TYFHSSKYMADIANGDICVAVGYSGSFSQAANRAREANNGVVVDMRLPKEGAPIWFDM
                     LAIPKGAANPEDAHTFINYLLRPEVIAPISDFVGYPNPNKDATDKVNPTIRNNPNLYP
                     TAEAMAKLYTLKPLTRDAERARTRAWTRIKSGT"
     gene            complement(9684..11213)
                     /locus_tag="PPUBIRD1_RS00055"
                     /old_locus_tag="PPUBIRD1_0012"
     CDS             complement(9684..11213)
                     /locus_tag="PPUBIRD1_RS00055"
                     /old_locus_tag="PPUBIRD1_0012"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_014589163.1"
                     /translation="MRESPLILPFDPAGIALDRSRGLSQQLYQALRARVLDGRLSSGT
                     RLPATRDLAAMLALSRNSVVRAYDQLYAEGFIESRVGDGTYVSRLPKLSTQVSTGLSL
                     GLSTGLSTFREENTEDLSSGRLFSAPLQRLKNNHLPPPRIGAPRAFRVGIPAFDLFPF
                     DVWAKLQAGFWRNPSPAQLGYGDPAGEPALRDLIAAYLRRSRGLSCTAEQIVITSGAQ
                     QAISLCAQLLLQPGDGVAVENPGYRAAAHAFTLAGGRVFGVPVNEDGLDCSRLEQLTD
                     CRLTYVTPAHQYPTGVTMSLARRLALLAWAERSDGWIIEDDYDGEYRYSGAPLAPLAA
                     LDRHGRVLYVGTFGKIAFPALRLGYLVLPSKLVQAFSQGKALAVRHSEVSSQCVMAEF
                     MARGHFQRHIRRMRKAALKRRDVLKAGWPVDIPGLGAMPEVAAGLHVKVDVDNFAREQ
                     ELVAKAEAVGVEVTPLSNFWLADCEVPVDKRAGLVLGFAAVPEGEIAEALMKLRKVWR
                     K"
     gene            11303..11932
                     /locus_tag="PPUBIRD1_RS00060"
                     /old_locus_tag="PPUBIRD1_0013"
     CDS             11303..11932
                     /locus_tag="PPUBIRD1_RS00060"
                     /old_locus_tag="PPUBIRD1_0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010955832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589164.1"
                     /translation="MYNSKPHQEHDLTRLHQHMLDTRLAILVSQGEQGLLATHLPVLV
                     DTAEGDFGTVYAHLARANRQWEDLQHGGEALLVFPGADAYVSPGYYPSKAENPKVVPT
                     WNYLAVHAYGPAEVIHEAEPLLSIVSRLTDRHEQGRNEPWKVTDAPADYIEGMLRAIV
                     GIRLPIARLQGARKLSQNRSRQDIDGVREGLSASPDQRDNQLAAHMRQL"
     gene            11944..12390
                     /locus_tag="PPUBIRD1_RS00065"
                     /old_locus_tag="PPUBIRD1_0014"
     CDS             11944..12390
                     /locus_tag="PPUBIRD1_RS00065"
                     /old_locus_tag="PPUBIRD1_0014"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_003253286.1"
                     /translation="MPNLTLRPVTAQDHAAWHALWQAYLHFYETELADAVSLSTWQRL
                     LDPSEPTHSALAWVDGKAVGMVNFIYHRSNWSIENSCYLQDLYVDSTQRGLGIGRQLI
                     EHVYTTAKADNCIKVHWLTHETNATAISLYQQVAERSGFIQFRKGL"
     gene            12398..13069
                     /locus_tag="PPUBIRD1_RS00070"
                     /old_locus_tag="PPUBIRD1_0015"
     CDS             12398..13069
                     /locus_tag="PPUBIRD1_RS00070"
                     /old_locus_tag="PPUBIRD1_0015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010955833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_014589165.1"
                     /translation="MTDALNWKPAAPPKAEPIEGRFIRLEKLDPGRHGEDLWEALQGP
                     ASDPVLWDYLPYGPFAERAAFDRWLEGNAAGRDPLFYTVIDRASGQAQGILSLMSIVP
                     EHGRIEIGHIAFGAAMQRTPKGTEAVYLLGKLGFALGNRRLEWKCNNANARSKRAAER
                     FGFVYEGVFRKHLVVKDHNRDTAWYSITDDEWPAVAAGFERWLSEENQQPGGQVESLE
                     MCRKG"
     gene            complement(13190..14998)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_RS00075"
                     /old_locus_tag="PPUBIRD1_0016"
     CDS             complement(13190..14998)
                     /gene="oadA"
                     /locus_tag="PPUBIRD1_RS00075"
                     /old_locus_tag="PPUBIRD1_0016"
                     /EC_number="6.4.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007927580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit B"
                     /protein_id="WP_003253282.1"
                     /translation="MSKKIHVTDTILRDAHQSLLATRMRTEDMLPICDKLDKVGYWSL
                     EVWGGATFDACVRFLKEDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAF
                     VAKAAVNGIDVFRIFDAMNDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTIEAFVNQ
                     AKQMEAMGCDSVAIKDMAGLLTPFATGELVKALKAEQSLPVFIHSHDTAGLAAMCQLK
                     AVENGADHIDTAISSFAWGTSHPGTESMVAALKGSEFDTGLDLELLQEIGLYFYAVRK
                     KYHQFESEFTAVDTRVQVNQVPGGMISNLANQLKEQGALNRMNEVLAEIPRVREDLGF
                     PPLVTPTSQIVGTQAFFNVLAGERYKTITNEVKLYLQGGYGKAPGVVNEQLRRQAIGS
                     EEVIDVRPADLLKPEMAKLRSDIGALARCEEDVLTFAMFPDIGRKFLEEREAGTLTPE
                     VLLPIPEAGAVAAPGGEGVPTEFVIDVHGETYRVDITGVGVKAEGKRHFYLSIDGMPE
                     EVVFEPLNEFVSGGGSKRKQATDPGHVSTTMPGNIVDVLVKEGDMVKAGQAVLITEAM
                     KMETEVQAAIAGKVVAIHVAKGDRVTPGEILIEIEG"
     gene            complement(15010..16425)
                     /locus_tag="PPUBIRD1_RS00080"
                     /old_locus_tag="PPUBIRD1_0017"
     CDS             complement(15010..16425)
                     /locus_tag="PPUBIRD1_RS00080"
                     /old_locus_tag="PPUBIRD1_0017"
                     /EC_number="6.4.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011064323.1"
                     /note="catalyzes the ATP-dependent carboxylation of a
                     covalently attached biotin and the transfer of the
                     carboxyl group to pyruvate forming oxaloacetate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit A"
                     /protein_id="WP_003253279.1"
                     /translation="MIKKILIANRGEIAVRIVRACAEMGIRSVAIFSDADRHALHVKR
                     ADEAHSIGAEPLAGYLNPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFI
                     GPAADVIRRMGDKTEARRTMIAAGVPVTPGTEGNVADIHEALSEGDRIGYPVMLKATS
                     GGGGRGIRRCNSREELEQNFPRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFG
                     NVVHLFERDCSIQRRNQKLIEIAPSPQLTPEQRAYIGDLAVRAAKAVNYENAGTVEFL
                     LADGEVYFMEMNTRVQVEHTITEEITGIDIVREQIRIASGLPLSVKQEDIQHRGYALQ
                     FRINAEDPKNNFLPSFGKITRYYAPGGPGVRTDTAIYTGYTIPPFYDSMCLKLVVWAL
                     TWEEAMDRGLRALDDMRVQGVKTTAAYYQEILRNPEFRSGQFNTSFVESHPELTNYSI
                     KRKPEELALAIAAAIAAHAGL"
     gene            16615..17577
                     /locus_tag="PPUBIRD1_RS00085"
                     /old_locus_tag="PPUBIRD1_0018"
     CDS             16615..17577
                     /locus_tag="PPUBIRD1_RS00085"
                     /old_locus_tag="PPUBIRD1_0018"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016394358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010955834.1"
                     /translation="MRKSLMRMTLRQLQIFNEVCDLRSYSRAAEEMALTQPAVSLQIR
                     QLEELIGQPLFEYVGKKLYLTEAAEALQRASHDIFGRLESLDMQLSDMQGSLQGQLKL
                     AIESSAKYFVPHLFAAFKQRHPEVNLTLTVVNRAQAIRRLSDNRDDLIIMSMVPQDMG
                     LEFLPFLNNPIVAVAPPQHPLCKLEQLRMQDLEPHTLLVREQGSGTRKACEEYFKDKR
                     VHFAQTLEVASADAQRECVIAGLGIALLTRHAVNLELATGMLKELPVEELPLYRSWCV
                     VQAKAKRQSPVALAFLAFIRGERALISALVERFSGKLPPTTAIP"
     gene            complement(17519..17737)
                     /locus_tag="PPUBIRD1_RS25940"
     CDS             complement(17519..17737)
                     /locus_tag="PPUBIRD1_RS25940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557752.1"
                     /translation="MARDFDGTYQPNAKARKQQEKDQRRMEYRRAIESYCDQRQLLRD
                     LADYPELQALTVWQSSAATSQKNVQQAR"
     gene            complement(17947..18813)
                     /locus_tag="PPUBIRD1_RS00090"
                     /old_locus_tag="PPUBIRD1_0019"
     CDS             complement(17947..18813)
                     /locus_tag="PPUBIRD1_RS00090"
                     /old_locus_tag="PPUBIRD1_0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MurR/RpiR family transcriptional regulator"
                     /protein_id="WP_003253273.1"
                     /translation="MNLLQHIAQSRHLLRKSELKVADHVLLDPAAVMHSSMADLAHSV
                     GISEPTIVRFCRAIGCSGFQDLKLKLAQSLAAGASFGQFAIHEDDSVADYSLKIFDTT
                     LHTLMEVREHLDPQALQQAVSAMAQAQRVEFYGFGASGAVAADAQHKFFRLLLSAAAY
                     SDPHMQAMSAVTLKPGDVAVCISQSGRSKDLLITANLVRESGANLITLCPSQTPLAEL
                     STVNLAIDVHEDTEIYTPLTSRIAHLVVIDVLAMGVAMARGPSLVNHLKSVKRSLRSL
                     RLSPKSIKATDD"
     gene            18917..20359
                     /locus_tag="PPUBIRD1_RS00095"
                     /old_locus_tag="PPUBIRD1_0020"
     CDS             18917..20359
                     /locus_tag="PPUBIRD1_RS00095"
                     /old_locus_tag="PPUBIRD1_0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate dehydrogenase"
                     /protein_id="WP_003253271.1"
                     /translation="MTIPCDILVFGGTGDLALHKLLPALYHLFREARLNPAVRVIALA
                     RRNLPRIDYLKLAERHCRAQIARSDFDEEVWQRFSARVDYFPMDASQSADFGRLARYL
                     GEPGGLTRIFYLATAPNLFVPIANHLRIAGLADTEARIVLEKPIGHSLESATAINEAI
                     GTVFEERQVFRIDHYLGKETVQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVEN
                     RGAYYDRAGAIRDMLQNHLLQLLCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDV
                     QDKTVRGQYGAGRIGGQEVPAYYFEKDVDNDSDTETFVAIEAHIDNWRWAGVPFYLRT
                     GKRMARRASQIVIQFKPVPHELFSGGQVNQLLIQLQPDERISLRMMTKSPGKGMRLEP
                     VDLDLNLAQVFSQTRRWEAYERLLLDVLEGDSTLFMRRDEVEAAWAWVDPIIKGCEEH
                     FQAPRPYPAGSFGPEQANSLLARHGRHWHG"
     gene            20574..22760
                     /locus_tag="PPUBIRD1_RS00100"
                     /old_locus_tag="PPUBIRD1_0021"
     CDS             20574..22760
                     /locus_tag="PPUBIRD1_RS00100"
                     /old_locus_tag="PPUBIRD1_0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase II"
                     /protein_id="WP_004575197.1"
                     /translation="MRTDDLSLLLNSLNDAQRQAVAATLGRQLVLAGAGSGKTRVLVH
                     RIAWLIQVEQASPHSILSVTFTNKAAAEMRQRIEQLLGINPAGMWVGTFHGLAHRLLR
                     AHWQEARLVQNFQILDSDDQQRLIKRVMRELGLDEQKWPARQAQWFINGQKDEGLRPQ
                     HIQAGGDLFLATMREVYTAYEQACERAGVIDFSELLLRALDLWRDHPGLLEHYQRRFR
                     HVLVDEFQDTNAVQYAWLRLLARGGDSLMAVGDDDQSIYGWRGAKIENIHQYTADFPD
                     AEMIRLEQNYRSTGGILKAANALIANNSGRLGKELWTDMGEGEPLTLYAAYNEHDEAR
                     YVVETIESLVKQGNARNEIAILYRSNAQSRVLEEALLRERIPYRIYGGQRFFERAEIK
                     NAMAYLRLIEGRGNDAALERVINVPPRGIGEKTVEAIREHARHSQLSMWEAMCQLLAA
                     KALKGRAASALGAFIELIEGLAAKVVDMPLHTMTQTTIEQSGLITYHQEEKGEKGQAR
                     VENLEELVSAARNFESTDEDADLSPLSAFLGHASLEAGDTQADEHEDSIQLMTLHSAK
                     GLEFPYVFLVGMEEGLFPHKMSLEEPGRLEEERRLAYVGITRAMRQLVMTYAETRRLY
                     GSETYNKVSRFVREIPAGLVQEVRLSNSVSRPFGGAKTATNSNLFANASIPQTAFNLG
                     QRVQHAVFGEGVILNFEGSGAQARVQVNFAEGSKWLMLGYAKLEAV"
     gene            22892..23746
                     /locus_tag="PPUBIRD1_RS00105"
                     /old_locus_tag="PPUBIRD1_0022"
     CDS             22892..23746
                     /locus_tag="PPUBIRD1_RS00105"
                     /old_locus_tag="PPUBIRD1_0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589167.1"
                     /translation="MQRFLSIALALCVGLTLSLDASAKRFGGGKSSGSAPIHQTRQAT
                     PTTPAAAPTAPGRAPAAASGASRWLGPLAGLAAGGLLASMFMGDGFEGFQIMDFLIVA
                     LIAFLVFRFIAARRRQQQPQMAMPGHAPMQREAHAQPAQPSIFGGSAAPAATAAPVIN
                     APAWFNEQSFLAAARNHFQSLQQHWDANEMDKISEFVTPQMLEFLKRERAELGDGFQS
                     TYIDNLEVQLDGVDDRADRTDATLTFRGVSKNSRFDQGEVFSESWHMVRAQGENQPWL
                     VAGIRQNG"
     gene            23860..24267
                     /locus_tag="PPUBIRD1_RS00110"
                     /old_locus_tag="PPUBIRD1_0023"
     CDS             23860..24267
                     /locus_tag="PPUBIRD1_RS00110"
                     /old_locus_tag="PPUBIRD1_0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007954245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMI1/KNR4 family protein"
                     /protein_id="WP_003253266.1"
                     /translation="MEEVIEQLREANEPVPVPLELPDEDQLVEIEEQLFINIPFVFKE
                     FLLTVSDVVYGSLEPVTVTDPQSHTYLPDVASNAWDAGVPRDLIPLCQDGDNYYCVEE
                     DGTVVLWDAEEEIVGEDSWESVWHWARDVWLES"
     gene            complement(24426..26186)
                     /locus_tag="PPUBIRD1_RS00115"
                     /old_locus_tag="PPUBIRD1_0024"
     CDS             complement(24426..26186)
                     /locus_tag="PPUBIRD1_RS00115"
                     /old_locus_tag="PPUBIRD1_0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017341593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation:proton antiporter"
                     /protein_id="WP_014589168.1"
                     /translation="MHAISFIQDLAVIMLIAGVVTILFHRLKQPVVLGYIVAGFIIGP
                     HTPPFGLIHDEETIKILAELGVIFLMFCLGLEFSLRKLFKVGATAFIAAFLEIVLMIW
                     IGFEIGRWFGWSTMDSLFLGAILAISSTTIIVKALNDLKMKNERFAQLIFGVLIVEDI
                     LGIGIIALLSGIAVSGTVSSGEVFSTVGKLSLFMIVALVIGILLVPRLLAYVAKFESN
                     EMLLITVLGLCFGFCLLVVKLEYSMVLGAFLIGAIMAESRQLLKIERLIEPVRDLFSA
                     IFFVAIGLMIDPQVLIDYAWPIVVITLAVVLGKMLSCGMGAFIAGNDGRTSLRVGMGL
                     SQIGEFSFIIAALGMTLQVTSDFLYPVAVAVSAITTLLTPYLIRAADPLSQKLGNVVP
                     ARLARVLSLYGEWLRNIQPQGESAMLAAMIRRILLQVGVNLALVIAIFFSGGYFAGRI
                     GNWLSEWVSDVSQQKAVIWGAALLLSLPFLIAAYRKLKALSMLLAEMGVKPEMAGRHT
                     QRVRRVIAEVIPLLSLLVIFLLLSALSASILPTSELLLVIAVVAAVVVALLWRWFIRV
                     HTRMQIALLETLENSRENSH"
     gene            26526..27011
                     /locus_tag="PPUBIRD1_RS00120"
                     /old_locus_tag="PPUBIRD1_0025"
     CDS             26526..27011
                     /locus_tag="PPUBIRD1_RS00120"
                     /old_locus_tag="PPUBIRD1_0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_238134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA thioesterase"
                     /protein_id="WP_003253263.1"
                     /translation="MEPGNAQLSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASR
                     YAGSYVVTLSVDQVIFREPVHVGELVTFLASVNYTGNTSMEVGIKVVTENIRERSVRH
                     SNSCFFTMVAVDDNRRPVPVPPRQPHSSEEKRRFLQGQQRRQIRQELEKRYQDLKTDA
                     I"
     gene            complement(27008..27880)
                     /locus_tag="PPUBIRD1_RS00125"
                     /old_locus_tag="PPUBIRD1_0026"
     CDS             complement(27008..27880)
                     /locus_tag="PPUBIRD1_RS00125"
                     /old_locus_tag="PPUBIRD1_0026"
                     /EC_number="2.7.1.35"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007934429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxal kinase"
                     /protein_id="WP_014589169.1"
                     /translation="MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNAWPLNTVQFS
                     NHTQYGQWAGEVLAPAQIPALVEGISNIGELGHCDAVLSGYLGSAEQGRAILAGVERI
                     KAVNPKALYLCDPVMGHPEKGCIVPPEVSEFLLDEAAATADILCPNQLELDSFSGRRA
                     QSLEDCVNMARSLLERGPQVVLVKHLAYPGRAEEQFEMLLVTAEQSWHLRRPLLAFPR
                     QPVGVGDLTSGLFLARVLLGDSWVQAFEFTAAAVHEVLLETQACASYELQLVRAQDRI
                     AHPRVRFEAQLLAL"
     gene            28001..28393
                     /locus_tag="PPUBIRD1_RS00130"
                     /old_locus_tag="PPUBIRD1_0027"
     CDS             28001..28393
                     /locus_tag="PPUBIRD1_RS00130"
                     /old_locus_tag="PPUBIRD1_0027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012274886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253259.1"
                     /translation="MLTLENLFVLMLVATAGAWLWHNHGLREKALERVKQHCAKLDLE
                     LLDDAVALKRIAFVRDANGRKRLARVYAFEFTVTGEQRHPGTATQFGAHSVQIELAPY
                     PFEIKTPPRADNVIEMQQWRQEHNRWRN"
     gene            complement(28394..29365)
                     /locus_tag="PPUBIRD1_RS00135"
                     /old_locus_tag="PPUBIRD1_0028"
     CDS             complement(28394..29365)
                     /locus_tag="PPUBIRD1_RS00135"
                     /old_locus_tag="PPUBIRD1_0028"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_014589170.1"
                     /translation="MLQNIPTHVIAGPLGAGKTTLIRHLLAQRPANERWAVLINEFGL
                     VGLDAAILSRDEDGIAIGEVAGGCLCCVNGMPFQVGLGRLLRKSRPDRLFIEPSGLGH
                     PLQLLAQLQQAPWVGVLTIQPLLMVVDAQAMARNEPLPEAQQQAFNASESVVFNKSEA
                     VDEIHKLLISNQFKEKRIMWTVQGQLPLSGLPTVSPQIVDSPFLKNRIVDNPGIAPAA
                     LWADPSLPICLVQQGEGGWSIGWRWHPGQQFYPQRLKAFLYAWPWRRAKGVIHSMEGW
                     WSFNGLNGDMPAWQPSDWRKDTRIELIFDQPQPQPALQAGLDECRVS"
     gene            complement(29406..30032)
                     /locus_tag="PPUBIRD1_RS00140"
                     /old_locus_tag="PPUBIRD1_0029"
     CDS             complement(29406..30032)
                     /locus_tag="PPUBIRD1_RS00140"
                     /old_locus_tag="PPUBIRD1_0029"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589171.1"
                     /translation="MNLAHRPVDIFQVFGETPQVLAEVLQDGVNLAVWRRRLPAQLED
                     FAALVLSLGQPLADQRVIDVDEEQKPVLPDLLREAADLHGYEAFVADVTWLVAAYTCL
                     VGARRVGLRLRVLDSPMCPRFHVDNVPLRLLTTYVGPGSEWLQERVSGRGELHTAQPS
                     VDNIQQLQAGEVAILKGEKWQGNEGAGLVHRSPSAQQGRLLLSLDWLA"
     gene            complement(30029..31237)
                     /locus_tag="PPUBIRD1_RS00145"
                     /old_locus_tag="PPUBIRD1_0030"
     CDS             complement(30029..31237)
                     /locus_tag="PPUBIRD1_RS00145"
                     /old_locus_tag="PPUBIRD1_0030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_041166809.1"
                     /translation="MSNRLPVTVLSGFLGAGKSTLLNHVLRNRDKLRVAVIVNDMSEI
                     NIDASEVQRNVSLNRAEEKLVEMSNGCICCTLREDLLEEVARLAEEGRFDYLLIESTG
                     ISEPLPVAETFTFRDELGRSLSDMARLDTMVTVVDGLNFLRDYQAADSLASRGETLGE
                     EDERSISDLLIEQVEFADVLLLSKIDLISQHEREELIAILRSLNARAQIVPMVMGQVP
                     LARILDTGLFDFDQAAQAPGWLQELRGEHVPETEEYGIAAMTWQARRPLHPQRFYDFI
                     HKNWENGRLLRSKGFFWLASKYQEAGSWSQAGGMMRHGLAGRWWRFVPREQWPQDVDN
                     TNAILKHWTAETGDCRQELVFIGQNIDVEKLSTALDACLLTDKEMGLGHMGWLRLPDP
                     FGPWHEEAAA"
     gene            31351..31731
                     /locus_tag="PPUBIRD1_RS00150"
                     /old_locus_tag="PPUBIRD1_0031"
     CDS             31351..31731
                     /locus_tag="PPUBIRD1_RS00150"
                     /old_locus_tag="PPUBIRD1_0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014754895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019437631.1"
                     /translation="MNLPRVMALLVLTMPASLLAMPQNSALALCTRSATLLACQDGKG
                     NYYSVRTEGSTFYLRGYDFSSRRLWAQTNSRYGTLTFFSGLASNGEAWVGYSRRVGWT
                     TLNRVSSSSGERFKLHCSLIEGCR"
     gene            complement(32000..32527)
                     /locus_tag="PPUBIRD1_RS00155"
                     /old_locus_tag="PPUBIRD1_0033"
     CDS             complement(32000..32527)
                     /locus_tag="PPUBIRD1_RS00155"
                     /old_locus_tag="PPUBIRD1_0033"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012274892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3617 domain-containing protein"
                     /protein_id="WP_003253248.1"
                     /translation="MKIRLPLLALALGMSSPLVQAQMLQPGLWELTTSNMQVDGKPLP
                     DMEFMLGQLKNLPPEQRAMMEGVLAKQGVSVGGKGVRSCLTPEQVATNDIPLQDPKSG
                     CTQKITDRTGNVWKFQFSCPKAQGSGQATFLSDREFTTQVSGTFNASGVQQQGSMNTR
                     AVWLGNDCGTVKPRS"
     gene            32660..34099
                     /gene="cls"
                     /locus_tag="PPUBIRD1_RS00160"
                     /old_locus_tag="PPUBIRD1_0034"
     CDS             32660..34099
                     /gene="cls"
                     /locus_tag="PPUBIRD1_RS00160"
                     /old_locus_tag="PPUBIRD1_0034"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_238144.1"
                     /note="Cardiolipin synthase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthase"
                     /protein_id="WP_014589175.1"
                     /translation="MDYHSPYFFGYLLGLIHLLGIVAALHALFTVRTAQGAIAWAMPL
                     LFIPYLTLIPYLIFGARSFYAYIKARRQANQEMHVAMANLNWRPWVEEALTARESESY
                     TALRAMPKLGRMPCLANNQVKLLINGKATFDAIFAAIEKARDVVLVQFFIIHDDTLGK
                     ALQQLLLRKAAEGVQVFVLYDRVGSHALPASYSQMLRDGGVQIHAFATRRGWFNRFQV
                     NFRNHRKIVVVDGLLGFIGGHNVGDEYLGEHPQLSPWRDTHVQISGPVLACLQESFAE
                     DWYWATRQLPPLILPDTYPDNGVLCQALASGPADPQETCSLFFLEAIHSATRRVWITS
                     PYFIPDEAVFAALRLAVLRGVDVRVLIPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQ
                     PGFLHQKVVLVDDDVSAIGSANLDNRSFRLNFEITLLTVDRGFADQVEHMLQEDFEHA
                     REITAEDTQDTHRLQQLGMRIARLISPIL"
     gene            complement(34182..35366)
                     /locus_tag="PPUBIRD1_RS00165"
                     /old_locus_tag="PPUBIRD1_0035"
     CDS             complement(34182..35366)
                     /locus_tag="PPUBIRD1_RS00165"
                     /old_locus_tag="PPUBIRD1_0035"
                     /EC_number="2.1.1.79"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014589176.1"
                     /translation="MLAQLPPALQSLHLPLRLKLWDGNQFDLGPSPQVTILVKEPQLI
                     SQLTHPSMDQLGTAFVEGKLELEGDIGEAIRVCDELSEALLADEDETPPPRVSHDKST
                     DAKAISYHYDVSNAFYQLWLDQDMAYSCAYFREPDNTLDQAQQDKFDHLCRKLRLDAG
                     DYLLDVGCGWGGLARFAAREYGAKVFGITLSKEQLKLGRKRVQAEGLADKVDLQILDY
                     RDLPQDGRFDKVVSVGMFEHVGHANLALYCQKLFGAVREGGVVMNHGITAKHVDGRPV
                     GRGAGEFIDRYVFPHGELPHLSMISASICEAGLEVVDVESLRLHYAKTLHHWSENLEN
                     QLHKAAALVPEKTLRIWRLYLAGCAYAFQKGWINLHQILAVKPYADGHHDLPWTREDL
                     YR"
     gene            35574..36974
                     /gene="lpdA"
                     /locus_tag="PPUBIRD1_RS00170"
                     /old_locus_tag="PPUBIRD1_0036"
     CDS             35574..36974
                     /gene="lpdA"
                     /locus_tag="PPUBIRD1_RS00170"
                     /old_locus_tag="PPUBIRD1_0036"
                     /EC_number="1.8.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:SwissProt:P31046.1"
                     /note="Dihydrolipoyl dehydrogenase 3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyl dehydrogenase"
                     /protein_id="WP_014589177.1"
                     /translation="MKSYDVVIIGGGPGGYNAAIRAGQLGLSVACVEGRSTLGGTCLN
                     VGCMPSKALLHASELYEAASGDEFAHLGIEVKPTLNLAQMMKQKDESVTGLTKGIEYL
                     FRKNKVEWIKGWGRLDGIGKVVVKAEDGSETALQAKDIVIATGSEPTPLPGVTVDNQR
                     IIDSTGALSLPQVPKHLVVIGAGVIGLELGSVWRRLGSQVTVIEYLDRICPGTDTETA
                     KTLQKALAKQGMVFKLGSKVTQATAGADGVSLTLEPAAGGTAESLQADYVLVAIGRRP
                     YTKGLNLESVGLEADKRGMLGNEHHRTSVPGVWVIGDVTSGPMLAHKAEDEAVACIER
                     IAGKPHEVNYNLIPGVIYTRPEMATVGKTEEQLKAEGRAYKVGKFPFTANSRAKINHE
                     TEGFAKVIADAETDEVLGVHLVGPSVSEMIGEFCVAMEFSASAEDIALTCHPHPTRSE
                     ALRQAAMNVDGMAMQI"
     gene            complement(37045..38052)
                     /locus_tag="PPUBIRD1_RS00175"
                     /old_locus_tag="PPUBIRD1_0037"
     CDS             complement(37045..38052)
                     /locus_tag="PPUBIRD1_RS00175"
                     /old_locus_tag="PPUBIRD1_0037"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017903969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014589178.1"
                     /translation="MSRVNTTETGKKRLTTSAMIASIAAEGQATRSAPFGHALAALAE
                     QRSDIVGLSADLSKYTDLHIFAKAHPERFYQMGMAEQLLMSAAAGMAREGCVPFATTY
                     AVFASRRAYDFICMAIAEENLNVKIVCGLPGLTTGYGPSHQATDDLAIFRAMPNLMIV
                     DPCDALEIEQAVPAIAAHQGPVYMRLLRGNVPLVLDEYGYKFEIGKAKTLRTGKDVLI
                     ISTGLMTMRSLEAAAHLQKDGVDVAVLHVPTIKPLDEQTILAEARKSGRLVVTAENHS
                     IIGGLGEAVAGLLLRNGVTPTFRQVALPDAFLDAGALPTLHDRYGISTDAVSAQIKAW
                     L"
     gene            complement(38049..38897)
                     /locus_tag="PPUBIRD1_RS00180"
                     /old_locus_tag="PPUBIRD1_0038"
     CDS             complement(38049..38897)
                     /locus_tag="PPUBIRD1_RS00180"
                     /old_locus_tag="PPUBIRD1_0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014754900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014589179.1"
                     /translation="MTVNAPDTSLSALAERAYNIRRHALRMGQVQGQGYVGQALGAAD
                     LLAVSYFHALRYQPHNPEWEQRDRFYLSIGHYAIALYAALIEAGVIPLEELETYGSDD
                     SRLPMSGMAAYTPGMEITGGSLGHGLGIAVGACLGLKRKKSDSFVYNLLSDGELNEGS
                     TWEAAMSASHWKLNNLIAIIDVNNQQADGYSSEVLAFEPIVDRWQAFGWFTQRVDGND
                     IGALVAAFDAARNHQGAQPRVIICDTKMGKGVDFLESREKTHFIRVDENEWDLALQNL
                     QVGRIV"
     gene            complement(38916..40217)
                     /locus_tag="PPUBIRD1_RS00185"
                     /old_locus_tag="PPUBIRD1_0039"
     CDS             complement(38916..40217)
                     /locus_tag="PPUBIRD1_RS00185"
                     /old_locus_tag="PPUBIRD1_0039"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589180.1"
                     /translation="MITTLSLDAVSAVRSNAYRKTAWRLMPFLMLCYLCAYLDRVNVG
                     FAKLQMMSDLALSEAVYGLGAGMFFIGYFLCEVPSNLILHRVGARRWIARIMISWGII
                     SALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPSYRRAKMTVLWFVAIPLS
                     GMIGGPLSGWIMNQFAGFHGWAGWQWMFVIEAIPTVIVGLLVLTYLKDGVHQATWLTD
                     EEKELVTKELAEDNAHKVTHASPREFIRDRRLWLLACIYFCVVMGQYAITFWLPTLIR
                     NAGVSDPLHIGMLTSLPYMCAIVAMLLMGRSGDKHRERRWHLVVPMIAGAIGLTLAAL
                     LGGNLLLSVLSLCLAAAGVLSASSLFWMLPTTLLGGVSAAAGIAGINSFANLAGFCSP
                     YLIGWITTSTGSSAIGMYLITAVLLAGATLVLRIPAASVNR"
     gene            complement(40285..41034)
                     /locus_tag="PPUBIRD1_RS00190"
                     /old_locus_tag="PPUBIRD1_0040"
     CDS             complement(40285..41034)
                     /locus_tag="PPUBIRD1_RS00190"
                     /old_locus_tag="PPUBIRD1_0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_004994514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_014589181.1"
                     /translation="MLLQGKVAIITGAASARGIGRATAATFAAQGARVVILDLDEAAA
                     RDAAASLGEGHLGLAANVADQAQVNQAVAQIIEHYGRIDVLVNNAGITQPLKTLDIKH
                     SDYDKVLDVSLRGTLLMSQAVIPLMREQRSGSIVCMSSVSAQRGGGIFGGPHYSAAKA
                     GVLGLAKAMARELGPDNVRVNAIAPGLIHTDITGGLMQDDRRHAIIDGIPLGRLGEAQ
                     DVANAALFLASDLSTYLTGITLDVNGGMLIH"
     gene            41229..42146
                     /locus_tag="PPUBIRD1_RS00195"
                     /old_locus_tag="PPUBIRD1_0041"
     CDS             41229..42146
                     /locus_tag="PPUBIRD1_RS00195"
                     /old_locus_tag="PPUBIRD1_0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010453098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_029380745.1"
                     /translation="MRSVDDTAPALPPLRAIQAFEQTARFGNVARAAEVLDLTPSAVS
                     HQLAKLEAMIGRQLFFRAARGVSLTPVGEQYLKDVSGILHSLSVATERASSDVSLDCL
                     RLHSSPSFGLLWLMPRLEAFRMAHPDIQINLSCSYESLHFSRDKIDVDIRHGEPNWPS
                     YEVRTLGNEAFAVLASPKLLARHRIDDASDLLRRDLILSEATLLKWPAWFARHGLARP
                     EKPYALSFDRSYMSLEAASHGLGFALESTLLAQKYLASGTLVEVVPHIFSAPVAAHHL
                     VFPKAHSGFERVRRFLAWMERELGHGFVF"
     gene            complement(42305..43342)
                     /locus_tag="PPUBIRD1_RS00200"
                     /old_locus_tag="PPUBIRD1_0042"
     CDS             complement(42305..43342)
                     /locus_tag="PPUBIRD1_RS00200"
                     /old_locus_tag="PPUBIRD1_0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589183.1"
                     /translation="MSQPLYRRVVPETYVQLLYEYLEALGHEPESVLGQPWPTPAQEG
                     VGGVDVECWDRLLLTAAQALDDPLLGLHVGQTISARHIGVLGSVLLACGNFGTAMQRL
                     ERYIRLVYDVIPMTRRDGDGWFELVWDVSQYQPGPLVNETGMVAIVQFCRALVRGTAN
                     PLRIDFNHPSPLDTSPYEAFFGCPVRFGQAEAVLRFSAQLLELPFKSPDPALVSLLEQ
                     HADRLLAQLPQQDEFVEQLRKTITHALREGEPSIERISPQLGTSSRTLQRRLQEAGTS
                     FRYELNLVRHELALSYLRDPRLQIVDIAMLLGYSEHSAFTRAFKEWSGRSPHEARQLN
                     SESYWAGSPWN"
     gene            43440..44396
                     /locus_tag="PPUBIRD1_RS00205"
                     /old_locus_tag="PPUBIRD1_0043"
     CDS             43440..44396
                     /locus_tag="PPUBIRD1_RS00205"
                     /old_locus_tag="PPUBIRD1_0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014589184.1"
                     /translation="MMTLQPFQQMPFMNTITDLLAPATIQFFSNGSRCVADFYRPLGA
                     GPFPVVVMAHGLGGTRKMRLPAFATRFAAAGYACLVFDYRHFGDSDGEPRQLLDINRQ
                     LEDWKAAIDHARRHADVDSQRVVIWGTSFGGGHVLATAADDARVAAVISQCPFTDGLS
                     SSLATELLVSLRLTLLALADRIGSWFGAKPILVPLAGQPGDTAFMTSPDAWSGYNGLI
                     PSGAHIRKEAAARFALDIIRYYPGRSTPRIQAPVLFCVCDPDSVAPAKQTLRHARRAP
                     RHEIHRYAHGHFDIYVGKAFEQVVGDQLDFLKRNVPSTPTKR"
     gene            44401..45264
                     /locus_tag="PPUBIRD1_RS00210"
                     /old_locus_tag="PPUBIRD1_0044"
     CDS             44401..45264
                     /locus_tag="PPUBIRD1_RS00210"
                     /old_locus_tag="PPUBIRD1_0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589185.1"
                     /translation="MYDLQGKVVLITGAAGGIGAASARELYVQGASLVLTDTSQEAVD
                     KLAQEFNSQRVLPLAFDVTDAEAAKAVIRQAVERFGRLDVAFANAGISWRGVPATLRT
                     CDEAEFRRIIEVDLFGVWHAMRAALPEVVRNRGQVLVTSSTYAYLNGMANAPYAASKA
                     AVESLARSLRAELSATGASASVLYPGWTATAIAKVAFGGNAIATQMNETLLPAFLHRA
                     IAPEQVARGVVRGLQKRQPRIVVPARWAPISLLRGLFNVFTDWHLTRDAHLQRLLHQL
                     EEETVRTQSPS"
     gene            45293..46159
                     /locus_tag="PPUBIRD1_RS00215"
                     /old_locus_tag="PPUBIRD1_0045"
     CDS             45293..46159
                     /locus_tag="PPUBIRD1_RS00215"
                     /old_locus_tag="PPUBIRD1_0045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589186.1"
                     /translation="MKSYSLNDRVIAITGATGGLGRAAAQALRDKGAKLVLLDLDLDS
                     LNAMAVTLGGPNVAVGWVANVRSIESLETALKEAAQHFGGIDVVVAGAGVSSVVALEH
                     IDPATFDRVIDINLNGVARTFRASLPHVKARQGYLLAISSMAAFVHSPLNTAYTASKA
                     GVWALCDSLRLELRQHGVSVGSLHPTFFQTPMMEAIVDGPSSTLVWNNHQGIWQFVAL
                     EQVVAALVDCIEQRHDLVTVPRSQMLVAKAPGLLRRLIEWIGFDAGKVAEAVRLSDEV
                     KASLGQGRSLNE"
     gene            46425..47744
                     /locus_tag="PPUBIRD1_RS00220"
                     /old_locus_tag="PPUBIRD1_0046"
     CDS             46425..47744
                     /locus_tag="PPUBIRD1_RS00220"
                     /old_locus_tag="PPUBIRD1_0046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015094700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein precursor"
                     /protein_id="WP_014589187.1"
                     /translation="MKINGCEIPCLSAQRKCAAWVKYTSVMALLSASTIAGANGIALN
                     EQSASSAGTAYAGRSSSALDASTIYGNPAGLTKLKRAEISGGAAIISGSDDISDAQSS
                     VAGTNRGDSVPLTILPFAYMSTPLDDRFSIGLGLYAPSGLINEYESTFQGRYQGSYSS
                     TKEVTLQPTIAYRINDYVSIGGGPTINHFDAELQNYLASGALNNGQDTEITLKGDDTA
                     IGYNVGLLVDLSDATSWGINYHSKVSYHLKGHTEVSGSPSVIPLDGKYDNKIDITMPE
                     SVDTSITHHFNSRWTGYLGTTWKRWSRLKKIEAINSDVSALGQSAGLERVDEPLNWHD
                     TWSTAVGTSFQLNQQWLLRAGYAYDPSPISNADRSVRVPVGNRQVVTLGGAYLPSPDL
                     TIDFAYGYLWESKASVNQANNSGLQPEYSANYENSANIFLVQASYRY"
     gene            complement(48338..49579)
                     /locus_tag="PPUBIRD1_RS00225"
                     /old_locus_tag="PPUBIRD1_0047"
     CDS             complement(48338..49579)
                     /locus_tag="PPUBIRD1_RS00225"
                     /old_locus_tag="PPUBIRD1_0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin, OprD family"
                     /protein_id="WP_014589188.1"
                     /translation="MNIHANRKSLVLVIPTLLLPINVWAEGFVEDTSATLTLRNFFFE
                     RNFTAPGVTQSHAREWTQGFIFDLKSGFTQGTVGFGVDVLGKYAVKLDGGAGEYGALL
                     LPKDGDGDPAGSFGRLGVALKAKLSNTEVKVGEWMPNFPIVTADDFRALPQTFRGAQI
                     ASQELKNWSFYAGEFTKTSLRNDSSMEDLSFGSAQSDSFTFLGADYRSSSKNTTVRLW
                     SGELEDIYKQHYLGLIQKWQLSQTVSLTSNLGYFWGKDTGVAKAGSLDNQTASALFSL
                     NIAQHSISIGLQNVSGDSGWMRIGGTGGIYLANNTFNHAFDNPRERSWQVRYDLNFVG
                     YGIPGLTLMTRYVHGDNVELRNVKDGSEWVRESELGYVFQSGKLRDLAVRWRNSSVRR
                     NFNASDYDENRLIVSYPLNIF"
     gene            complement(49794..50723)
                     /locus_tag="PPUBIRD1_RS00230"
                     /old_locus_tag="PPUBIRD1_0048"
     CDS             complement(49794..50723)
                     /locus_tag="PPUBIRD1_RS00230"
                     /old_locus_tag="PPUBIRD1_0048"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003235804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase family protein"
                     /protein_id="WP_012054141.1"
                     /translation="MSTKNTIDLKGLVPAPVTPFTRDGEVDYAAIQKLGAWLGSYEGV
                     KGLVVLGHAGEGTFLTQAEQGRVIQAFKESVGGRLPIIAGITGEGTQVAAEEAKRAVD
                     NGAAAGLVYPSHGWLRFGYQKGAAQDRYKAIYEESGLPLILFQYPDVTKATYDLETQL
                     EIAKQPGVFAMKNGVRNMRRWDTEIPVIRREVPDLQILTCHDEYLLHTMFDVDGALVG
                     YGGLTPEPLIELIAAGKRRDYPAARAIHDKLLPVTRNVYHRGSHMEGTVALKHGLVAR
                     GILDHATVRSPLLPLAEGADKEIADALRSAGLV"
     gene            complement(50847..52238)
                     /locus_tag="PPUBIRD1_RS00235"
                     /old_locus_tag="PPUBIRD1_0049"
     CDS             complement(50847..52238)
                     /locus_tag="PPUBIRD1_RS00235"
                     /old_locus_tag="PPUBIRD1_0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589189.1"
                     /translation="MLMQQVETDPLPDKVKSQANISARLERLPITKQVFWARNIIGAA
                     TFFDGYTVIAIAYAMPVLAKEWSLSGAQIGMILSAGYLGQLFGALIFGWLAEKLGRMK
                     VLTFTILLFVSMDVACLFASSAAMMIAFRFIQGIGTGGEVPVASAYINELIGSKKRGK
                     FFLLYEVMFLLGLVGAGIIGYFLVPIYGWQAMFAVGIVPAMLLIPLRFFLFESPRWLA
                     SKGRLDEADRIVTRLENSALKAGKTLQPPVEVPQIQTDKNGLGWKELFKGMYFKRSLV
                     IWAMWFGAYMVANGLITWLPTLYRQHFNLPLETSLAYGFMTSAGGVVAAVICALLIDK
                     VGRRRWYMGALFLAAIPLAILATTGASAPLKILALAGLGYALVQTVTFSLYLYSAELY
                     PTRLRALGTGVGSAWLRMGSALGPIIVGFTVSGAGVQYVFGTFAVVLLITATITALFA
                     IETKGRILEELSP"
     gene            53576..54298
                     /locus_tag="PPUBIRD1_RS00240"
     CDS             53576..54298
                     /locus_tag="PPUBIRD1_RS00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_041166810.1"
                     /translation="MSSSQHIAIVDDYPDIRELVAQYLTQEGYRLTAVADGNELRALL
                     DRDVPDLIILDVMMPGEDGLSLCRHIRSRSNTPVLFLSARTEDLDVILGLEMGGDDYL
                     KKPFNPRELLARVKALLRRATPASEGASSMLEGSIRFGEWVLNCKLRELLGADGVSVS
                     LSGTEFRLLAALLEKPGEIVTRDELLNKVSGRASEPFDRSIDNQISRLRRKIEPDPKN
                     PIYIRTHWGGGYAFVHLVSNSS"
     gene            54295..55695
                     /locus_tag="PPUBIRD1_RS00245"
                     /old_locus_tag="PPUBIRD1_0051"
     CDS             54295..55695
                     /locus_tag="PPUBIRD1_RS00245"
                     /old_locus_tag="PPUBIRD1_0051"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_014589191.1"
                     /translation="MKLRNPNLAARFIGLMLLALIVSQALTLSIFWDERAGALREVAK
                     SDFLSRTSSLASLLDRMPVDERQMTLQVSSTAYERFWLFPASPSQPSEWWKFARRHLL
                     EPLSHGKPQGTLSIQFRSEDEVPPATIDATAAWSVPGEALWPSPRTARFIYLPQLNVM
                     GVATPLNNGTWLHAAYAKPVTDSPFSRRALVSLGITALALTLIAVLIARGISQPLRDL
                     ALAAQRLGRGHSGTELREHGPEDIRRTAKAFNQMQRRIQRFVDDRTRMLAAVGHDLRT
                     PLTSLRLRVEFIQDPEVQRKMLATLDEITAITEAAIGYGRDNAVTEPTRTMDIGTLVE
                     SLCEDLVTLGMAVSFSCNSKVILECRPDALRRAIRNLIENAVRYGECADVRVYSADKH
                     VHISVTDRGNGIPDSELEAVFTPFYRLEHSRNRNTGGVGLGLSIVRSIARQHGGEITL
                     INHNGGLEAIISLPEN"
     gene            55804..56640
                     /locus_tag="PPUBIRD1_RS00250"
                     /old_locus_tag="PPUBIRD1_0052"
     CDS             55804..56640
                     /locus_tag="PPUBIRD1_RS00250"
                     /old_locus_tag="PPUBIRD1_0052"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_012054147.1"
                     /translation="MAPRTSTKSETTAAEEDKNQRSTVQSLAKGFRVLEAFTAESDEL
                     TLSQIAAKAELDPGTTYRMLNTLVDLGYVSRIPESKRFSLTLKILNLGFHAIAHTDLR
                     SLVRPVLRGLVSETSEAASFAVLQGADVLYLERVRAGITRLGVDIRIGTTVPACQTAI
                     GQSILAFLPDHEVERIKELSSSTSFMSKSLSRPLSEVLEQIRKDGYIITESLFAEGLR
                     ILAVPVLDIDGYPVGAISIAAPAVRCTTEELERRALSVTIAAAKNIGRALQASGSINS
                     SL"
     gene            57087..57782
                     /locus_tag="PPUBIRD1_RS00255"
                     /old_locus_tag="PPUBIRD1_0053"
     CDS             57087..57782
                     /locus_tag="PPUBIRD1_RS00255"
                     /old_locus_tag="PPUBIRD1_0053"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012054148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /protein_id="WP_012054148.1"
                     /translation="MINKTFESIASAVEGIIDGSTIMVGGFGTAGMPSELIDGLIATG
                     ARDLTIISNNAGNGEIGLAALLKAGCVRKVVCSFPRQSDSYVFDELYRAGKIELEVVP
                     QGNLAERIRAAGSGIGAFFSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAH
                     KGDRWGNLVYRKAARNFGPIMAMAAKTAIAQVDQIVELGELDQEHIITPGIFVQRVVA
                     VSGAAASSIINAA"
     gene            57791..58432
                     /locus_tag="PPUBIRD1_RS00260"
                     /old_locus_tag="PPUBIRD1_0054"
     CDS             57791..58432
                     /locus_tag="PPUBIRD1_RS00260"
                     /old_locus_tag="PPUBIRD1_0054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016711482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="WP_012054149.1"
                     /translation="MSITKKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANFLGDKE
                     VFLHSENGLLGMGPSPAPEEEDDDLINASKEHVTMLPGGAFFHHADSFSMMRGGHLDI
                     AVLGAFQVSVKGDLANWHTGAEGSIPAVGGAMDLATGARQVFVMMNHLTKSGESKLVP
                     ECTYPPTGFGCVSRIYTDMAVLEVTSDGLRVVEICAEIDFEQLQALSGVPLIQ"
     gene            complement(58778..60613)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_RS00265"
                     /old_locus_tag="PPUBIRD1_0055"
     CDS             complement(58778..60613)
                     /gene="glmS"
                     /locus_tag="PPUBIRD1_RS00265"
                     /old_locus_tag="PPUBIRD1_0055"
                     /EC_number="2.6.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020190289.1"
                     /note="Glucosamine--fructose-6-phosphate aminotransferase
                     [isomerizing]; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="WP_014589193.1"
                     /translation="MCGIVGAIAERNITAILIEGLKRLEYRGYDSAGLAVLTQNGELQ
                     RRRRIGKVSELEVAVADDPLAGQLGIAHTRWATHGAPTEGNAHPHFSGNDVAVVHNGI
                     IENHEELREELKGLGYVFTSQTDTEVIVHLIHHTLKSLPNLTDALKAAVKRLHGAYGL
                     ALISAKQPDRLVAARSGSPLVIGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRR
                     DQVSIWDQQGNKVQRETVQYHEGAEAADKGAYRHFMLKEIHEQPSVVQRTLEGRLGKD
                     NVLVQAFGPQAADLFAKVRNVQIVACGTSYHAGMVARYWLESLAGIPCQVEVASEFRY
                     RKVVVQPDTLFVSISQSGETADTLAALRNAKELGFLGSLAICNVGISSLVRESDLTLL
                     TLAGPEIGVASTKAFTTQLVSLMLLTLALGQVRGTLEAGAEAELVEELRRLPTRLGEA
                     LAMDATVEKIAELFADKHHTLFLGRGAQYPVAMEGALKLKEISYIHAEAYPAGELKHG
                     PLALVDNDMPVVTVAPNNELLEKLKSNLQEVRARGGELVVFADEHAGMTNGEGTHVIK
                     VPHIADALAPILYTIPLQLLSYYVAVLKGTDVDQPRNLAKSVTVE"
     gene            complement(60617..61393)
                     /locus_tag="PPUBIRD1_RS00270"
                     /old_locus_tag="PPUBIRD1_0056"
     CDS             complement(60617..61393)
                     /locus_tag="PPUBIRD1_RS00270"
                     /old_locus_tag="PPUBIRD1_0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014589194.1"
                     /translation="MSKRNTPQRRHNILALLSEQGEVSVDALAKRFATSEVTIRKDLA
                     ALETNGLLLRRYGGAVPVPQELLGEPAQPVSSYKKAIARAAVGRIREHARIIIDSGST
                     TAAMIPELGRQPGLVVMTNSLNVARAICDLEHEPVLLMTGGTWDPHSESFQGQVAEQV
                     LRSYDFDQLFIGADGIDLGRGTTTFNELLGLSRVMAEVAREVIVMVESDKVGRKIPNL
                     ELPWGSVHTLITDERLPAAAREQIQARGVNLICAAISQEQ"
     gene            complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_RS00275"
                     /old_locus_tag="PPUBIRD1_0057"
     CDS             complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_RS00275"
                     /old_locus_tag="PPUBIRD1_0057"
                     /EC_number="2.7.7.23"
                     /EC_number="2.3.1.157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470301.1"
                     /note="UDP-N-acetylglucosamine pyrophosphorylase; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     diphosphorylase/glucosamine-1-phosphate
                     N-acetyltransferase"
                     /protein_id="WP_014589195.1"
                     /translation="MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLQ
                     PQGIHVVIGHGAELVRERLAADDLNFVMQDKQLGTGHAVAQALPALTADTVLVLYGDV
                     PLIEVETLQRLLAKANDQQLGLLTVTLDDPTGYGRIVRDEQGKVTAIVEHKDASDAQK
                     AIKEGNTGILALPAARLADWMGRLSNNNAQGEYYLTDVIAMAVADGLVVATEQPHDAM
                     EVQGANDRRQLSELERHYQLREGRRLMAQGVTLRDPARFDVRGEVSVGRDVLIDINVI
                     LEGKVVIEDDVQIGPNCVIKNTTLRKGAVVKANSHLEGAVMGEGSDAGPFARLRPGSV
                     LDAKAHVGNFVELKNTHLGEGAKAGHLTYLGDAEIGARTNIGAGTITCNYDGANKFKT
                     VMGEDVFIGSNNSLVAPVEIKAGATTAAGSTITQAVDAGDLAVARARQRNISGWKRPE
                     KIKKS"
     gene            complement(63076..63495)
                     /locus_tag="PPUBIRD1_RS00280"
                     /old_locus_tag="PPUBIRD1_0058"
     CDS             complement(63076..63495)
                     /locus_tag="PPUBIRD1_RS00280"
                     /old_locus_tag="PPUBIRD1_0058"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012274908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase epsilon chain"
                     /protein_id="WP_016489909.1"
                     /translation="MAMTVHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLIT
                     NLKPGPITLTKQGGAQEVFYISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAA
                     ENALNLKGADFDYGAAAARLAEAAAQLRTVQQMRKGK"
     gene            complement(63539..64915)
                     /gene="atpD"
                     /locus_tag="PPUBIRD1_RS00285"
                     /old_locus_tag="PPUBIRD1_0059"
     CDS             complement(63539..64915)
                     /gene="atpD"
                     /locus_tag="PPUBIRD1_RS00285"
                     /old_locus_tag="PPUBIRD1_0059"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit beta"
                     /protein_id="WP_003253197.1"
                     /translation="MSSGRIVQIIGAVIDVEFPRDVVPSVYNALKVQGAETTLEVQQQ
                     LGDGVVRTIAMGSTEGLKRGLDVVDTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGE
                     EERRGIHQPAPSFADQAGGNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMME
                     LIRNIAMEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRV
                     ALTGLTMAEKFRDEGNDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGV
                     LQERITSTKEGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVD
                     PLDSTSRQLDPNVIGNEHYETARGVQYVLQRYKELKDIIAILGMDELSEADKQLVARA
                     RKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFSGILKGDYDHLPEQAFYMVGSIDE
                     AIEKAKKL"
     gene            complement(64943..65803)
                     /locus_tag="PPUBIRD1_RS00290"
                     /old_locus_tag="PPUBIRD1_0060"
     CDS             complement(64943..65803)
                     /locus_tag="PPUBIRD1_RS00290"
                     /old_locus_tag="PPUBIRD1_0060"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555983.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The gamma chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit gamma"
                     /protein_id="WP_003253195.1"
                     /translation="MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRP
                     YAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKD
                     MSANREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSINDLIGSVKVMLDAY
                     LDGRIDRLSVVSNKFINTMTQKPTVEQLVPLVATPDQDLKHHWDYLYEPDAKELLDGL
                     MVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAITQEI
                     SEIVGGAAAV"
     gene            complement(65852..67396)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_RS00295"
                     /old_locus_tag="PPUBIRD1_0061"
     CDS             complement(65852..67396)
                     /gene="atpA"
                     /locus_tag="PPUBIRD1_RS00295"
                     /old_locus_tag="PPUBIRD1_0061"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004351897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit alpha"
                     /protein_id="WP_003253193.1"
                     /translation="MQQLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHG
                     LADVMYGEMIEFPGGVYGMALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGK
                     ELLGRVVDALGNPIDGKGPLGNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPV
                     GRGQRELIIGDRQIGKTAMAIDAIINQKDSGIFCVYVAVGQKRSTVANIVRKLEENGA
                     LANTIVVVASASESAALQFLAPYAGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISL
                     LLRRPPGREAYPGDVFYLHSRLLERASRVSEEYVEKFTNGAVTGKTGSLTALPIIETQ
                     AGDVSAFVPTNVISITDGQIFLESAMFNSGIRPAVNAGVSVSRVGGAAQTKIIKKLSG
                     GIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPMSIADMALSLY
                     AAERGFLIDVEVSKIGSFEQALIAFFNRDHAELMAKINVKGDFNDEIDAGLKAGIEKF
                     KATQTW"
     gene            complement(67418..67954)
                     /locus_tag="PPUBIRD1_RS00300"
                     /old_locus_tag="PPUBIRD1_0062"
     CDS             complement(67418..67954)
                     /locus_tag="PPUBIRD1_RS00300"
                     /old_locus_tag="PPUBIRD1_0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014861150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit delta"
                     /protein_id="WP_003253191.1"
                     /translation="MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTM
                     QRLLKAPRLTSAEKAATFIDVCGDKFNAQAQNFIHVAAENDRLLLLPEIAALFDLYKA
                     EQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDASLIGGVVIRAGDLV
                     IDGSVRGKIAKLAEALKS"
     gene            complement(67967..68437)
                     /locus_tag="PPUBIRD1_RS00305"
                     /old_locus_tag="PPUBIRD1_0063"
     CDS             complement(67967..68437)
                     /locus_tag="PPUBIRD1_RS00305"
                     /old_locus_tag="PPUBIRD1_0063"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019694394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit B"
                     /protein_id="WP_010955888.1"
                     /translation="MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGL
                     DAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVK
                     AQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI"
     gene            complement(68494..68751)
                     /locus_tag="PPUBIRD1_RS00310"
     CDS             complement(68494..68751)
                     /locus_tag="PPUBIRD1_RS00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003097235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit C"
                     /protein_id="WP_003097235.1"
                     /translation="METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEM
                     VPMLQVKMFIVAGLLDAVTMIGVGIALFFTFANPFVGQIAG"
     gene            complement(68896..69765)
                     /locus_tag="PPUBIRD1_RS00315"
                     /old_locus_tag="PPUBIRD1_0064"
     CDS             complement(68896..69765)
                     /locus_tag="PPUBIRD1_RS00315"
                     /old_locus_tag="PPUBIRD1_0064"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_238192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit A"
                     /protein_id="WP_010955889.1"
                     /translation="MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAF
                     HLDTLGWSVALGLIFLLIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSP
                     VIAPLALTIFVWVFLMNAVDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAF
                     CVFALIIFYSIKVKGLGGFIGELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISL
                     ALRLFGNMYAGELVFILIAVMFGSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMML
                     TIVYLSMAHEDNH"
     gene            complement(69782..70189)
                     /locus_tag="PPUBIRD1_RS00320"
                     /old_locus_tag="PPUBIRD1_0065"
     CDS             complement(69782..70189)
                     /locus_tag="PPUBIRD1_RS00320"
                     /old_locus_tag="PPUBIRD1_0065"
                     /EC_number="3.6.3.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003437994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit I"
                     /protein_id="WP_010955890.1"
                     /translation="MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGY
                     SGLCGGLIAWLPNVYFAWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGV
                     KPLAPLAVFGVFVLTLLVSWFAPLLMNKRLSRP"
     gene            complement(70339..71211)
                     /locus_tag="PPUBIRD1_RS00325"
                     /old_locus_tag="PPUBIRD1_0066"
     CDS             complement(70339..71211)
                     /locus_tag="PPUBIRD1_RS00325"
                     /old_locus_tag="PPUBIRD1_0066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009402535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_003253185.1"
                     /translation="MAVKKRGLGRGLDALLSGPSVSALEEQAVKIDQKELQHLPVELV
                     QRGKYQPRRDMDPEALEELAHSIRNHGVMQPIVVRPIGDNRYEIIAGERRWRATQQAG
                     LDTIPAMVREVPDEAAIAMALIENIQREDLNPLEEAMALQRLQQEFELTQQQVADAVG
                     KSRVTVANLLRLITLPDAIKTMLAHGDLEMGHARALLGLDENRQEEGARHVVARGLTV
                     RQTEALVRQWLSDKPDPVEPSKPDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRY
                     NSLDELQGVLAHIR"
     gene            complement(71221..72012)
                     /locus_tag="PPUBIRD1_RS00330"
                     /old_locus_tag="PPUBIRD1_0067"
     CDS             complement(71221..72012)
                     /locus_tag="PPUBIRD1_RS00330"
                     /old_locus_tag="PPUBIRD1_0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_238195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ParA family protein"
                     /protein_id="WP_019436532.1"
                     /translation="MAKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGN
                     ATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQ
                     VKESRLRNALAPIRDNYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSD
                     LVDNIKRIAERLNPELKIEGLLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIR
                     LAEAPSFGMPALAYDKQSRGALAYLALAGELVRRQRRPSRTAQTT"
     gene            complement(72031..72681)
                     /locus_tag="PPUBIRD1_RS00335"
                     /old_locus_tag="PPUBIRD1_0068"
     CDS             complement(72031..72681)
                     /locus_tag="PPUBIRD1_RS00335"
                     /old_locus_tag="PPUBIRD1_0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020294935.1"
                     /note="Ribosomal RNA small subunit methyltransferase G;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase G"
                     /protein_id="WP_014589198.1"
                     /translation="MSSLVTPQHAEELSTGARQLGVELTAEQHEKLLGYLALLIKWNK
                     AYNLTAVRDPDEMVSRHLLDSLSVMSFIHNGRDNWLDVGSGGGMPGIPLAILHPHKRV
                     TVLDANGKKTRFLTQVKMELRLDNLMVIHSRVEAFQPAQPFDGIISRAFSSMENFTNW
                     TRHLGDTGTQWLAMKGLHPADELVALPADFTVESEQALTVPGCQGQRHLLILRRKA"
     gene            complement(72678..74570)
                     /locus_tag="PPUBIRD1_RS00340"
                     /old_locus_tag="PPUBIRD1_0069"
     CDS             complement(72678..74570)
                     /locus_tag="PPUBIRD1_RS00340"
                     /old_locus_tag="PPUBIRD1_0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017848940.1"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme mnmG; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine-5-carboxymethylaminomethyl(34)
                     synthesis enzyme MnmG"
                     /protein_id="WP_014589199.1"
                     /translation="MDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGH
                     MSCNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRA
                     IYKAVVREILENQPNLWIFQQSCDDLIVEQDQVKGVVTQMGLRFFAESVVLTTGTFLG
                     GLIHIGLQNHSGGRAGDPPSIALAHRMRELPLRVGRLKTGTPPRIDGRSVDFSVMTEQ
                     PGDTPIPVMSFMGNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYSGVIEGVGPRY
                     CPSIEDKIHRFADKESHQVFIEPEGLNTHELYPNGISTSLPFDVQLELVRSIRGMENA
                     HIVRPGYAIEYDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAA
                     LRAQGRDSWCPRRDEAYIGVLVDDLITLGTQEPYRMFTSRAEYRLILREDNADLRLTE
                     KGRELGLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTEQGQAIVDKFGTPLSHEYS
                     LLNLLARPEIDYAGLIEATGGEAIDPQVAEQVEIRTKYAGYIDRQQDEIARLRASEDT
                     RLPVDIDYTTISGLSKEIQGKLSQTRPETLGQASRIPGVTPAAISLLLIHLKKRGAGR
                     ELEQSA"
     gene            complement(75203..76573)
                     /locus_tag="PPUBIRD1_RS00345"
                     /old_locus_tag="PPUBIRD1_0070"
     CDS             complement(75203..76573)
                     /locus_tag="PPUBIRD1_RS00345"
                     /old_locus_tag="PPUBIRD1_0070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine-5-carboxymethylaminomethyl(34)
                     synthesis GTPase MnmE"
                     /protein_id="WP_010951424.1"
                     /translation="MNTVRETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRTLTP
                     RHAHYGPFRDDEGLVLDEGIALFFPGPNSFTGEDVLELQGHGGPVVLDMLLQRCVQVG
                     CRLARPGEFSERAFLNDKLDLAQAEAIADLIEASSSQAARNALRSLQGEFSRRVHSLT
                     EALIALRIYVEAAIDFPEEEIDFLADGHVLSMLDAVRSELSTVQREAGQGALLRDGMT
                     VVIAGRPNAGKSSLLNQLAGREAAIVTDIAGTTRDILREHIHIDGMPLHVVDTAGLRD
                     TDDHVEKIGVERALKAIGEADRVLLVVDSTAPEASDPFALWPEFLAQRPDPAKVTLIR
                     NKADLSGERVALEQCDDGHVTITLSAKGDDTGLQLLRDHLKGCMGYEQTAESGFSARR
                     RHLDALRQASEHLEHGRAQLTLAGAGELLAEDLRQAQHALGEITGAFSSDDLLGRIFS
                     SFCIGK"
     gene            complement(76662..78344)
                     /locus_tag="PPUBIRD1_RS00350"
                     /old_locus_tag="PPUBIRD1_0071"
     CDS             complement(76662..78344)
                     /locus_tag="PPUBIRD1_RS00350"
                     /old_locus_tag="PPUBIRD1_0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015886658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase YidC"
                     /protein_id="WP_010951425.1"
                     /translation="MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAP
                     GLPDGVPAGNNGASADVPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIV
                     QLNLPKYPRRQDHPNIPFQLFDNGGERVYLAQSGLTGTDGPDARASGRPLYAAEQKSY
                     QLADGQEQLVVDLKFSDNGVNYIKRFSFKRGEYDLNVSYLIDNQSGQAWNGNMFAQLK
                     RDASGDPSSSTATGTATYLGAALWTASEPYKKVSMKDIDKGSLKENVSGGWVAWLQHY
                     FVTAWIPAKSDNNVVQTRKDSQGNYIIGYTGPVISVPAGGKVETSALLYAGPKIQSKL
                     KELSPGLELTVDYGFLWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAA
                     SYRSMARMRAVAPKLAALKERFGDDRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF
                     LALYWVLLESVEMRQAPWILWITDLSIKDPFFILPIIMGATMFIQQRLNPTPPDPMQA
                     KVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEAATKKAAA"
     gene            complement(78347..78592)
                     /locus_tag="PPUBIRD1_RS25945"
     CDS             complement(78347..78592)
                     /locus_tag="PPUBIRD1_RS25945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003437980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertion efficiency factor"
                     /protein_id="WP_003253169.1"
                     /translation="MRKLALVPIQFYRYAISPLMANHCRFFPSCSCYAYEAIENHGIW
                     RGGWLAVRRLGRCHPWNDGGFDPVPPAPSSRTSSIAE"
     gene            complement(78585..78989)
                     /locus_tag="PPUBIRD1_RS00355"
                     /old_locus_tag="PPUBIRD1_0072"
     CDS             complement(78585..78989)
                     /locus_tag="PPUBIRD1_RS00355"
                     /old_locus_tag="PPUBIRD1_0072"
                     /EC_number="3.1.26.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003260020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="WP_003253166.1"
                     /translation="MVSQDFSREKRLLTPRHFKAVFDSPTGKVPGKNLLILARENGLD
                     HPRLGLVIGKKSVKLAVQRNRLKRLMRDSFRLNQQLLAGLDIVIVARKGLGEIENPEL
                     HQHFGKLWKRLARSRPTPAVTANSAGVDSQDA"
     gene            complement(79003..79137)
                     /locus_tag="PPUBIRD1_RS25950"
                     /old_locus_tag="PPUBIRD1_0073"
     CDS             complement(79003..79137)
                     /locus_tag="PPUBIRD1_RS25950"
                     /old_locus_tag="PPUBIRD1_0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_003253163.1"
                     /translation="MKRTFQPSTIKRARTHGFRARMATKNGRAVLSRRRAKGRKRLAI
                     "
     gene            79733..81253
                     /locus_tag="PPUBIRD1_RS00360"
                     /old_locus_tag="PPUBIRD1_0074"
     CDS             79733..81253
                     /locus_tag="PPUBIRD1_RS00360"
                     /old_locus_tag="PPUBIRD1_0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_010951427.1"
                     /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPN
                     RFVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASL
                     AQTQAHKTAPAAAVEPVAVAAAEPVLVETSSRDSFDAMAEPAAAPPSGGGRAEQRTVQ
                     VEGALKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKT
                     HLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
                     QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVE
                     PPELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRD
                     ITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
                     ALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
     gene            81294..82397
                     /locus_tag="PPUBIRD1_RS00365"
                     /old_locus_tag="PPUBIRD1_0075"
     CDS             81294..82397
                     /locus_tag="PPUBIRD1_RS00365"
                     /old_locus_tag="PPUBIRD1_0075"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_003253156.1"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSL
                     TGTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLL
                     EVSRNTLRAVSTDGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSN
                     EKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTT
                     EQVRLILSDSNSSALLQEAGNDDSSYVVMPMRL"
     gene            82413..83516
                     /locus_tag="PPUBIRD1_RS00370"
                     /old_locus_tag="PPUBIRD1_0076"
     CDS             82413..83516
                     /locus_tag="PPUBIRD1_RS00370"
                     /old_locus_tag="PPUBIRD1_0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253154.1"
                     /note="DNA replication and repair protein recF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="WP_014589201.1"
                     /translation="MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVH
                     LLGLARSFRSTRLNPVIQYEQAACTVFGEVQLTEGGTSNLGVSRERQGEFTIRIDGQN
                     ARSAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALR
                     QRNSWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGL
                     TLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQ
                     KLVVCALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELHCQVFITCV
                     DHELLREGWQTETPVALFHVEQGRITQTHDHRE"
     gene            83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_RS00375"
                     /old_locus_tag="PPUBIRD1_0077"
     CDS             83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_RS00375"
                     /old_locus_tag="PPUBIRD1_0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_003253152.1"
                     /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFE
                     VVDNSIDEALAGHCDDITVIIHPDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHA
                     GGKFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVG
                     DSETTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFK
                     YEGGLRAFVEYLNTNKTPVNSQVFHFNVQRDDGVGVEVALQWNDSFNENLLCFTNNIP
                     QRDGGTHLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQLPELVERGYIYIAQPPLYKVKRGKQEQYIKDDEAMEEYMTQSALEDA
                     SLHLDESAPAVSGVQLEALVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQLGD
                     HAVMQAWLAQFQARLNSSQKSGLAYNASLREDKERNVWLPEVEITSHGLASYITFNRD
                     FFGSNDYRTVVNIGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQR
                     YKGLGEMNPDQLWETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LSVSNLDF"
     gene            complement(86006..86413)
                     /locus_tag="PPUBIRD1_RS00380"
     CDS             complement(86006..86413)
                     /locus_tag="PPUBIRD1_RS00380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019438064.1"
                     /translation="MKKALTVICAALMLSTPLASFAQPGPPDRHDGGPSHQGNPPHGQ
                     PQHQGRHDNGRGPAYRDPNFRPQQGMPIPHKQWQRGHAVDPHYRGDRYWVTDWQARHL
                     YAPPRDHRWLYVNGDYVLVAIASGVIVNILAGY"
     gene            complement(86544..87836)
                     /locus_tag="PPUBIRD1_RS00385"
                     /old_locus_tag="PPUBIRD1_0080"
     CDS             complement(86544..87836)
                     /locus_tag="PPUBIRD1_RS00385"
                     /old_locus_tag="PPUBIRD1_0080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_014589203.1"
                     /translation="MPEAHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGR
                     HDQAPLGEKCHRVSHHYAVPCDQAGEHCPMRKAWDSKVPERVLHIHHTPRGPEHVDVE
                     LRPILDEQGKVVAFVERLTTITLASAQPQEQGLVGRAPTFKAALASLQRAAPAQIPVL
                     LQGESGTGKELFARAVHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQR
                     KIGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLISATH
                     KPLKQMVADGSFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMVGQPTPRLSE
                     DALQQLALHPFPGNIRELRNILERARLFADDGVIRPEHLPEDTGLTGAPKGSGRRNDL
                     GELAQALELFKGSRSELASHLGMSERTLYRRLKALGLN"
     gene            88059..88943
                     /locus_tag="PPUBIRD1_RS00390"
                     /old_locus_tag="PPUBIRD1_0081"
     CDS             88059..88943
                     /locus_tag="PPUBIRD1_RS00390"
                     /old_locus_tag="PPUBIRD1_0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016712782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold metallo-hydrolase"
                     /protein_id="WP_010951461.1"
                     /translation="MIIGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYDPK
                     SGRTCSASADRLIERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQ
                     VQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIED
                     AGEIAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGG
                     RDMQYVTTVAEQRAHNIHIHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMRSGQL
                     PPPEANGVSYLKIPLNKL"
     gene            88984..90252
                     /locus_tag="PPUBIRD1_RS00395"
                     /old_locus_tag="PPUBIRD1_0082"
     CDS             88984..90252
                     /locus_tag="PPUBIRD1_RS00395"
                     /old_locus_tag="PPUBIRD1_0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)/FAD-dependent oxidoreductase"
                     /protein_id="WP_014589205.1"
                     /translation="MPALLSPANTDHHKVVIVGAGAAGIATASSLTSRDPSLDVALID
                     PAEVHYYQPGWTMVGAGVFKAPSTARTMASTIPRGVRWVKARVKGFDPLAQLVILDDG
                     RAISYEQLIVCPGLKLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRAL
                     FSQPPMPIKCAGAPQKALYLSCDHWLRHGHLGAVKASFYNAGAVLFGVADYVPALMKY
                     IEKYAVDLNFSHRLVAVDGPGKRATFLRTLPDGSSETRIEAFDMLHVVPPQVAPDFIR
                     ESPLADSSGWVDVDPHTLRHRKYTNVHALGDVANTSNAKTAAAARKQAPVVANNVLVA
                     LGRLATLAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPNWLLDGRKPTRLAWLLK
                     AQALPPLYWQGMLKGREWLARPQLVAEGGQ"
     gene            90249..91067
                     /locus_tag="PPUBIRD1_RS00400"
                     /old_locus_tag="PPUBIRD1_0083"
     CDS             90249..91067
                     /locus_tag="PPUBIRD1_RS00400"
                     /old_locus_tag="PPUBIRD1_0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016712784.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion permease"
                     /protein_id="WP_014589206.1"
                     /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVE
                     AAPVGLLAVGLAAAVGAVLGLRQGLVRYRAALFIALVGVAAAPFGLMLAHRLPNAPLQ
                     VVFAGVLVYACLRIWRKAAKELRGEANDAHRFIEPCVLNPLQGRLRWTLPCARALAFT
                     GALSGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGV
                     MHWQVGAPFAVGAVLGLLLARPLAARLAGPRLQQMFAVAGWAAALLLAGKALLG"
     gene            complement(91056..91943)
                     /locus_tag="PPUBIRD1_RS00405"
                     /old_locus_tag="PPUBIRD1_0084"
     CDS             complement(91056..91943)
                     /locus_tag="PPUBIRD1_RS00405"
                     /old_locus_tag="PPUBIRD1_0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589207.1"
                     /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSL
                     GTALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIG
                     IMFFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDY
                     RLALYASQDYLDRAPPLRHREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVVFRST
                     SVIAQQAAARAGLGIAVLPNYMARHDPTLVRVLPGETIQRSYWICTRRELHKSVRLRV
                     VWDYLLALCAAEQSELLAE"
     gene            92178..93824
                     /locus_tag="PPUBIRD1_RS00410"
                     /old_locus_tag="PPUBIRD1_0085"
     CDS             92178..93824
                     /locus_tag="PPUBIRD1_RS00410"
                     /old_locus_tag="PPUBIRD1_0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase"
                     /protein_id="WP_014589208.1"
                     /translation="MPSADSVFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDN
                     YPWIHIPVGYLYCIGNPRTDWCFKTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRG
                     QAADYDHWAAQGNDGWAWKDVLPLFKASENHFAGASEYHGAEGEWRVERQRYSWPILD
                     AFRDAAEQSGIGKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPIKDRANLTVLT
                     GVQVDQVLLDNTRARAVKALWQGAWHEFAARREIILCAGAVGSPGILQRSGIGPRQLL
                     ESLGIGVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRS
                     GPLAMAPSQLGVFVRSSPEQATANLQYHVQPLSLERFGEPLHQFPAFTASVCNLRPAS
                     RGRIDICSTDMNSTPLIDPNYLSAAQDLRVAADAIRLTRRIVQAPALAAFEPKEYLPG
                     PALQSEEELFEAAGKIGTTIFHPVGTCRMGNGAMDVVDNQLRVHGIPGLRVADASIMP
                     QITSGNTCSPTLMIAEKAAQLILKGAATQTYLNEDALPTP"
     gene            93922..95541
                     /locus_tag="PPUBIRD1_RS00415"
                     /old_locus_tag="PPUBIRD1_0086"
     CDS             93922..95541
                     /locus_tag="PPUBIRD1_RS00415"
                     /old_locus_tag="PPUBIRD1_0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010447557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589209.1"
                     /translation="MSDYIQEQGAAASSSSRREERKIIFASSLGTVFEWYDFFLYGAL
                     AAVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVL
                     MGLSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPPGKRGL
                     HTGFIQSTATLGLLLSLLVVLGSRYVSGDQFETWGWRLPFLLSIVLLAISTWIRMSMH
                     ESPAFVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFM
                     TQMLKMDSAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFK
                     ALSYYANPQIDAASRQAPIVVTADPQGCTFQFDPVGKARFDSPCDKVKTFLVKQGLPY
                     SSVSVAGSEVVVNIGDKTINGFDETAMRAAIEQAGYPAKAEPAQVNQVMVVVLIVAMI
                     LIATMTYGPLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFY
                     GLWYPVLVTGISLVVGIFCLRETKDVDIDKV"
     gene            complement(95716..96501)
                     /locus_tag="PPUBIRD1_RS00420"
                     /old_locus_tag="PPUBIRD1_0087"
     CDS             complement(95716..96501)
                     /locus_tag="PPUBIRD1_RS00420"
                     /old_locus_tag="PPUBIRD1_0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012269866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_019438060.1"
                     /translation="MVQATMSILQAIRIFLFYLLLGTSSLLWCSLSFFVAPFLSFPKR
                     YKFINVYWCRCALFLVRTILGIDYKITGAENVPAEPCVILSNHQSTWETFFLSQYFSP
                     LSQVLKRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPE
                     GTRVPFGTLGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPM
                     YANGTGPRAIAELNDRAAAWNEATQRAMGSLPPAAEKPQEQMA"
     gene            complement(96548..97075)
                     /locus_tag="PPUBIRD1_RS00425"
                     /old_locus_tag="PPUBIRD1_0088"
     CDS             complement(96548..97075)
                     /locus_tag="PPUBIRD1_RS00425"
                     /old_locus_tag="PPUBIRD1_0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003220221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="WP_014589211.1"
                     /translation="MKLLILDRDGVINYDSDAYIKTLEEWVPIPGSVDAIAQLSKAGW
                     TVAVATNQSGIARGYYPLATLDAMHARLRALVAEQGGEVGHIVYCPHGPDEGCDCRKP
                     KPGMLRAIAEHYQIGLEGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPET
                     TLIFDDLAAIARELI"
     gene            complement(97079..99133)
                     /locus_tag="PPUBIRD1_RS00430"
                     /old_locus_tag="PPUBIRD1_0089"
     CDS             complement(97079..99133)
                     /locus_tag="PPUBIRD1_RS00430"
                     /old_locus_tag="PPUBIRD1_0089"
                     /EC_number="6.1.1.14"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018927313.1"
                     /note="Glycyl-tRNA synthetase beta subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit beta"
                     /protein_id="WP_014589212.1"
                     /translation="MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTG
                     KQVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGVEL
                     AEIDQSGPKLRFSQHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWL
                     VMLLGDQVVDCTILSQKAGRESRGHRFHHPENVLITTPANYVEDLRKAYVLADFAERR
                     ELISKRTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTM
                     QDNQKYFCLLDNEGKLLPRFITVANVESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKK
                     QPLETFNERLKNVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRAGRAGLLSKCDL
                     ATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQTLTGAAVAIA
                     DKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEFAVKQFGA
                     KVKAPGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFR
                     KLPEAEALAAVNKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMA
                     AARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISL
                     LG"
     gene            complement(99130..100077)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_RS00435"
                     /old_locus_tag="PPUBIRD1_0090"
     CDS             complement(99130..100077)
                     /gene="glyQ"
                     /locus_tag="PPUBIRD1_RS00435"
                     /old_locus_tag="PPUBIRD1_0090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_064729.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase subunit alpha"
                     /protein_id="WP_003253126.1"
                     /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHT
                     ATFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLG
                     SLKAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANV
                     DKLFELFDFYESEANRLIKLELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARDVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
     gene            100161..100712
                     /locus_tag="PPUBIRD1_RS00440"
                     /old_locus_tag="PPUBIRD1_0091"
     CDS             100161..100712
                     /locus_tag="PPUBIRD1_RS00440"
                     /old_locus_tag="PPUBIRD1_0091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003260004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase I"
                     /protein_id="WP_019438059.1"
                     /translation="MPRCFWCTDDPLYQAYHDQEWGMPQRDPALLFEMLLLEGFQAGL
                     SWITVLRKRERYRQVMYGFDPVKLAAMSDERIEELMQDAGIIRNRLKLKAARRNAQAW
                     LAVDNPAEWLWSFIGGSPKINHFKQRSDVPAVTDEAKAMSKALQKAGFTFVGPTICYA
                     FMQATGMVMDHTTDCDRYAALLR"
     gene            100754..101641
                     /locus_tag="PPUBIRD1_RS00445"
                     /old_locus_tag="PPUBIRD1_0092"
     CDS             100754..101641
                     /locus_tag="PPUBIRD1_RS00445"
                     /old_locus_tag="PPUBIRD1_0092"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014716285.1"
                     /note="Acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(lauroyl)-lipid IVA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl acyltransferase"
                     /protein_id="WP_003253121.1"
                     /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKIPNSSRN
                     VVRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLE
                     VLEQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQM
                     GNRVAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNML
                     AGGKAVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQ
                     YMWSMKRFKKRPAGEPRWY"
     gene            complement(101740..102054)
                     /locus_tag="PPUBIRD1_RS00450"
                     /old_locus_tag="PPUBIRD1_0093"
     CDS             complement(101740..102054)
                     /locus_tag="PPUBIRD1_RS00450"
                     /old_locus_tag="PPUBIRD1_0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589214.1"
                     /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVE
                     QDPKYSAAWKLLGKAYQLQGDLAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKA
                     AG"
     gene            complement(102066..103439)
                     /locus_tag="PPUBIRD1_RS00455"
                     /old_locus_tag="PPUBIRD1_0094"
     CDS             complement(102066..103439)
                     /locus_tag="PPUBIRD1_RS00455"
                     /old_locus_tag="PPUBIRD1_0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016489939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Trk system potassium transport protein TrkA"
                     /protein_id="WP_010951472.1"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRES
                     SYLTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAY
                     YGGPLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIR
                     AVMGELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMSPARCRHLSDTLEST
                     VVLQGSASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAY
                     VDLVQGGDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSK
                     VVGKAIEDITLPPGTTIGAIIRDEEVMIAHDDTMIESGDHVILFVVDKKHIRDVEKLF
                     HVGLSFF"
     gene            complement(103463..104773)
                     /locus_tag="PPUBIRD1_RS00460"
                     /old_locus_tag="PPUBIRD1_0095"
     CDS             complement(103463..104773)
                     /locus_tag="PPUBIRD1_RS00460"
                     /old_locus_tag="PPUBIRD1_0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003170720.1"
                     /note="Ribosomal RNA small subunit methyltransferase B;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (cytosine(967)-C(5))-methyltransferase"
                     /protein_id="WP_014589215.1"
                     /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLA
                     FGTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCA
                     DKLKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKALKAFWPEQWEA
                     ICAANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLP
                     GFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAHVVAIDL
                     EAKRLTRVRENLDRLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLTRQADDIPALATLQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIKAFLARTP
                     GARELDLATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
     gene            complement(104770..105702)
                     /locus_tag="PPUBIRD1_RS00465"
                     /old_locus_tag="PPUBIRD1_0096"
     CDS             complement(104770..105702)
                     /locus_tag="PPUBIRD1_RS00465"
                     /old_locus_tag="PPUBIRD1_0096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951474.1"
                     /note="Methionyl-tRNA formyltransferase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_014589216.1"
                     /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLM
                     PSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPSLG
                     CINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDT
                     GGTLHDRLAKMGPPAVVRAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTRPAV
                     ELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGQGAPGEILSASKDGLVVACGDQAL
                     SLTRLQLPGGKALSFSDLFNSRREKFAAGKVLGQ"
     gene            complement(105763..106269)
                     /locus_tag="PPUBIRD1_RS00470"
                     /old_locus_tag="PPUBIRD1_0097"
     CDS             complement(105763..106269)
                     /locus_tag="PPUBIRD1_RS00470"
                     /old_locus_tag="PPUBIRD1_0097"
                     /EC_number="3.5.1.88"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020301426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_003253111.1"
                     /translation="MAILNILEFPDPRLRTLAKPVTEFDDALRQLIDDMFETMYEAPG
                     IGLAATQVNVHKQVVVMDLSEDRSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENV
                     DRPLRVRVKAQDRDGKPFELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKL
                     EKQHRQQA"
     gene            106476..107573
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_RS00475"
                     /old_locus_tag="PPUBIRD1_0098"
     CDS             106476..107573
                     /gene="dprA"
                     /locus_tag="PPUBIRD1_RS00475"
                     /old_locus_tag="PPUBIRD1_0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="WP_014589217.1"
                     /translation="MPSHHSSPCPPAELEARLRLHRLPEAGLRRFRTLLEAFGSASSA
                     LSAPASAWRALGIPQATIDARRSAEVRDGALAAMAWLERPGQHLLMWDGPGYPALLAE
                     IDDAPPLLFVAGEPALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAV
                     GVDGAAHRAALQAGGGTIAVLGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPLDAGPL
                     PGNFPRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGC
                     HQLIRDGALLVETVEQILESLQGWQNLPPAVMDRFDHPLLALLHAAPQTSESLAHCSE
                     QPLADVLAQLTELELEGRVSNEAGRWFARAG"
     gene            107616..108173
                     /locus_tag="PPUBIRD1_RS00480"
                     /old_locus_tag="PPUBIRD1_0099"
     CDS             107616..108173
                     /locus_tag="PPUBIRD1_RS00480"
                     /old_locus_tag="PPUBIRD1_0099"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951476.1"
                     /note="Putative ribosome maturation factor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_014589218.1"
                     /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKSRPVDKGLILVADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWV
                     TGQHDTVALRVSDHPVVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVL
                     GGALGGRKNPSVIRDLATGEVVRPG"
     gene            complement(108177..108293)
                     /locus_tag="PPUBIRD1_RS25955"
     CDS             complement(108177..108293)
                     /locus_tag="PPUBIRD1_RS25955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_076402393.1"
                     /translation="MGAGMPANTGEARARHRVVFFAGAPAPTGARVPSQACG"
     gene            108621..108938
                     /locus_tag="PPUBIRD1_RS00485"
                     /old_locus_tag="PPUBIRD1_0100"
     CDS             108621..108938
                     /locus_tag="PPUBIRD1_RS00485"
                     /old_locus_tag="PPUBIRD1_0100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589219.1"
                     /translation="MMKKIVPDPPLQCTSTRPFGRCDAGHDPLFTVNPNISAEDALVH
                     VALYLRSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPPTNRP
                     SQA"
     gene            108889..109077
                     /locus_tag="PPUBIRD1_RS25960"
     CDS             108889..109077
                     /locus_tag="PPUBIRD1_RS25960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013971858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_076402394.1"
                     /translation="MASSRLHRRQTDPHRHSEAIEADAVPVGAGLPANTGKAGAIHRG
                     GFFAGKPAPTGNVCGSGD"
     gene            complement(109066..110043)
                     /locus_tag="PPUBIRD1_RS00490"
                     /old_locus_tag="PPUBIRD1_0101"
     CDS             complement(109066..110043)
                     /locus_tag="PPUBIRD1_RS00490"
                     /old_locus_tag="PPUBIRD1_0101"
                     /EC_number="1.6.5.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_014589220.1"
                     /translation="MAKRIQFSQHGGPEVLQFVEFEPTPPGPQQVRVRNHAIGLNFID
                     TYFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVSRLKVGDRVAHAGGPLGAYSEVHTLP
                     EANLVKLPDTISFEQAAAVMLKGLTVQYLLKQTYEVKAGDVILFHAAAGGVGSLACQW
                     AKALGAKLIGTVSSAEKAERAKALGAWATIDYSREDVVKRVLELTDGKKCPVVYDGVG
                     ADTWLTSLDCLRPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENT
                     QAMADDLFAMIASGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
     gene            110178..111089
                     /locus_tag="PPUBIRD1_RS00495"
                     /old_locus_tag="PPUBIRD1_0102"
     CDS             110178..111089
                     /locus_tag="PPUBIRD1_RS00495"
                     /old_locus_tag="PPUBIRD1_0102"
                     /EC_number="1.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953125.1"
                     /note="Coproporphyrinogen-III oxidase, aerobic; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_014589221.1"
                     /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGG
                     GRTRVIGEGKVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPH
                     VPTSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADV
                     YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAFVDAYLPIV
                     QRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKAEPGSEEARLTEYFLQDRDWLGQ"
     gene            111114..111938
                     /locus_tag="PPUBIRD1_RS00500"
                     /old_locus_tag="PPUBIRD1_0103"
     CDS             111114..111938
                     /locus_tag="PPUBIRD1_RS00500"
                     /old_locus_tag="PPUBIRD1_0103"
                     /EC_number="1.1.1.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253098.1"
                     /note="shikimate 5-dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate dehydrogenase"
                     /protein_id="WP_014589222.1"
                     /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFS
                     DCARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDG
                     AGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVVANRTVEKAEQLA
                     REFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGK
                     EPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
     gene            complement(111977..113542)
                     /locus_tag="PPUBIRD1_RS00505"
                     /old_locus_tag="PPUBIRD1_0104"
     CDS             complement(111977..113542)
                     /locus_tag="PPUBIRD1_RS00505"
                     /old_locus_tag="PPUBIRD1_0104"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="WP_014589223.1"
                     /translation="MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYA
                     LIAGLPAEYGLYAAIVPVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYI
                     TLVLLLTFLGGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMAL
                     PSQSTALKTVQDLASHAGEVDLPSLLLGLATVVIGVAFKLWRPRWPSLLISLILVSLL
                     AWLLPGFFGHVPRVAAFTGQLPPFSPLPLLDVELMLHLLPSAVAVGMLGLVTSLSIAR
                     SLSARSEQLINPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFS
                     ALWVALFAVSGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTT
                     AATLLLELQTAIYAGVLASLFFYLKRTSRPRIQQSREGDADVLRVGGSIFFGAAHYLQ
                     VRLQRCQGPHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQK
                     LEGVELCPIRFEE"
     gene            complement(113458..113718)
                     /locus_tag="PPUBIRD1_RS25965"
     CDS             complement(113458..113718)
                     /locus_tag="PPUBIRD1_RS25965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013971858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_076402396.1"
                     /translation="MPWRPSKPNCNLTKQHTNPVGAGAPANTGKAGAKQRVGFFAGMP
                     APTGLGDPLRIVDNPCIASLYCCPSSPGFPANRAAACARTCW"
     gene            complement(113687..114610)
                     /locus_tag="PPUBIRD1_RS00510"
                     /old_locus_tag="PPUBIRD1_0105"
     CDS             complement(113687..114610)
                     /locus_tag="PPUBIRD1_RS00510"
                     /old_locus_tag="PPUBIRD1_0105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589224.1"
                     /translation="MHKFSAAVFVLALSTTTAHAADSDAQCSTVKMADPGWSDIASTN
                     AVARLLLESLGYQVKIDSLAVPIIYGGLKDGQVDAFLGNWMPAHQGFHDKFIANGDVQ
                     QLSRNLEGTEFTLAVPDYVWNAGVKDFADLQKHAGQFDKKLYGIGSGAPANLSLKAII
                     DKNEFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEK
                     WFGSKGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENSIMAEVVDKKISFDEAAKAW
                     VKAHPERLDGWLAGVTTKADGDALEAVKAKL"
     gene            complement(114625..116142)
                     /gene="betC"
                     /locus_tag="PPUBIRD1_RS00515"
                     /old_locus_tag="PPUBIRD1_0106"
     CDS             complement(114625..116142)
                     /gene="betC"
                     /locus_tag="PPUBIRD1_RS00515"
                     /old_locus_tag="PPUBIRD1_0106"
                     /EC_number="3.1.6.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017147851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline-sulfatase"
                     /protein_id="WP_014589225.1"
                     /translation="MTRPNILFIMADQMAAPLLPIYGPSPIKMPHLGRLAEQAVVFDS
                     AYCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMH
                     FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLD
                     FDEEVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIAKRYWDRYEGVDIPMPRA
                     EFGQAALDPHSQRLLKVYDLWNKPLPVDKVRDARRAYFGACSYIDDNIGQLLQTLEEC
                     NLADDTLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLIHAPKRFAAGRVTASVSTC
                     DLLPTLVELAGGAVDKDLQLDGRSLLGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGP
                     YKFVYSEDDPCLLYDLSRDPHERENLTDSPDHQVLLQTFVDEAQQRWDIPSLRQQVLA
                     SQRRRRLVAEALAIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
     gene            116251..117150
                     /locus_tag="PPUBIRD1_RS00520"
                     /old_locus_tag="PPUBIRD1_0107"
     CDS             116251..117150
                     /locus_tag="PPUBIRD1_RS00520"
                     /old_locus_tag="PPUBIRD1_0107"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014859482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589226.1"
                     /translation="MFEHLAGLSLDTLRVFEAAARLRGFTAAALELGTTQPAVSQQVK
                     RLEAQLGTRLFDRIYRGIELTEAGQVLFEQVHQGLQAMDDGIAQSGGRGQREVLQVAT
                     DFAFAAFWLMPRLQRFHEAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESR
                     WLFDEEVFPVCSPHLIHGKALSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVDSPP
                     PAGQLRFDNYTLLIQAAIAGQGVAIGWAHLVDGLVEQGLLCRPLEGSLRSERGYYAVL
                     PPRKRRGALIERFVDWLEQERSL"
     gene            complement(117262..117879)
                     /locus_tag="PPUBIRD1_RS00525"
                     /old_locus_tag="PPUBIRD1_0108"
     CDS             complement(117262..117879)
                     /locus_tag="PPUBIRD1_RS00525"
                     /old_locus_tag="PPUBIRD1_0108"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-flavin reductase"
                     /protein_id="WP_014589227.1"
                     /translation="MKNAETPVFKLVLFGPESSLGNALMVELLSRQHEVTAVVDDLNR
                     HSPRPGLHFKIGGLGDAHQAEQGAAGGSAVIALLPALAPGDLPGQARLSEALVAGLAR
                     TTIRRLLLVGDFDVLDEPGKYSEVERECVAQVVDGLQRSALHWTLINAPQELAGLSME
                     HFRSTEGTLEPGLAEPLRRLARIAAGMVDMLELDLHRGEHLNFVV"
     gene            117932..118264
                     /locus_tag="PPUBIRD1_RS00530"
                     /old_locus_tag="PPUBIRD1_0109"
     CDS             117932..118264
                     /locus_tag="PPUBIRD1_RS00530"
                     /old_locus_tag="PPUBIRD1_0109"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DOPA 4,5-dioxygenase"
                     /protein_id="WP_014589228.1"
                     /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPV
                     GPHPDWSCQLAFGPEVVGVVLPWLALYRKGLVVFMHPETGDELADHRDHAIWMGAVRP
                     LNLAVFGG"
     gene            complement(118382..119191)
                     /locus_tag="PPUBIRD1_RS00535"
                     /old_locus_tag="PPUBIRD1_0110"
     CDS             complement(118382..119191)
                     /locus_tag="PPUBIRD1_RS00535"
                     /old_locus_tag="PPUBIRD1_0110"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233145.1"
                     /note="Tryptophan synthase alpha chain; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="WP_014589229.1"
                     /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAG
                     ADVIELGMPFTDPMADGVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGY
                     YNPIHRFGVDTFVAQAKEAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDD
                     ARLPRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPE
                     QAANIARLADGVVVGSALVDKIAQAKSADQAVSDVLSLCSALAEGVRGARR"
     gene            complement(119188..120405)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_RS00540"
                     /old_locus_tag="PPUBIRD1_0111"
     CDS             complement(119188..120405)
                     /gene="trpB"
                     /locus_tag="PPUBIRD1_RS00540"
                     /old_locus_tag="PPUBIRD1_0111"
                     /EC_number="4.2.1.20"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011531493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_004575268.1"
                     /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKA
                     DPKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQ
                     VLLAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLL
                     GAEIVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGK
                     ETRAQLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHA
                     ASLNGGVPGVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVS
                     ITDDEALDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQ
                     TVMNHMAAQEKHA"
     gene            120516..121412
                     /locus_tag="PPUBIRD1_RS00545"
                     /old_locus_tag="PPUBIRD1_0112"
     CDS             120516..121412
                     /locus_tag="PPUBIRD1_RS00545"
                     /old_locus_tag="PPUBIRD1_0112"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589230.1"
                     /translation="MAHDLPPLNALRAFEAAARLNSVSQAAEALHVTHGAVSRQIKVL
                     EEHLGVALFVKDGRGIKLTDAGMRLRDASGEAFDRLRSVCSELSRDVSEAPFVLGCSG
                     SLLARWFIPRLGRLQADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHV
                     LAEECIGPVLSPHFAGFQRLQGAPAKALLGEALLHTTSRPQAWPTWAVQQGLDPAAIH
                     YGQAFEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTQAALALWVPRR
                     AADGRAEQLAQWLRAELARQSA"
     gene            complement(121409..121732)
                     /locus_tag="PPUBIRD1_RS00550"
                     /old_locus_tag="PPUBIRD1_0113"
     CDS             complement(121409..121732)
                     /locus_tag="PPUBIRD1_RS00550"
                     /old_locus_tag="PPUBIRD1_0113"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF883 domain-containing protein"
                     /protein_id="WP_014589231.1"
                     /translation="MHRNSLRKTSLESMEAEIESLLKSLENLKHDASEESQKSVKAIR
                     SNAESALRHSRSLLSDAYEEVKQRTRQTGKATRDYAQEHPYTTAGVAIGALGLLAAYL
                     ICKRN"
     gene            121883..122098
                     /locus_tag="PPUBIRD1_RS00555"
                     /old_locus_tag="PPUBIRD1_0114"
     CDS             121883..122098
                     /locus_tag="PPUBIRD1_RS00555"
                     /old_locus_tag="PPUBIRD1_0114"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253076.1"
                     /translation="MTDHHTYKKIELVGSSPTSIEEAINNALAEAGKSIKHLEWFEVV
                     DTRGHIRDNKAAHFQVTLKVGFRIANS"
     gene            122199..122420
                     /locus_tag="PPUBIRD1_RS00560"
                     /old_locus_tag="PPUBIRD1_0115"
     CDS             122199..122420
                     /locus_tag="PPUBIRD1_RS00560"
                     /old_locus_tag="PPUBIRD1_0115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016712812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253075.1"
                     /translation="MNKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYK
                     LEIVKKGDPAGKVIGSCEAGTKEIVYRRG"
     gene            complement(122493..123497)
                     /locus_tag="PPUBIRD1_RS00565"
                     /old_locus_tag="PPUBIRD1_0116"
     CDS             complement(122493..123497)
                     /locus_tag="PPUBIRD1_RS00565"
                     /old_locus_tag="PPUBIRD1_0116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LLM class flavin-dependent oxidoreductase"
                     /protein_id="WP_014589232.1"
                     /translation="MTQLRDLKISTLDLVPVRADAGPAQSLRNSLDLAQHVERFGYNR
                     FWVAEHHNMDGIASSATSVLIGYLAGGTSRIRVGSGGVMLPNHAPLVIAEQFGTLASL
                     YPGRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVP
                     GYDTDVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRYMHEAIRVYRNHFKPSTTLDK
                     PYVMLGIPMVVAQTDEKAEYLATSVYQRILALIRGQSLMQKPPVESMEGLWLPHERET
                     VGSFLGLAMIGSPQKVKAKVEVLLEQTGADELIFTCDLYEHADRIRSYELMAQALKTE
                     "
     gene            123650..124075
                     /locus_tag="PPUBIRD1_RS00570"
                     /old_locus_tag="PPUBIRD1_0117"
     CDS             123650..124075
                     /locus_tag="PPUBIRD1_RS00570"
                     /old_locus_tag="PPUBIRD1_0117"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_003253070.1"
                     /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTAERIDTAAEVTLDKQADGFAITAVHLVLRA
                     KVPGASEAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
     gene            124151..124384
                     /locus_tag="PPUBIRD1_RS00575"
                     /old_locus_tag="PPUBIRD1_0118"
     CDS             124151..124384
                     /locus_tag="PPUBIRD1_RS00575"
                     /old_locus_tag="PPUBIRD1_0118"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012269896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253067.1"
                     /translation="MIRVAIAVLASLVATSALAAVKPCEELKTEIEAKIQAQGVSSYT
                     LEIVPNSEVKDQNMVVGTCDGGTKKIIYQKNDR"
     gene            complement(124420..124833)
                     /locus_tag="PPUBIRD1_RS00580"
                     /old_locus_tag="PPUBIRD1_0119"
     CDS             complement(124420..124833)
                     /locus_tag="PPUBIRD1_RS00580"
                     /old_locus_tag="PPUBIRD1_0119"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_010951495.1"
                     /translation="MRQPMMLIALSTLGACASPLPPVDPKQAWVDLYTMTPGRVIMAD
                     RLDGKRLDDGRYFQVTPGKHELVVRFDYEIYSGGLMSQPRDRTCYLTVRFDNFKAGER
                     YRLEARAPVMEPQVLLYDANRKVVVNEPSEVFCIP"
     gene            complement(124889..125302)
                     /locus_tag="PPUBIRD1_RS00585"
                     /old_locus_tag="PPUBIRD1_0120"
     CDS             complement(124889..125302)
                     /locus_tag="PPUBIRD1_RS00585"
                     /old_locus_tag="PPUBIRD1_0120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589233.1"
                     /translation="MRALLVAGSLLLISACSTLPDPDPNQAWIDLTRYDNTSLDAVQV
                     DERDWGDSRYFEVQPGSHELTVRYQFPVNPSNIGPVEEPLWRDCQVKLTFKDFSAGQR
                     YQLQAGSIGFRPWIKLYDHQQKLLGQGLPAGCQRT"
     gene            125388..126461
                     /locus_tag="PPUBIRD1_RS00590"
                     /old_locus_tag="PPUBIRD1_0121"
     CDS             125388..126461
                     /locus_tag="PPUBIRD1_RS00590"
                     /old_locus_tag="PPUBIRD1_0121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_014589234.1"
                     /translation="MQRSGLGALDRIFTRLVPLVAALLLNGCSNVAYYGQLAQGQWQL
                     LRARQPVEQVLADPATPAPLRAHLQQAEQARAFASQQLKLPDNRSYRVYADLGRRYVV
                     WNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVEAYS
                     TLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYMQDDTEFNESFASFVEQEGTRQW
                     RAARGLAAVGGDQGKQRDQFIRLVLASRERLQAIYAGPLDDAHKRRAKQAEFERLRRE
                     YRQVRDGQWGGDKRYDAWMYGPMNNAKLLPFGLYDQWVPAFAALFREVGGDWVRFYER
                     VAHLGRLPIEERKAALQRLMVSL"
     gene            complement(126571..127221)
                     /locus_tag="PPUBIRD1_RS00595"
                     /old_locus_tag="PPUBIRD1_0122"
     CDS             complement(126571..127221)
                     /locus_tag="PPUBIRD1_RS00595"
                     /old_locus_tag="PPUBIRD1_0122"
                     /EC_number="3.1.3.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_014589235.1"
                     /translation="MHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEPDLARLEH
                     FIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYENLVFEGVPELLEALNGQGR
                     TLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEGLDPAQ
                     TLMIGDRKHDLIGARSNGLQAVAVGYGFGSREELMAEEPAFHFATVADLHQAFSKA"
     gene            complement(127343..127891)
                     /locus_tag="PPUBIRD1_RS00600"
                     /old_locus_tag="PPUBIRD1_0123"
     CDS             complement(127343..127891)
                     /locus_tag="PPUBIRD1_RS00600"
                     /old_locus_tag="PPUBIRD1_0123"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma carbonic anhydrase family protein"
                     /protein_id="WP_014589236.1"
                     /translation="MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVR
                     GDMHRIRIGARTSVQDGSVLHITHAGPFNTDGFPLIIGDEVTIGHKVMLHGCTLGNRI
                     LVGMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFS
                     YSAGNYVKLKDQHLAEGYDQPE"
     gene            127958..130045
                     /locus_tag="PPUBIRD1_RS00605"
                     /old_locus_tag="PPUBIRD1_0124"
     CDS             127958..130045
                     /locus_tag="PPUBIRD1_RS00605"
                     /old_locus_tag="PPUBIRD1_0124"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_019436839.1"
                     /translation="MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAIL
                     ADNRKAIAEILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYE
                     SCLPALSAYSTELGQNRALFEAYQALIDSPEAAGFDVAQKTILEHALRDFRLSGIDLP
                     ADKQQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQ
                     AKGLDGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMRE
                     ILDLRQELAELLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAY
                     AAEQGCPELASWDAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEI
                     AELKGFDSWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQL
                     QSPVANLVCNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAW
                     DAVELPSQFMENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLE
                     FSLFDFELHASHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYS
                     YKWAEVLSADAFSRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDA
                     LLRHSGLTEDAAA"
     gene            130042..130323
                     /locus_tag="PPUBIRD1_RS00610"
                     /old_locus_tag="PPUBIRD1_0125"
     CDS             130042..130323
                     /locus_tag="PPUBIRD1_RS00610"
                     /old_locus_tag="PPUBIRD1_0125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019098084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_010951500.1"
                     /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNEDGVPHRECVAC
                     GFTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAE"
     gene            130447..132441
                     /locus_tag="PPUBIRD1_RS00615"
                     /old_locus_tag="PPUBIRD1_0126"
     CDS             130447..132441
                     /locus_tag="PPUBIRD1_RS00615"
                     /old_locus_tag="PPUBIRD1_0126"
                     /EC_number="3.4.24.70"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="WP_014589238.1"
                     /translation="MDNPLLQNSHIPVDYSSITLENMQAAFDHVLLAHEKGVERIILD
                     QRAMPTWDDMVLAVDELDSRLLAVLYGASPLVGRDMDWANAITDVYGRATARFEQKFA
                     NSGLHDLYERLAKSDIGKQLDAGKRATLRWHLDKFVASGALLDTAGKARLADLQAQIG
                     TARKAFRSNIYRPGLSITDEAELSGIPQRVRDELAARAKEAGKQGWLIACDTVTTSEV
                     LKHADSRQLRERVYRAFHARGVSHDPQQDNRSHLQRLAQLLEEKALLLGFPSHLEQSL
                     QVKSAGSVAHVCGFLHDLADHVRPAMLQWRSQVEGRAAEQGLGKPQPWDFEYLQRASR
                     SEFPTAALRDYFPLNTVVSALQQLAQKLFGVVLQPKALAAWDDSVQPFEVWQDSAFIG
                     FLYLDAVQHAGKQPDAVFTTYVRNRRVDAEGIYHAASVVVFSDVPQAPPGFQPLLDHL
                     SLRKLFHEFGHALHHLLVRTTNHVMSNVTELGTDGVELFGKLFERWVWDADYLVAISA
                     HARDGSQLTRKQADKCLQQLRQRGVEEIARHLSLALFDMDLHATPNDGRSFEQRLGNA
                     RERCGYWPLADFEHPAHAFDHLVDGYDAGYYAYLWSDVHAFDLFTRFEAEGLLNRATG
                     RALQEALFAPGASRPLREGIEAFLGRQSNQAAYLRWHGLK"
     gene            132512..133570
                     /locus_tag="PPUBIRD1_RS00620"
                     /old_locus_tag="PPUBIRD1_0127"
     CDS             132512..133570
                     /locus_tag="PPUBIRD1_RS00620"
                     /old_locus_tag="PPUBIRD1_0127"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014589239.1"
                     /translation="MIPPAPQKGRGTAHNPHNRFASGRSVAEDDGWYQEVPQTQGTEV
                     RIETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLI
                     AKTNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTI
                     VTKGSLVLRDLDLLAEMARQRLARVMISLTTLDDDLKRVLEPRAASPGARLRAIRVLR
                     EAGVPVGVLCSPMIPMINDSELERLLEAAKEAGAQSAAYMMLRLPLEVAPLFEQWLQD
                     HYPQRAAHVLSLIRQSRGGELYDSRFGVRMRGEGVFAELLAQRFARAMKRLDFEGRDA
                     QALDCSAFCPPGGQMALF"
     gene            133874..134593
                     /locus_tag="PPUBIRD1_RS00625"
                     /old_locus_tag="PPUBIRD1_0128"
     CDS             133874..134593
                     /locus_tag="PPUBIRD1_RS00625"
                     /old_locus_tag="PPUBIRD1_0128"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_003253046.1"
                     /translation="MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELF
                     KKLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAI
                     EYAVMALKVHHIIICGHSDCGAMRAVLNPQSLTKMPTVGAWLRHAEVARTVVENNCSC
                     GSEHETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAAS
                     DSFLPLAAGEPVPCATPRGRY"
     gene            134786..136318
                     /locus_tag="PPUBIRD1_RS00630"
                     /old_locus_tag="PPUBIRD1_0129"
     CDS             134786..136318
                     /locus_tag="PPUBIRD1_RS00630"
                     /old_locus_tag="PPUBIRD1_0129"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SulP family inorganic anion transporter"
                     /protein_id="WP_014589240.1"
                     /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLI
                     TGIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGR
                     LRLGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLEFPATLSAAL
                     PQESTGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVN
                     RVQVPADLSEAIDWLSPADLMQLADPALLVAAFALAFIASAETLLSAAAVDRMHSGQR
                     SDFDRELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVV
                     ALSSVLQQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLL
                     TGVLLGFALTLLKLAFKAARLKINLVSLDKDGHMELRLSGAATFLKVPALTQVLDTVP
                     PGTTLHVPLGNLSYIDHSCLELLEDWSRSNSANGSRLLIEQRRLKRRIEGRLRTTAGV
                     GA"
     gene            complement(136296..136511)
                     /locus_tag="PPUBIRD1_RS26815"
     CDS             complement(136296..136511)
                     /locus_tag="PPUBIRD1_RS26815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014592316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_085983372.1"
                     /translation="MPVASTGCRAGSAGLIYLSRRRCIGGSPQPVVGAGLPAKGPALL
                     ANLHPPFTVAATTVFAGKPAPMPQPPL"
     gene            complement(136466..137107)
                     /locus_tag="PPUBIRD1_RS00635"
                     /old_locus_tag="PPUBIRD1_0130"
     CDS             complement(136466..137107)
                     /locus_tag="PPUBIRD1_RS00635"
                     /old_locus_tag="PPUBIRD1_0130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019694461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253042.1"
                     /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQD
                     AQGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHV
                     GLDCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEV
                     VHHSVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
     gene            137477..138604
                     /gene="coxB"
                     /locus_tag="PPUBIRD1_RS00640"
                     /old_locus_tag="PPUBIRD1_0131"
     CDS             137477..138604
                     /gene="coxB"
                     /locus_tag="PPUBIRD1_RS00640"
                     /old_locus_tag="PPUBIRD1_0131"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253039.1"
                     /note="cytochrome c oxidase, subunit II; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="WP_014589241.1"
                     /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHM
                     TIFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVVMAI
                     PATKTLIDIYDASESDIDVQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDE
                     HYLLEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWARIEKPG
                     IYRGQCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVE
                     RGDKVYHTACVACHQAEGQGLPPMFPALKGSKIATGPKEDHLSIVFHGKPGTAMAAFG
                     KQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
     gene            138648..140237
                     /gene="ctaD"
                     /locus_tag="PPUBIRD1_RS00645"
                     /old_locus_tag="PPUBIRD1_0132"
     CDS             138648..140237
                     /gene="ctaD"
                     /locus_tag="PPUBIRD1_RS00645"
                     /old_locus_tag="PPUBIRD1_0132"
                     /EC_number="1.9.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009683607.1"
                     /note="cytochrome c oxidase, subunit I; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="WP_014589242.1"
                     /translation="MSAVIDDHAHGHDHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFI
                     MFLLGGSFAMVIRAELFQPGLQIVEPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIP
                     LMVGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASV
                     TFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPV
                     LAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIP
                     AFSRKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGV
                     KVFNWVSTMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAH
                     FHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNMAFFPMHFVGLA
                     GMPRRIPDYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEG
                     LEWSIPSPAPYHTFQTPPEVK"
     gene            140247..140813
                     /locus_tag="PPUBIRD1_RS00650"
                     /old_locus_tag="PPUBIRD1_0133"
     CDS             140247..140813
                     /locus_tag="PPUBIRD1_RS00650"
                     /old_locus_tag="PPUBIRD1_0133"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589243.1"
                     /note="cytochrome C oxidase assembly protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase assembly protein"
                     /protein_id="WP_014589243.1"
                     /translation="MNGLSVKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKT
                     GGQYEGSQISDPTRAVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFIAHNPTD
                     RPMSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHL
                     TLAYTLFDITARHPPVAHVAAQDVQGAR"
     gene            140830..141717
                     /locus_tag="PPUBIRD1_RS00655"
                     /old_locus_tag="PPUBIRD1_0134"
     CDS             140830..141717
                     /locus_tag="PPUBIRD1_RS00655"
                     /old_locus_tag="PPUBIRD1_0134"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_248798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit 3"
                     /protein_id="WP_011953141.1"
                     /translation="MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDS
                     HGPLIFFVGALFLAYMLFGWFGAVVKESHAGLYSPQLDRSFRWGMSWFIFSEVMFFLA
                     FFGALFYVRVLAGPWLGGEGAKGVTHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWH
                     LPLINTILLVSSSVTITIAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYT
                     KLGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASW
                     YWHFVDVVWVGLFIFVYVL"
     gene            complement(141750..141953)
                     /locus_tag="PPUBIRD1_RS00660"
     CDS             complement(141750..141953)
                     /locus_tag="PPUBIRD1_RS00660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2909 domain-containing protein"
                     /protein_id="WP_020191169.1"
                     /translation="MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTIRVTL
                     AALTIGLVAWGLISGQLVSHAPF"
     gene            142005..142742
                     /locus_tag="PPUBIRD1_RS00665"
                     /old_locus_tag="PPUBIRD1_0135"
     CDS             142005..142742
                     /locus_tag="PPUBIRD1_RS00665"
                     /old_locus_tag="PPUBIRD1_0135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SURF1 family protein"
                     /protein_id="WP_014589244.1"
                     /translation="MRPFRPGWVPTLAVLALLPGLIALGCWQLGRAEEKRVLLATYAE
                     RRIEAPIATAQLLSKEDNAFRRVHLYGRFDAEHSVLLDNRMRDGKPGVELLQPFHDQA
                     SGLWLLINRGWLPWLDRRVPVHFETPAQALALDASVYVAPGSTFQLHPDPIGGQWPHL
                     LTAIDAALLWQQLDREGFAQELRLEPGPASYRLDWPVVAMSPEKHVGYAVQWFALATA
                     LVLLYLYFGWHQNKEKRHGHRHSTGRA"
     gene            142711..143292
                     /locus_tag="PPUBIRD1_RS00670"
                     /old_locus_tag="PPUBIRD1_0136"
     CDS             142711..143292
                     /locus_tag="PPUBIRD1_RS00670"
                     /old_locus_tag="PPUBIRD1_0136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589245.1"
                     /translation="MATATPLDVPERSKPRARGRLQLLLILLVVLGPMVLATSMYKLK
                     FWVPEGRSYHGAMIGNGESRADLGVAGQGERWQLLVSAPQACTEDCQRLVYLARQIQI
                     GLGRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVVEPGPQLWIV
                     DPHGNLVLRYDGKVNGKHVLDDLRHLLKLSNIG"
     gene            143302..144381
                     /locus_tag="PPUBIRD1_RS00675"
                     /old_locus_tag="PPUBIRD1_0137"
     CDS             143302..144381
                     /locus_tag="PPUBIRD1_RS00675"
                     /old_locus_tag="PPUBIRD1_0137"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b561"
                     /protein_id="WP_014589246.1"
                     /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGF
                     ISVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARD
                     GQPYRLPMLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRA
                     FAPLPKLPLSLRRIAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGRWWPAADFS
                     NGFHLTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLAR
                     LVLLALALQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDKVQVGVG
                     HGWRLRPVVGVGISHHMRNDSWRRF"
     gene            144366..145259
                     /locus_tag="PPUBIRD1_RS00680"
                     /old_locus_tag="PPUBIRD1_0138"
     CDS             144366..145259
                     /locus_tag="PPUBIRD1_RS00680"
                     /old_locus_tag="PPUBIRD1_0138"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011531519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_014589247.1"
                     /translation="MATLLSVRRARWRDYLELTKPKVVVLMLITSLAGMFLATRAGVS
                     WSVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALAL
                     ALLGMVLLLVFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGW
                     VAVSGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHI
                     LLYTLILLAVSLLPYAIHMSGPLYLACALGLGLRFLRWAWVLYRSSRPHAAIGTFKYS
                     IGYLFALFIALLLDHYLLLSL"
     gene            145256..145888
                     /locus_tag="PPUBIRD1_RS00685"
                     /old_locus_tag="PPUBIRD1_0139"
     CDS             145256..145888
                     /locus_tag="PPUBIRD1_RS00685"
                     /old_locus_tag="PPUBIRD1_0139"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SCO family protein"
                     /protein_id="WP_003253019.1"
                     /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGII
                     LLPQSRAVADVTMTNQDGQPVQMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSEL
                     PKDAVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFI
                     PADTSKPGYTVDHSGNLAIVGPDGRQRGFIRAPFNNQKLGAQLPGLVKRD"
     gene            complement(145982..146752)
                     /locus_tag="PPUBIRD1_RS00690"
                     /old_locus_tag="PPUBIRD1_0140"
     CDS             complement(145982..146752)
                     /locus_tag="PPUBIRD1_RS00690"
                     /old_locus_tag="PPUBIRD1_0140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_254192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589248.1"
                     /translation="MKKLLAVAAAVAAFSAQADTLTVAATPVPHAEILNFVKPQLAKE
                     GVELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTQLVSVAGVHIEPLG
                     VYSTKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAEN
                     PKNVKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVA
                     RPDNKDSDDMKKLAAALHSPEVKQFIIDKYKGAVVPAF"
     gene            complement(146817..147488)
                     /locus_tag="PPUBIRD1_RS00695"
                     /old_locus_tag="PPUBIRD1_0141"
     CDS             complement(146817..147488)
                     /locus_tag="PPUBIRD1_RS00695"
                     /old_locus_tag="PPUBIRD1_0141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019472428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010951513.1"
                     /translation="MDALNFFANVDWAEIWLATVDTMIMLFGSLFFTVLLGLPLGVLL
                     FLCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPL
                     VVGATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTA
                     ITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVV
                     HFSRK"
     gene            complement(147488..148495)
                     /locus_tag="PPUBIRD1_RS00700"
                     /old_locus_tag="PPUBIRD1_0142"
     CDS             complement(147488..148495)
                     /locus_tag="PPUBIRD1_RS00700"
                     /old_locus_tag="PPUBIRD1_0142"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016986453.1"
                     /note="Methionine import ATP-binding protein metN1;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine import ATP-binding protein MetN 1"
                     /protein_id="WP_014589249.1"
                     /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGK
                     STMLRLINRLEEPSGGTIVVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADN
                     VALPLALAGELSRSEIDKRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNP
                     KILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAG
                     QIVEQGSVAEVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYA
                     PLLGTVARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVL
                     R"
     gene            148723..150858
                     /locus_tag="PPUBIRD1_RS00705"
                     /old_locus_tag="PPUBIRD1_0143"
     CDS             148723..150858
                     /locus_tag="PPUBIRD1_RS00705"
                     /old_locus_tag="PPUBIRD1_0143"
                     /EC_number="1.11.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009401730.1"
                     /note="Catalase HPII; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase HPII"
                     /protein_id="WP_014589250.1"
                     /translation="MPSKKTDAPKHSEAAGTQTPDRANTNVKLQSLEADRSDATGQAL
                     RTNQGVRIADNQNSLKAGDRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFF
                     QSYGNHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNF
                     DLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVM
                     WAMSDRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPRQGVHSLLWDEAQKLAG
                     KDTDFQRRDLWEAIETGDYPEWELGVQIVPEADEHKFDFDLLDPTKIIPEELVPVTPL
                     GKMVLNRNPDNFFAEVEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNF
                     HQIPINRPVAPNHNNQRDALHQHVVHKGRASYEPNSIDGGWPKETPPAAQDGGFESYQ
                     ERIDAHKIRQRSESFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREHIRAREV
                     NEILANIDLKLAAAVAANLGLPAPKAGTVQVKGSQLAQSPALSQMNHPGSVGIKGRKI
                     AVLVADGVDAASVDKLVKALEAHSARPMLLGPTSAPVKAADGKQLPVAASMEGMPSIM
                     FDGIIVPAGKASTDALAASGLAKHFVLEGYKHLKALVLTKELAKALGLKEDKGLLLGD
                     EQKAVDAFVKAVEGHRVWEREAAAEAVPA"
     gene            complement(150919..151626)
                     /locus_tag="PPUBIRD1_RS00710"
                     /old_locus_tag="PPUBIRD1_0144"
     CDS             complement(150919..151626)
                     /locus_tag="PPUBIRD1_RS00710"
                     /old_locus_tag="PPUBIRD1_0144"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003256959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589251.1"
                     /translation="MKPFASRYLLVAAFSLILAACSNAPVEQATAPAQADAWQQLQQN
                     IASNELATAEDQLAALQAQSPDDARLEQYQRQLAEAYLQRSQIVLQKGDVNAAATALA
                     RARALMPQAPAVTGGDAVTQARKAELEKAEAALKAAEAKPEARIIDPTAPSTVVALKT
                     TDSRALRRQLDDIAADVVSYQCEVVFQVPRTEDAPWLKTLLEKRVRKIDSGFELKQKH
                     EIQRSLPAQVVLVPHQQ"
     gene            complement(151753..152536)
                     /locus_tag="PPUBIRD1_RS00715"
                     /old_locus_tag="PPUBIRD1_0145"
                     /pseudo
     CDS             complement(151753..152536)
                     /locus_tag="PPUBIRD1_RS00715"
                     /old_locus_tag="PPUBIRD1_0145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003196213.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter permease"
     gene            complement(152529..153302)
                     /locus_tag="PPUBIRD1_RS00720"
                     /old_locus_tag="PPUBIRD1_0146"
     CDS             complement(152529..153302)
                     /locus_tag="PPUBIRD1_RS00720"
                     /old_locus_tag="PPUBIRD1_0146"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017849021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc import ATP-binding protein ZnuC"
                     /protein_id="WP_003253004.1"
                     /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGK
                     TTLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAA
                     LSALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTEL
                     YNLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELF
                     GKTAPSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
     gene            complement(153299..153784)
                     /locus_tag="PPUBIRD1_RS00725"
                     /old_locus_tag="PPUBIRD1_0147"
     CDS             complement(153299..153784)
                     /locus_tag="PPUBIRD1_RS00725"
                     /old_locus_tag="PPUBIRD1_0147"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor"
                     /protein_id="WP_003253002.1"
                     /translation="MSITPLANRPHDHSHCVHSALAEADALCTRQGLRLTALRRRVLE
                     LVWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSH
                     PEHVHQGQFLICRACHVAIELEQSSISEAIINSAKGVGFTVETQTVEVVGLCGNCRSA
                     A"
     gene            153851..154759
                     /locus_tag="PPUBIRD1_RS00730"
                     /old_locus_tag="PPUBIRD1_0148"
     CDS             153851..154759
                     /locus_tag="PPUBIRD1_RS00730"
                     /old_locus_tag="PPUBIRD1_0148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016394240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_041166811.1"
                     /translation="MSRFLALFVAFIALSAQADVRVLTTIKPLQQIAAAVQEGVGSPD
                     VLLPPGASPHHYALRPSDVRRVGDADLLYWIGPDMENFLARVLGSRSKATVAVQSLPG
                     MKLRHFGEDSHSHNEEDHDDHDHDHRPGSLDAHLWLSSVNARVIAAKMAADLAHVDPA
                     NAARYQSNLKAFDERLDALDGRIKARVTGIAGKPYFVFHEAFDYFEAEYGLKHAGVFS
                     VASEVQPGAQHVAAMRKRLQEVGKTCVFSEPPLRPRLAETLTAGLPVRLAELDALGGT
                     DPVDGKGYERLLEKLGGDLAGCLEQL"
     gene            complement(154869..155819)
                     /locus_tag="PPUBIRD1_RS00735"
                     /old_locus_tag="PPUBIRD1_0149"
     CDS             complement(154869..155819)
                     /locus_tag="PPUBIRD1_RS00735"
                     /old_locus_tag="PPUBIRD1_0149"
                     /EC_number="2.7.1.39"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009683590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_014589254.1"
                     /translation="MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLE
                     QGEFVLTLIERGPSEDMPFFIELLDTLHGADMPVPYAIRDRDGNGLRELCGKPALLQP
                     RLSGKHIKAPNNQHCAQVGELLAHIHLATREHIIERRTDRGLDWMLASGAELLPRLTA
                     EQAALLQPALEEISAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPM
                     LYDIAITVNDWCLDEQGAVDVPRAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWL
                     SRLIAAESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
     gene            complement(155889..156176)
                     /locus_tag="PPUBIRD1_RS00740"
                     /old_locus_tag="PPUBIRD1_0150"
     CDS             complement(155889..156176)
                     /locus_tag="PPUBIRD1_RS00740"
                     /old_locus_tag="PPUBIRD1_0150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003177138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951520.1"
                     /translation="MRTLNRLLLLGLLATMPVVTLAADDAPSADPEVTIRTEGDKTIQ
                     EYRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
     gene            156252..158999
                     /locus_tag="PPUBIRD1_RS00745"
                     /old_locus_tag="PPUBIRD1_0151"
     CDS             156252..158999
                     /locus_tag="PPUBIRD1_RS00745"
                     /old_locus_tag="PPUBIRD1_0151"
                     /EC_number="2.7.7.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_014589255.1"
                     /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLK
                     SLRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQIEPLHASVKALGYP
                     LLCVEGVEADDVIGTLARSSAALGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVA
                     GVHEKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDK
                     VPTLAIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVEALVCGEPDREALLAL
                     YTEMEFKSWVAEVQRDAAKAGDDVAPAVEPAAKVEPKYETILDQARFDAWLEKLRQAP
                     LFAFDTETTGLDAQQAQLVGLSFAVEPHEAAYVPLAHDYEGAPAQLDREAVLLALKPL
                     LEDPAKAKVGQNAKYDINILANGSPAIEMRGVAYDTMLESYVLNSTATRHDMDSLAQK
                     YLDHTTIAFEDIAGKGAKQLTFNQINLDKAGPYAAEDADITLRLHDALQARLAQTPSV
                     QPVLMDIEMPLVPVLARIERQGALVDAELLKVQSGELGVKMAELELRAYELAGETFNL
                     GSPKQLGTILYDKLGMPVLSKTAKGQPSTAEAVLDELALQGYPLPEVLMQYRSLSKLK
                     STYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIA
                     SPGYKLLAADYSQIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALEDVTTDQ
                     RRSAKAINFGLIYGMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAE
                     QGFVETLFGRRLYLPDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVKVDNWLSE
                     SGLDARVILQVHDELVLEVREDLVQQVKDEIRQHMSQAAQLDVPLLVEAGVGANWDEA
                     H"
     gene            complement(159545..160177)
                     /locus_tag="PPUBIRD1_RS00750"
                     /old_locus_tag="PPUBIRD1_0152"
     CDS             complement(159545..160177)
                     /locus_tag="PPUBIRD1_RS00750"
                     /old_locus_tag="PPUBIRD1_0152"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein"
                     /protein_id="WP_010951522.1"
                     /translation="MQVKNPILGLCQKAKFALSAAKVEQCPDDQGYEVAFAGRSNAGK
                     SSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKH
                     LEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGK
                     NTLLKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLADWMELEDKPVV"
     gene            160379..160681
                     /locus_tag="PPUBIRD1_RS00755"
                     /old_locus_tag="PPUBIRD1_0153"
     CDS             160379..160681
                     /locus_tag="PPUBIRD1_RS00755"
                     /old_locus_tag="PPUBIRD1_0153"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016712845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c5 family protein"
                     /protein_id="WP_003252992.1"
                     /translation="MAKWLLAVGMFLPFFSAQATQDPEVLYNRTCAACHTGQLPQAPR
                     RGDRAAWEPRLAQGMDVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
     gene            160713..161330
                     /locus_tag="PPUBIRD1_RS00760"
                     /old_locus_tag="PPUBIRD1_0154"
     CDS             160713..161330
                     /locus_tag="PPUBIRD1_RS00760"
                     /old_locus_tag="PPUBIRD1_0154"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003256951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="WP_003252989.1"
                     /translation="MNKLVVSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNP
                     DGNSLAPNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLAAFSDQDLADIAAYFSS
                     QKGSVGAADPKLVERGRALFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQY
                     VAKQLTDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
     gene            161482..162114
                     /locus_tag="PPUBIRD1_RS00765"
                     /old_locus_tag="PPUBIRD1_0155"
     CDS             161482..162114
                     /locus_tag="PPUBIRD1_RS00765"
                     /old_locus_tag="PPUBIRD1_0155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222617.1"
                     /note="DSBA oxidoreductase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_014589257.1"
                     /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYIELSNPVPVSVP
                     GKIEVVELFWYGCPHCYHFEPTINPWAEKLPKDVNFKRVPAMFGGPWDAHGQMFLTLE
                     AMGVEHKVHAAVFDAIQNQHKRLTDKNDMADFLATQGVDKDKFLATFDSFAIQGQVKQ
                     AKELAKKYEITGVPSMVVNGKYRFDLGTAGGPEGVLNVADQLIDKERAAK"
     gene            162127..162981
                     /locus_tag="PPUBIRD1_RS00770"
                     /old_locus_tag="PPUBIRD1_0156"
     CDS             162127..162981
                     /locus_tag="PPUBIRD1_RS00770"
                     /old_locus_tag="PPUBIRD1_0156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_014589258.1"
                     /translation="MPRFRATRGIGLHEPQVNEHHLQAPGLPEDGRLRLLSFNIQVGI
                     STERYRHYLTRSWQHLLPHNGRAVNLQKIGRLLGDFDLVALQEADGGSLRSGYVNQVE
                     HLAHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQLLEDHPLPGPAGRGAILVRFGE
                     GEDALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDL
                     GLVAPQVEATFPSWRPQRCLDHILLSSSLTLERVEVLAQPISDHLPVAVEIRLPDALT
                     VDTLPVLS"
     gene            163009..164946
                     /locus_tag="PPUBIRD1_RS00775"
                     /old_locus_tag="PPUBIRD1_0157"
     CDS             163009..164946
                     /locus_tag="PPUBIRD1_RS00775"
                     /old_locus_tag="PPUBIRD1_0157"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_014589259.1"
                     /translation="MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAA
                     EGSDKVVDECMKEMRDVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMHQVSDALTA
                     LVGQLQSLPLPSDISRPLKKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKSGE
                     EARPGFLQRLFGSREEDAQAGAALAPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPA
                     PAAPAAEVAEAPELELEAFGPALIETAEMPPAPLPRDKSPLPEAAVSASEPLAEAEPL
                     QALEVTFGEDGPYALPYAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERV
                     ARGLNWYELIPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHAD
                     NSTAARELDSQLREHVDGLQSSMQGAADVDSLKHILENRLEGLLVTMDEHKHERDRRE
                     QELAGRLQGLSERVASMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSERVEREML
                     DWQENGGHLAMAILDLDHFKRINDNYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGE
                     EFVLLLPQTTPAVAAQVAEVLRATVEACPFHFKGERVVITTSIGLSAFRSGERSDQVL
                     KRADAALYRAKELGRNRVEHG"
     gene            165020..165808
                     /locus_tag="PPUBIRD1_RS00780"
                     /old_locus_tag="PPUBIRD1_0158"
     CDS             165020..165808
                     /locus_tag="PPUBIRD1_RS00780"
                     /old_locus_tag="PPUBIRD1_0158"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014861523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011953154.1"
                     /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVL
                     HYTNASLERSLALLTQGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNS
                     SSIGIEIVNPGFTDTPNGRVWHPYSEAQIQSLIALLKDIVKRNNIEPRHIIGHSDIAP
                     LRKLDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSVGWYQQELARFGYQIE
                     QTGVLDVATRHVIAAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
     gene            166012..167610
                     /locus_tag="PPUBIRD1_RS00785"
                     /old_locus_tag="PPUBIRD1_0159"
     CDS             166012..167610
                     /locus_tag="PPUBIRD1_RS00785"
                     /old_locus_tag="PPUBIRD1_0159"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014589260.1"
                     /translation="MSAFIALLRQIFYRPWMLATLAALASAAVLLSASIGIALQQMKQ
                     SESEQMNAQGERFLERLEQVFGQLREGVDLLQAQPLRGCNPAMLAALQQVGLNSRFIY
                     EAAYVDGNVACSNRGDERAFVPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGKFL
                     VSTSRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSD
                     RLIYRMPTKSPDYQLVLIAPRASLPLKMNGMLWLLFPGSVLAACCIGWLVLQLILQRR
                     SMSSELQNALRRGELQVLYQPIIELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAEN
                     TGQIRQITDFVLQRVLEQLGQLLRSHPKLYISINLAACDVMVPRIGRVAARLLALHRV
                     APSQIAFEVTERGLIDVVVARDNLQALRAVGHQVLIDDFGTGYCSLAYLQTLPVDCLK
                     IDKAFIDALGHDAASSGVAPHIIRMAHDLHLRVIAEGIEFEDQAVLLNSEGVNYGQGW
                     LFARPLNARQFAELVTRGHLPRRV"
     gene            complement(167625..169406)
                     /locus_tag="PPUBIRD1_RS00790"
                     /old_locus_tag="PPUBIRD1_0160"
     CDS             complement(167625..169406)
                     /locus_tag="PPUBIRD1_RS00790"
                     /old_locus_tag="PPUBIRD1_0160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing sensor histidine kinase"
                     /protein_id="WP_041166812.1"
                     /translation="MKWPPMKLRTRLFLSISALITVALLGLLLGLVSMLQMATVQQQL
                     VRDTTHALEVGLKLRQNLGEQLMLILNEDTAPESLRLLQESFQDLLNQGLEQGGERTG
                     FSKASSNYQAFLQTYRDSAAPARSMGVDQPLGAAFNQVRTDLIDSHKHALDLITRSEE
                     RTRDRALLVSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAKAADQLGKGDFDVTL
                     PVAQAAELNQLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQG
                     RLEHLNPVAQRQLGWNDSRVGSSLVEALQRPELEQQLRQVLRGGSLDRPPDDLNMEVD
                     EESRLLTYSLTPVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGM
                     HMAFGLLRERVKFPPEARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLELAPC
                     AIDDLLEHAQLRFAEQAAHKQIELIKELDPPLPRIQADVAQLDRVLDNLLHNAIRHTA
                     NGGRIRLHARRHAERVIISVEDNGEGISYGQQARIFEPFVQVGRKKGGAGLGLALCKE
                     IVQLHGGRMGVFSRPGQGTQFYMALPV"
     gene            complement(169403..170749)
                     /locus_tag="PPUBIRD1_RS00795"
                     /old_locus_tag="PPUBIRD1_0161"
     CDS             complement(169403..170749)
                     /locus_tag="PPUBIRD1_RS00795"
                     /old_locus_tag="PPUBIRD1_0161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019409264.1"
                     /note="Alginate biosynthesis transcriptional regulatory
                     protein algB; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_014589262.1"
                     /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQA
                     ETLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAG
                     AADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMMAVLET
                     ARQVAITDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFG
                     HTRGAFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVT
                     RRADVRILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILILADRFLA
                     RFVKEYSRPARGFSDEARTALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGE
                     QPAGNAPRVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
     gene            170960..171781
                     /locus_tag="PPUBIRD1_RS00800"
                     /old_locus_tag="PPUBIRD1_0162"
     CDS             170960..171781
                     /locus_tag="PPUBIRD1_RS00800"
                     /old_locus_tag="PPUBIRD1_0162"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014589263.1"
                     /translation="MPFSLRTAVLAATLLPIFTPAFADPVQDARLEGALQTALSMNRM
                     LDSFRINVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENLLQLNTQLVERPL
                     ELRAYAQRLEDVTLAAVIRARLLWSRTTEKAPIEVQSSEGVVTLRGKVDSAEAKELAG
                     VVARTTDGVYLVNNLVSLDTAAMAKARETPAGALTGPQPSDSWIVDKIQSSYRFSRNL
                     DGLNLKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVATKVEG"
     gene            171956..172246
                     /locus_tag="PPUBIRD1_RS00805"
                     /old_locus_tag="PPUBIRD1_0163"
     CDS             171956..172246
                     /locus_tag="PPUBIRD1_RS00805"
                     /old_locus_tag="PPUBIRD1_0163"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589264.1"
                     /translation="MNRQSVNRSQSAALPLRQMLTLGMAMLLTLAAGLFYYSLQTARL
                     AEQVAAQTALLTQIQATRANTLVKAADWQPAGQAIASPATVEKFVPQERWVF"
     gene            172290..172451
                     /locus_tag="PPUBIRD1_RS25970"
     CDS             172290..172451
                     /locus_tag="PPUBIRD1_RS25970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009041538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1328 domain-containing protein"
                     /protein_id="WP_003252966.1"
                     /translation="MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVA
                     SFFFGRGRG"
     gene            172454..172924
                     /locus_tag="PPUBIRD1_RS00815"
                     /old_locus_tag="PPUBIRD1_0165"
     CDS             172454..172924
                     /locus_tag="PPUBIRD1_RS00815"
                     /old_locus_tag="PPUBIRD1_0165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951530.1"
                     /translation="MSRKLRSAVVAALLLGGSAAAMAANDGQVRVDQLLGSDPEYRET
                     WQDTLEGEERLPDWVVNLTGSSQQQMSAVTEDGDKYLVGPLCEKQDNCTYKRLIVAFS
                     WDKDDAYGMLVEVPEGLPSDKSPTRHAQYRWLGEPDDGMKAMLQEQLKRDPNWY"
     gene            173670..174998
                     /locus_tag="PPUBIRD1_RS00820"
                     /old_locus_tag="PPUBIRD1_0166"
     CDS             173670..174998
                     /locus_tag="PPUBIRD1_RS00820"
                     /old_locus_tag="PPUBIRD1_0166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate:proton symporter GltP"
                     /protein_id="WP_010951531.1"
                     /translation="MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPA
                     GDIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVL
                     ANLFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEML
                     PIIFFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTV
                     ANFGFSSLLPLAKLVVLVYFAIAFFAFMVLGLVARLFGFSVIKIMRIMKDELILAYST
                     SSSETVLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDL
                     SWSQQLLLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIMDMAR
                     TALNVVGNALAALVIARWEGMYDAVKGEQYYASLMAEKQGAVVVGETAKR"
     gene            175146..176375
                     /locus_tag="PPUBIRD1_RS00825"
                     /old_locus_tag="PPUBIRD1_0167"
     CDS             175146..176375
                     /locus_tag="PPUBIRD1_RS00825"
                     /old_locus_tag="PPUBIRD1_0167"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009683573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589267.1"
                     /translation="MLNGLWLGFFLVAAVSAMAQWLVGGNAGIFAAMVESIFAMAKLS
                     VEVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHQALGLITMN
                     FAANGLGLDNAATPIGLKAMRALQELNPSSTTASNAQILFLVLNASSLTLLPVTVFMY
                     RAQQGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGF
                     MAFLGTLSAAALGSLSSLLGNLTLFGVIMLFLVVGALKRVKVYEAFVEGATEGFDVAK
                     NLLPYLVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSA
                     ARAMLIETMQTQGVDSFAALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLA
                     EFSGVVAAIFVCYWFFA"
     gene            complement(176357..176992)
                     /locus_tag="PPUBIRD1_RS00830"
                     /old_locus_tag="PPUBIRD1_0168"
     CDS             complement(176357..176992)
                     /locus_tag="PPUBIRD1_RS00830"
                     /old_locus_tag="PPUBIRD1_0168"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589268.1"
                     /translation="MNPSLRLLTLAASLSLASACSILPQSEPVDLYRLPVNQPSRTAP
                     PLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGARWSDAAPVLLRNRLLDGFQRE
                     GQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVVIRYDARLVQGRNQRILASK
                     RFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTITQANQAQLKLQAKNQ"
     gene            complement(176989..177927)
                     /locus_tag="PPUBIRD1_RS00835"
                     /old_locus_tag="PPUBIRD1_0169"
     CDS             complement(176989..177927)
                     /locus_tag="PPUBIRD1_RS00835"
                     /old_locus_tag="PPUBIRD1_0169"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="WP_010951534.1"
                     /translation="METRAHHVLIGLVTVLVVTGAMLFGLWLAKSSVDDAFKDYEVVF
                     NEAVSGLSPGSTVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTL
                     AGVTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINMLLHN
                     ANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAIAQLVQVGKQASATLAETQAL
                     MRNANGLLDSEGKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAI
                     RELRETLNALKGISRQLEADPSGYLLGRDNNKEFQP"
     gene            complement(177931..178722)
                     /locus_tag="PPUBIRD1_RS00840"
                     /old_locus_tag="PPUBIRD1_0170"
     CDS             complement(177931..178722)
                     /locus_tag="PPUBIRD1_RS00840"
                     /old_locus_tag="PPUBIRD1_0170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_014589269.1"
                     /translation="MSGQDCVIEARGICNRFGRQVVHENLDLDLYRGEILAVVGGSGS
                     GKSVLLRSIIGLRRPNEGQIKVLGQDLTGLRDEQRSLVERRFGVLFQKGALFSSLTVT
                     ENVALPLIEHAGLSRSDAEHLAGVKLALAGLPISAADKYPASLSGGMIKRAALARALA
                     LDPDILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVL
                     SQKKVLVAGPLAEVEKTNDTWIQEYFHGPRGRAAEQAATRAGQER"
     gene            complement(178719..179852)
                     /locus_tag="PPUBIRD1_RS00845"
                     /old_locus_tag="PPUBIRD1_0171"
     CDS             complement(178719..179852)
                     /locus_tag="PPUBIRD1_RS00845"
                     /old_locus_tag="PPUBIRD1_0171"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008092048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041166813.1"
                     /translation="MEPMTTPSATLDASSQPACLRITGDWTLAHYASLKRESERLRSQ
                     CPADTVADLSQLGRLDTAGASLLAELLGSERLSRCTHALPEASQALLKNVYCSVQDYC
                     IPVKEPERNVLLLLLERIGRAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPV
                     VAHIEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVL
                     LTAILMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTF
                     VAMICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCL
                     EGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
     gene            complement(179984..181009)
                     /locus_tag="PPUBIRD1_RS00850"
                     /old_locus_tag="PPUBIRD1_0172"
     CDS             complement(179984..181009)
                     /locus_tag="PPUBIRD1_RS00850"
                     /old_locus_tag="PPUBIRD1_0172"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589271.1"
                     /translation="MPQIPHIVQRVIELLKRYPGIIALGGFLSGIGSFILVDRQAGLA
                     SWVAVLMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFI
                     TTTWNSGQLVFTGLLGAAGLVSIIDPLYYKWLAPRRWLFLALHTLTLFAALLTALPII
                     LHLTTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVLVTLSVGGGGWLLRSWVP
                     PATLWMTEVAVSTEVLNRQPGDSLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQ
                     KDGQEVDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVV
                     NDAPAGS"
     gene            complement(181103..182509)
                     /locus_tag="PPUBIRD1_RS00855"
                     /old_locus_tag="PPUBIRD1_0173"
     CDS             complement(181103..182509)
                     /locus_tag="PPUBIRD1_RS00855"
                     /old_locus_tag="PPUBIRD1_0173"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_014589272.1"
                     /translation="MRCLMFVCLLICSLPSFALDRSRVEGYLLPNGLQVILKNGYERD
                     HVAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDETGEGGLEERLQALGGEWNAYTS
                     SADTTFVIEAPARNQRKVLDLLLAVIRDTTIDAKALATAKRIIEREDGGHYGHLQRWL
                     DRQDIGHPANDQLATELGLKCPERSNLDDMTLAQVQALRDRWYAANNMTLIMVGGLDR
                     LLPAYLERSFGELPATEPEERRNLESITRQAQQRRNLTRGWLGDGVKLHWLFIEPVLD
                     NDHQATLDLLSHYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDK
                     AVKVMQALFDHLRKEGLDPDTFARIKEASIAKESWSTQGNSALADYYWGALNDYTDGR
                     FASPVRKLRQVSLEQANEALKDLLKEDGYVRIEKPLLGYDELYGLMALLVGLCLAAGL
                     LRWRRHGPERPSGATRQQ"
     gene            complement(182540..184198)
                     /locus_tag="PPUBIRD1_RS00860"
                     /old_locus_tag="PPUBIRD1_0174"
     CDS             complement(182540..184198)
                     /locus_tag="PPUBIRD1_RS00860"
                     /old_locus_tag="PPUBIRD1_0174"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_019436588.1"
                     /translation="MLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRIISQNMDKR
                     PLAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTALMARVLTF
                     DLSWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAPITHAQGV
                     KVLFASLTGDIMLDALVGAMFAMISYSSLAAVLLTATLAGAELISLPVAIGLVVGANI
                     GSGLLAFISTSMQNAAGRRVALGSLLYKLIGLVLIIPVLHPLVEWMDSLSFSPQELVI
                     GFHLLYNTLRCLIMLPTVKPMGRLCNVLLPERETGNGQVRPRHLDASALETPSLALAN
                     AARETLRLGDIVDSLLESMLGALRGTQTALPQQVRALGEDAEALYSAIKLYLAQMSRE
                     DLSEQDNRRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQVGLEELTGLQE
                     QLLANLRLGLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVVQSIETSS
                     LHLELIADMKRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARQP"
     gene            complement(184471..185241)
                     /locus_tag="PPUBIRD1_RS00865"
                     /old_locus_tag="PPUBIRD1_0175"
     CDS             complement(184471..185241)
                     /locus_tag="PPUBIRD1_RS00865"
                     /old_locus_tag="PPUBIRD1_0175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008045761.1"
                     /note="integral membrane protein TerC; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589274.1"
                     /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQP
                     RTRIFGLALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSS
                     QEIYHGLEGEDENAEEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVA
                     AIVVAVLVMMLCAGAISNFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFA
                     MAFSLGVEAINIRMRTAMARKDGKDHDPVKLRKDIPGQ"
     gene            complement(185311..186618)
                     /locus_tag="PPUBIRD1_RS00870"
                     /old_locus_tag="PPUBIRD1_0176"
     CDS             complement(185311..186618)
                     /locus_tag="PPUBIRD1_RS00870"
                     /old_locus_tag="PPUBIRD1_0176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_789921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="WP_010951541.1"
                     /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAK
                     IGPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTA
                     VLALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTA
                     RAASALHVDPSDIFVPMIPAMLFGVLAILAIAYMYGKRERARLGELHLPTDDIDHSEI
                     TVSQYPDARRPKLLYFNGALTAALMVALIAGLLPLPVLFMIAFSIAMIVNYPCLQQQK
                     DRIAAHAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAI
                     VSMPFTFFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYL
                     LVALAGIEFGDHQRFTLKWAVLVCLCIMLGALLMGIFPLFSSL"
     gene            186886..187287
                     /locus_tag="PPUBIRD1_RS25975"
                     /old_locus_tag="PPUBIRD1_0177"
     CDS             186886..187287
                     /locus_tag="PPUBIRD1_RS25975"
                     /old_locus_tag="PPUBIRD1_0177"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde-activating protein"
                     /protein_id="WP_080557753.1"
                     /translation="MQDVTEGGCHCGALRYRLEGNLTDIAHCHCSICRRVSGGLVVTW
                     LTLPRSGFQWLTGEPSCYVAPASCSRYFCGQCGAHVALVTTHSPQTIDVTVATLDHPE
                     RVRANRHIWVGSRLPWLHLDEDLPSEDEGRL"
     gene            complement(187326..189281)
                     /locus_tag="PPUBIRD1_RS00875"
                     /old_locus_tag="PPUBIRD1_0178"
     CDS             complement(187326..189281)
                     /locus_tag="PPUBIRD1_RS00875"
                     /old_locus_tag="PPUBIRD1_0178"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589276.1"
                     /translation="MKRVRAWLLGCALTLLGTPALADLQLELQASGLDPQQTQASQAL
                     LDEAMGKLPPHFKQQLDRHVRVSWSDNMPADAYGQASLISTLELNRRLLPSLADGSAA
                     AERTDRPHGTVREELLATVLHELTHLYDRARLWPSAENSLIARCKRQQGTLGKVGLPE
                     ECRGQAERRFTLSDDPRLLDLAGWQQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIA
                     VNMEYFLLDPSYSCRRPALYQYLREHFGWAPQQDTCAKGLPFINAGSDFARQPLGEID
                     PERVYEVDYLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFV
                     NDVQLSSWDGLVGNYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLNRDEIENLVRQA
                     AEMHWSYDGNYWFLSNNCAVESLKLLRSGTANPRLNDLDSIMPNGLLAVLKGRGLADT
                     SVLDNPREALRLGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLALNAEQRRSWFAK
                     ADLRTSAALLLLEQASLRRQLLLAQDEVKQRYLNAAALKDGSINKADATLKQMLANSG
                     FLSRPAELLDSKGYGLPQPEERKHLEQVSRERQAQLLRLSTSLDKEVRALLEPSRAKE
                     IAAVEANVKQIGEHLRALHKAAGGLQL"
     gene            complement(189278..189598)
                     /locus_tag="PPUBIRD1_RS00880"
                     /old_locus_tag="PPUBIRD1_0179"
     CDS             complement(189278..189598)
                     /locus_tag="PPUBIRD1_RS00880"
                     /old_locus_tag="PPUBIRD1_0179"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_238088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003252932.1"
                     /translation="MRKPLIAASLGMLLLADLAQAQTLVATSNIIVRAFGRSIDFTSD
                     TTTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFNTLRERVPEARGASDQVLAEA
                     ILAL"
     gene            complement(189635..189928)
                     /locus_tag="PPUBIRD1_RS00885"
                     /old_locus_tag="PPUBIRD1_0180"
     CDS             complement(189635..189928)
                     /locus_tag="PPUBIRD1_RS00885"
                     /old_locus_tag="PPUBIRD1_0180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589277.1"
                     /translation="MRYLLPLLFAAAGMASAHAMDTTTQSLVITGYVTSQVTAAPFDR
                     KLVTQARDDAAAFVASGGLIRGARLEAALESLRHNCARHAVGDLELAQAILVQ"
     gene            complement(190016..190333)
                     /locus_tag="PPUBIRD1_RS00890"
                     /old_locus_tag="PPUBIRD1_0181"
     CDS             complement(190016..190333)
                     /locus_tag="PPUBIRD1_RS00890"
                     /old_locus_tag="PPUBIRD1_0181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589278.1"
                     /translation="MNRKHLLGAALLLGLAGTANATSFVVTTDAVVGAVAASTDATSD
                     VSSSFRDDKIVQAARDDAASFVGTQGAIRGARLESAFVHIRSNMPALQASDAQLAQAI
                     LAL"
     gene            complement(190642..190857)
                     /locus_tag="PPUBIRD1_RS00895"
                     /old_locus_tag="PPUBIRD1_0182"
     CDS             complement(190642..190857)
                     /locus_tag="PPUBIRD1_RS00895"
                     /old_locus_tag="PPUBIRD1_0182"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012269957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003252924.1"
                     /translation="MERTLSSGLVFESNAQQSNTSLPLRALSTLLLWQRRMTSRRQLA
                     RLDSRLLADAGISESQRYEELSKPFWR"
     gene            complement(191231..192724)
                     /locus_tag="PPUBIRD1_RS00900"
                     /old_locus_tag="PPUBIRD1_0183"
     CDS             complement(191231..192724)
                     /locus_tag="PPUBIRD1_RS00900"
                     /old_locus_tag="PPUBIRD1_0183"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003256967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA hydrolase"
                     /protein_id="WP_003252922.1"
                     /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKA
                     VPHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQ
                     VMFIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQV
                     IVEINLSHNTNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISD
                     QPDSPSTVLPPDDETQGIADHLINFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLI
                     ESPFEDLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSTRRNADVFGNLERYKDKLVL
                     RPQEISNHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHL
                     AVFVTKSIAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDN
                     CVHPDYRAALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
     gene            complement(192911..194347)
                     /locus_tag="PPUBIRD1_RS00905"
                     /old_locus_tag="PPUBIRD1_0184"
     CDS             complement(192911..194347)
                     /locus_tag="PPUBIRD1_RS00905"
                     /old_locus_tag="PPUBIRD1_0184"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013717800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_003252919.1"
                     /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLA
                     ILTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGAPVQFAGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLVLAFIMGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGGDTDTGAAQGSQEQRPVKSGSADDATFLLSNADSVIIVPGYGLAV
                     ARAQHALKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINA
                     EFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     gene            complement(194350..194664)
                     /locus_tag="PPUBIRD1_RS00910"
                     /old_locus_tag="PPUBIRD1_0185"
     CDS             complement(194350..194664)
                     /locus_tag="PPUBIRD1_RS00910"
                     /old_locus_tag="PPUBIRD1_0185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003252914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)(+) transhydrogenase"
                     /protein_id="WP_003252914.1"
                     /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNA
                     ISAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKTKNEA
                     KK"
     gene            complement(194676..195797)
                     /locus_tag="PPUBIRD1_RS00915"
                     /old_locus_tag="PPUBIRD1_0186"
     CDS             complement(194676..195797)
                     /locus_tag="PPUBIRD1_RS00915"
                     /old_locus_tag="PPUBIRD1_0186"
                     /EC_number="1.6.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_014589279.1"
                     /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAA
                     IPDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLVGMLNPFNGELIG
                     KMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHHYPRFMPMLMTAAG
                     TVKAARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETD
                     EERECAEGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSAETV
                     AQMKPGSVVIDLAAAQGGNCPLTVADQVVQENGVTIVGPTNLPAQVSADASALYARNL
                     LDFMKLLFDKDGALIINLEDDIVAACLMCRDGQVVRKNG"
     gene            complement(196217..197134)
                     /locus_tag="PPUBIRD1_RS00920"
                     /old_locus_tag="PPUBIRD1_0187"
     CDS             complement(196217..197134)
                     /locus_tag="PPUBIRD1_RS00920"
                     /old_locus_tag="PPUBIRD1_0187"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012269961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589280.1"
                     /translation="MRRKIPSTAALICFEAAARNESFTKAAQELALTQGAVCRQIGGL
                     EAFLNVELFRRSRRGVRLTEAGLSYSRQVAAQLDAVERDTLSVMRQQGANVIELAVVP
                     TFGTQWLLPRLKDFQQCHPEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHQL
                     MGENPVPVCSPALLNDQGMLEARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGP
                     RYELFSMLAQAAMHDMGIALIPPFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKV
                     ESASLRAFRDWLVGQAQAYINSSGTNATN"
     gene            197295..198476
                     /locus_tag="PPUBIRD1_RS00925"
                     /old_locus_tag="PPUBIRD1_0188"
     CDS             197295..198476
                     /locus_tag="PPUBIRD1_RS00925"
                     /old_locus_tag="PPUBIRD1_0188"
                     /EC_number="1.3.99.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014589281.1"
                     /translation="MAGKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLE
                     AFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMS
                     VQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDG
                     GYRLTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWQGLSAPAIHGKVGLRASI
                     TGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGAMGAAEACWHTARQYTLD
                     RQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     Y"
     gene            198490..199710
                     /locus_tag="PPUBIRD1_RS00930"
                     /old_locus_tag="PPUBIRD1_0189"
     CDS             198490..199710
                     /locus_tag="PPUBIRD1_RS00930"
                     /old_locus_tag="PPUBIRD1_0189"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007911642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_014589282.1"
                     /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDT
                     RSWGPPFLKDVEGEDTSEAAYYLSANRNKRSVTIDFTQSEGQRLVRELAAKCDIVIEN
                     FKVGGLAAYGLDYQSLKAVNPQLIYCSITGFGQTGPYARRAGYDFMIQGLGGLMSLTG
                     RPEGEEGAGPVKVGVALTDILTGLYSTVAMLAALAHRDQTGVGQHVDMALLDVQVACL
                     ANQAMNYLTTGTPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQ
                     WAEDPRFATNKLRVANRAELIPLIRQATVFKTTAEWVAQLEAAGVPCGPINNLAQMFQ
                     DPQVLARGLALNIPHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTEAVLGEVLGL
                     DVGEVQRLRGAGVL"
     gene            200265..201811
                     /locus_tag="PPUBIRD1_RS00935"
                     /old_locus_tag="PPUBIRD1_r0001"
     rRNA            200265..201811
                     /locus_tag="PPUBIRD1_RS00935"
                     /old_locus_tag="PPUBIRD1_r0001"
                     /product="16S ribosomal RNA"
     gene            202087..205003
                     /locus_tag="PPUBIRD1_RS00940"
                     /old_locus_tag="PPUBIRD1_r0002"
     rRNA            202087..205003
                     /locus_tag="PPUBIRD1_RS00940"
                     /old_locus_tag="PPUBIRD1_r0002"
                     /product="23S ribosomal RNA"
     gene            205130..205245
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00945"
                     /old_locus_tag="PPUBIRD1_r0003"
     rRNA            205130..205245
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00945"
                     /old_locus_tag="PPUBIRD1_r0003"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            205695..207241
                     /locus_tag="PPUBIRD1_RS00950"
                     /old_locus_tag="PPUBIRD1_r0004"
     rRNA            205695..207241
                     /locus_tag="PPUBIRD1_RS00950"
                     /old_locus_tag="PPUBIRD1_r0004"
                     /product="16S ribosomal RNA"
     gene            207517..210433
                     /locus_tag="PPUBIRD1_RS00955"
                     /old_locus_tag="PPUBIRD1_r0005"
     rRNA            207517..210433
                     /locus_tag="PPUBIRD1_RS00955"
                     /old_locus_tag="PPUBIRD1_r0005"
                     /product="23S ribosomal RNA"
     gene            210560..210675
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00960"
                     /old_locus_tag="PPUBIRD1_r0006"
     rRNA            210560..210675
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00960"
                     /old_locus_tag="PPUBIRD1_r0006"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            210785..210900
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00965"
                     /old_locus_tag="PPUBIRD1_r0007"
     rRNA            210785..210900
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS00965"
                     /old_locus_tag="PPUBIRD1_r0007"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            complement(210967..213381)
                     /locus_tag="PPUBIRD1_RS00970"
                     /old_locus_tag="PPUBIRD1_0190"
     CDS             complement(210967..213381)
                     /locus_tag="PPUBIRD1_RS00970"
                     /old_locus_tag="PPUBIRD1_0190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrioxamine B receptor"
                     /protein_id="WP_041166814.1"
                     /translation="MRHAIRAVLFGTALGLATVPQLSVAADTAEVSQHYAIPAGQLTD
                     VLNKIARQAGITLSSTPQLTDGLHSNGLQGQYTTDQALRQLLNGSGLEAVSQGGSNYV
                     LQAQRQNAALALPDTDIRSFSLGNALGSMEGYNATHSQVATKTSMPLVETSQSVSVVT
                     RQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAMRGFNDGSVDNIYVDGLKSMG
                     DNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVALTTKKPLFAPYHQVQATVG
                     TQGQRGVGFDFSGPVDDDQRIAYRLTGLADASETQFDHNKEERYAIAPAISVDFTEDT
                     SLTLQAYLQHDPDGGYHGGNPADGMLHKRNGLRLSDHFFEGEPSIDNYERTQQSFSYQ
                     FEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWADVDSNMLNRAYTGGDERLHSYIIDN
                     MLQAEFFTGAAKHTLLLGADYQRRKADVTWRYGTVDPLDAGNPQYGNGNLQVLGENRY
                     QRRLQQTGVYLQDLVELDQWRFSLGLRQDWVRVSEENRDSDSKVSDQRSRFTSRAGVL
                     YLFENGIAPYISYSESFNPNTVSDQQGRPLAPTEGTQWEAGIKYQPPGSDSLFTASVF
                     RIEQENLASKQPDEDFYRPVGEVRSQGLELEAHVQLTDSLKLLGGYTFTDIEYSKSMP
                     SLVSGNLDNKGNSPTQAPKQMLSLWADYNFRQGALDGLRLGGGVRYVGYSWVDAENSM
                     KVPSYTLFDASIGYDLGKVGLTGVDVRLNANNLTNESYITSCASLNYCYMGEERNVSA
                     TVSYQF"
     gene            complement(213547..214503)
                     /locus_tag="PPUBIRD1_RS00975"
                     /old_locus_tag="PPUBIRD1_0191"
     CDS             complement(213547..214503)
                     /locus_tag="PPUBIRD1_RS00975"
                     /old_locus_tag="PPUBIRD1_0191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589284.1"
                     /note="anti-FecI sigma factor, FecR; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589284.1"
                     /translation="MTVARPDTKTVRQAIQWMLRLRESGHDPALQQQCEQWRSTHHEN
                     EQAWQRVVHLHQDLDLRAIPGAGLALQTLETSQQRLRRRQALKLLGGVVMAGSASWLA
                     KDLNTVSAWASDYATGTGERRVFTLPDGSMMQLNTCSAVDLAFHDQRRLVRLKHGELM
                     INCNPRHPLLVQTRDALLEGFEGRFVAYQDSDCTRVSVSYGKVAIHRPGTGQLQWIES
                     GQNWRLDAQGAHRLAHMDMDAMAWTEGLIVTQDMRLSNFLAQVSRYRHGYLSCSNDIA
                     DLRLSGVFRLEDPEQLLRLLPQTLPVQLRRRTRWWVHVESMT"
     gene            complement(214508..215011)
                     /locus_tag="PPUBIRD1_RS00980"
                     /old_locus_tag="PPUBIRD1_0192"
     CDS             complement(214508..215011)
                     /locus_tag="PPUBIRD1_RS00980"
                     /old_locus_tag="PPUBIRD1_0192"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014859071.1"
                     /note="ECF subfamily RNA polymerase sigma factor; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014589285.1"
                     /translation="MPSNDSVQTLYSDHHGWLHTWLRSKLGNAADAADLAQDTFVRLL
                     QRREQLQLNAPRAFLRTVARGLVIDHWRREELHRAYLEALAHVPEALVPSVETRELLL
                     ELLERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQMGISVRTVERYIADALYHCYV
                     LRYEDDC"
     gene            complement(215118..215807)
                     /locus_tag="PPUBIRD1_RS00985"
                     /old_locus_tag="PPUBIRD1_0193"
     CDS             complement(215118..215807)
                     /locus_tag="PPUBIRD1_RS00985"
                     /old_locus_tag="PPUBIRD1_0193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014589286.1"
                     /translation="MAKKIKLSNVLASEQLLPHQARGVIEERLRSAILDGRLPPGTAV
                     RQQELATLYGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLE
                     SEALRQSIPLLDASDIASARGYIQQLENETSHTEIGRLNRLLHMALYSKAPNKKLLRL
                     IENELNEEERFLRFHLSSMGLGKLTQDDHNALVDAASDKLVDEAVAVLERHLNGGARV
                     IRNYLDTQLGH"
     gene            216079..216771
                     /locus_tag="PPUBIRD1_RS00990"
                     /old_locus_tag="PPUBIRD1_0194"
     CDS             216079..216771
                     /locus_tag="PPUBIRD1_RS00990"
                     /old_locus_tag="PPUBIRD1_0194"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012269968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic protein"
                     /protein_id="WP_041167117.1"
                     /translation="MAISWLLKTVVRYVGFAALLGSLLLSGLHADWDFSQISRKSQAL
                     YGPLGAGQGRIDAWQSLMATQKQGTELERLQVVNRFFNQQLRYVEDIDLWHEVDYWAT
                     PVQALIKGAGDCEDYAIAKYFSLRRMGIPSEKLRITYVKALRQNRAHMVLTYYSSPQA
                     QPLVLDSLMDAIKPASQRTDLLPVYAFNGEGLWLTGAAGNKKVGDTKRLSRWQDLLKK
                     MQAEGFPAEPVY"
     gene            216782..218728
                     /locus_tag="PPUBIRD1_RS00995"
                     /old_locus_tag="PPUBIRD1_0195"
     CDS             216782..218728
                     /locus_tag="PPUBIRD1_RS00995"
                     /old_locus_tag="PPUBIRD1_0195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003256007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF-domain containing protein"
                     /protein_id="WP_014589288.1"
                     /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQD
                     AATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERQAEPDPGGV
                     PLWFVRLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLSWLLLCGA
                     ASAVLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKL
                     KALFTEQAERSERLRAESYQDSLTGLSNRRYFEMQLNNRVSNLEDARAGYLLLLRVQG
                     LAGLNARLGGQRTDQLLQAVGEQLRRTCASYPETNDLISRSRGGEFAVLAPGMVHEEA
                     VHLAQALEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPT
                     PGWVCLEQGVAAVAADSQHAWHERLDQAFINGHFELFFQPVMECASSQRVLHHKVISR
                     LRDGHGEALPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADP
                     KALQRIFELLSQNAALGPRLVFEIGEEQLPEQAALEQLTRRLHGFGFGLALQRFGGRF
                     SMIGNLAHLGLAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGE
                     RLVLLEMGVGGIQGQLVGEPAPWR"
     gene            complement(218855..220231)
                     /locus_tag="PPUBIRD1_RS01000"
                     /old_locus_tag="PPUBIRD1_0196"
     CDS             complement(218855..220231)
                     /locus_tag="PPUBIRD1_RS01000"
                     /old_locus_tag="PPUBIRD1_0196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004577155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family type I secretion periplasmic adaptor
                     subunit"
                     /protein_id="WP_010951555.1"
                     /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVV
                     RLTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEG
                     QIVEVGQPLLRLDETRFASNVGETEADRLAMALRVERLSAEVEDRPLIIDEKLRKAAP
                     NQAASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRTQYANSLELLRKEISM
                     SEPLVATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFR
                     SEALTQLNEARTELNKATATSKALDDRVHRTLVTSPVRGIVKQLLVNTIGGVIQPGSD
                     IIEVVPLDDTLVIEAKILPKDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTI
                     TDEDKKTTYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKA
                     RSEALRER"
     gene            complement(220221..222377)
                     /locus_tag="PPUBIRD1_RS01005"
                     /old_locus_tag="PPUBIRD1_0197"
     CDS             complement(220221..222377)
                     /locus_tag="PPUBIRD1_RS01005"
                     /old_locus_tag="PPUBIRD1_0197"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I secretion system permease/ATPase"
                     /protein_id="WP_003256004.1"
                     /translation="MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTT
                     GLPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWE
                     NDDTARLLLSESDGGEVHVSREALLSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRD
                     TLLRSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYI
                     FDLILKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLR
                     DFLASLTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFPLALGIGYALQRPLMATME
                     RTMALASERQSSLIETLAGLDAVKVNNAESERQYMWEQTLGTLSRLELRVKVLSSLAM
                     NITLLIQQLAGVAMICVGVYLIIDGNLSMGGLVACYMLSGRALGPLGQLNGLLARYQQ
                     AKVTMVSTDHMMDLPQERNFEERPLSRKVLQGSVEFRGVDFTYPNQQNLALKNINLTI
                     RPGEKVGIIGRSGSGKSSLAKLIVGLYEADGGSLLVDGVDIRQIDVSELRHNIGYVPQ
                     DIQLLAGTLRDNLVSGARYIEDELILQAAELAGVHEFARLHPDGYELQVGERGQNLSG
                     GQRQNVALGRALLLNPQILLLDEPTSAMDNTGEERLKQRLQAVVEGKTVLLVTHRASL
                     LSLVDRLIVIDRGQIVADGPKAAVMDALKKGQISVA"
     gene            complement(222441..222656)
                     /locus_tag="PPUBIRD1_RS01010"
     CDS             complement(222441..222656)
                     /locus_tag="PPUBIRD1_RS01010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019437307.1"
                     /translation="MPWLSGRLCCNKPDDGWIKNETIIAPLSLVKMKHVELFTQHRFK
                     ANIGQLLQHQGVITLISTALQHQREPG"
     gene            223371..249419
                     /locus_tag="PPUBIRD1_RS01015"
                     /old_locus_tag="PPUBIRD1_0199"
     CDS             223371..249419
                     /locus_tag="PPUBIRD1_RS01015"
                     /old_locus_tag="PPUBIRD1_0199"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="surface adhesion protein"
                     /protein_id="WP_014589289.1"
                     /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLAGEEVLTGPG
                     GAVTLELADGRLLDLGRDSQWSADAPDSSTDLSQAAAQAAPSVEELQQAIAAGVDPTT
                     ELEATAAGPSSAGGGALGGGHSFVMLEETAGRVDPTVGFPTDGLGFAGVPDNEEVGLL
                     DTNGNNLVTTPTDTTVATELTLGATPSISEAGGVIVYTATVGQAPTTNLVLTLSNGAV
                     IVIPAGQTSGSVNVAVPANDTPYIDGGQISATVTGSTGGGGLTVTLPQTPAVTQVTDT
                     IDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQVITVEAGKTQGSVDFQ
                     TPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTE
                     GGVITYTVTLSNPAQTPVTVNLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVT
                     IESATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQT
                     PVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNP
                     TPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEA
                     GKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTA
                     TLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDV
                     YNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITY
                     TVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATG
                     GNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTL
                     SNGQVITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTT
                     INDSVDATTATLTASPSVTEGGVITYTVILSNPAQTPVTVTLSNGQTITVEAGKTQGS
                     VDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTITDSVDTTTATLTASP
                     SVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGST
                     VSVTIESATGGNFEHLTPNPTPASTVINDSIDTVTVSIVSNGNVTEDQQPSFTVKVSQ
                     ALDRPLTVTLSNGDTVTIEAGKTEVEYKTSVQGDDVYLDAGSITLSVTDATVPGATFE
                     KLALGGPATVEISDTISEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFK
                     LTDGTTVVVAANSTTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTP
                     VSTEVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNA
                     QVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAAKVDVT
                     DTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANS
                     TTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPG
                     NEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPY
                     THDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAASVQVTDTLDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNV
                     YVGTNAPVINAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDA
                     GQISLGINSAVDATGAAFENLELGGSASVQVTDTLDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAID
                     AVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITADQASVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGITSAVDV
                     DGHTFENLQLGGNASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAIDAVSGADAWKFENL
                     NLDKTPVSTTVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLIV
                     TLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLQLGGN
                     ASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTV
                     VVAANSTTGSATVAAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTTVTD
                     EPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHDAQGDDVYQDAGQISLGITSAVDVDGHTFENLQLGGNASVQVTDTLDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATA
                     TAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVK
                     VTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGD
                     DVYNDAGQISLGITSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATPSVTEGG
                     EITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTND
                     PVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAE
                     NVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLG
                     ITSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
                     GLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGA
                     DVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDA
                     TGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQ
                     LTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPL
                     AHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFEN
                     LELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTL
                     SDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTP
                     VSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVT
                     LSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNA
                     SVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVI
                     TVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTD
                     EPGTPGNEGDLVKVTITADQTSVAENVKPIFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQLGGNASVQVTDTTDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTAT
                     VTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSN
                     EGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYT
                     HAAQGDDVYNDAGQISLGINSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATP
                     SVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNV
                     YVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDA
                     GQISLGITSAVDVDGRTFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSI
                     ATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTF
                     TVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVD
                     ATGATFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINN
                     HSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFE
                     QLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDL
                     VVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELG
                     GAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIDKHAALTFTLDDGK
                     TTITIPANGTTGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTS
                     VTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTI
                     KAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLELGGAASVQVTDTLD
                     EVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVG
                     TATVTAPDNVYVGANDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEG
                     DLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHA
                     AQGDDVYNDAGQISLGITSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSV
                     TEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYV
                     GSNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQT
                     SVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQ
                     ISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTATPSVTEGGEITYTITL
                     TNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIAT
                     VGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSLAENVK
                     PTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINS
                     AVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLP
                     INNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVG
                     KFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLA
                     HDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENL
                     ELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLS
                     DGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVGKFEQLTLDKTPV
                     STSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQ
                     VTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTD
                     TTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANG
                     TVGTATVTAPDNVYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPG
                     NEGDLVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVIIKAGETSAPY
                     THAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDN
                     VYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDPVKVTITA
                     DQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYND
                     AGQISLGINSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYT
                     ITLTNKDGLPIDKHAALTFTLDDGKTTITIPANGTTGTATVTAPDNVYVGTNDPVVMS
                     IATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPT
                     FTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAV
                     DVDGRTFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIN
                     NHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGANDPVVMSIATVEGADVGKF
                     EQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHD
                     LVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQL
                     GGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDG
                     KTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVST
                     SVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVT
                     IKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGAATVQVTDTT
                     DEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTV
                     GTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNE
                     GDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTH
                     AAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPS
                     VTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVY
                     VGTNDPVIKSIATVGGADVGKFEQLTLDKTPVSTAVTDEPGSGTPGTGNKGDVTTVGI
                     TGTTSLTEGETGQYTLTLSNASKSEVTITLSYSGTAQNGDDFTGVATVKIPANSTGTT
                     FNIATLNDKLVEGTENFVVKIETATGGNFENLQVDSSKSSVTTTILDNDHLPVSPGGA
                     VFGVEDTDYVFAWSDFKVTDADGNTNLSVTITSLPAAGNLQFFNGTAWVNVAVGQVVS
                     QADITAKNLKFVPALNQSGADNYGGNGVGNQKADYAQFKFKPNDGTNLGSEVTMKVDI
                     SPVADKPTLSFGSADIESKGLTKEVWTSLKGLGTGGNGITGEDLKTVFANSGSANSSS
                     TTTNVQSDGSVTAGTGSKTSGLIYLEAGKVYTFSGLADDSFVVTIGGKTVVTATWGAG
                     GGVSGTFTPNTSGYYPIEVYHANQSGPGSYDLNIQVGSGAVTDLSSSNVKMYQNVTEM
                     ANAGLGVSDLHTVNGQSYYDGYKLNEGPEGGSVKLVGISTALTDTDGSESLNVTLSGI
                     PKGTVLSDGAGHTVTVGTAPVDVTGWKLSSLTLTPPAYYKGSFDITVTSTATESLGGS
                     AITTGNIPVTVYGATYKASVGTSGNDTLTGSEGNDIFVADVSGLNVVQGKNYNIAFMV
                     DSSGSMSDKSIADAKTQLASVFNTLKASLGSDTSGTVNIFLVDFDTQVNKNVAVNLAD
                     PDALSKLQAVLNSMVGGYYGGGTNYEDAFKTTSNFFNSTMATSNKGAENLTYFITDGK
                     PTYYQSNESTNPSLWKNGKSLDDVVNVNNYKMGDTFSAWADATHKVEISSSGVVKVLT
                     YTENRRGELVLDSTKTVGTLHAQGDGTYEFSSLDGTGYADYWNYVYSAAGSTESFAVL
                     GGTNGLSKVQAIGLNSDVTLNDLKPYDSAGKPQTNIDPSDLAKAILGHSEATVPGADT
                     IDSGNGNDIIFGDLITLNGVVSEGYQALQTYVAQKSGVEVGAVTTSNVHQYITEHYTE
                     FDISGAKDGNDILSGGNGNDILFGQGGSDTLNGGKGNDILLGGTGNDTLIGGQGDDIL
                     IGGSGADTFVWKAGDVGNDVIKDFNKAEGDRIDLKDLLQGEKGSTIDNYLKLTTVEGT
                     TTLQVSSEGKLNAEGGIANADVTIKLEGVNWSNQTINSLISGADPTIIIHNKDS"
     gene            249565..249906
                     /locus_tag="PPUBIRD1_RS01020"
                     /old_locus_tag="PPUBIRD1_0200"
     CDS             249565..249906
                     /locus_tag="PPUBIRD1_RS01020"
                     /old_locus_tag="PPUBIRD1_0200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255921.1"
                     /translation="MFYVQRNAAGQLLRVEAAAFDQFTEMLPSDHADIQEWFADDVVE
                     NSLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKALSSLNN
                     LIDEEEQGGLI"
     gene            249938..250099
                     /locus_tag="PPUBIRD1_RS01025"
                     /old_locus_tag="PPUBIRD1_0201"
     CDS             249938..250099
                     /locus_tag="PPUBIRD1_RS01025"
                     /old_locus_tag="PPUBIRD1_0201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019439221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166815.1"
                     /translation="MVVLQGNLVLAALPSIKLCAGLAVVILIGLLAEGLVFNNLEGLT
                     VLRWETPRG"
     gene            complement(250516..251232)
                     /locus_tag="PPUBIRD1_RS25980"
     CDS             complement(250516..251232)
                     /locus_tag="PPUBIRD1_RS25980"
                     /inference="COORDINATES: protein motif:HMM:TIGR03696"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557754.1"
                     /translation="MSRRDQILRRFYQGQQLCTLLTQDEAWMALRANRKLISEQLLPP
                     GREPYAILPGDDSSGSVICTKNANALVNLAYTPYGYTKERFQSSGRLRFNGQLPEASM
                     NCYLLGSYRLFSSSLMRFFTPDVWSPFGAGGLNAYAYCENDPLNHSDPSGHGKVSNKS
                     ARPSSPTLKLLKKATDKLKTYNERKARLEAKTAAQRKAINTEAIDTPPYPNLQPVVNQ
                     INSHKKANHFDSEQHARKSK"
     gene            complement(251533..252093)
                     /locus_tag="PPUBIRD1_RS01030"
                     /old_locus_tag="PPUBIRD1_0202"
     CDS             complement(251533..252093)
                     /locus_tag="PPUBIRD1_RS01030"
                     /old_locus_tag="PPUBIRD1_0202"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019097414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="WYL domain-containing protein"
                     /protein_id="WP_003255912.1"
                     /translation="MPFATTRATLSRQWALLRQLPSRSPGITSAELVWRLRDVGFTVS
                     KRTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLLTHLRGDALQPSQG
                     EGVELVARISDALARQLRDAPLSSDMQLTALEHGHRLRGTVSDGWPLRWWLLSHGDRV
                     VVEQPAGLREEIGRILSNAAAQYQNL"
     gene            252301..253095
                     /locus_tag="PPUBIRD1_RS01035"
                     /old_locus_tag="PPUBIRD1_0203"
     CDS             252301..253095
                     /locus_tag="PPUBIRD1_RS01035"
                     /old_locus_tag="PPUBIRD1_0203"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017147865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sel1 repeat family protein"
                     /protein_id="WP_014589291.1"
                     /translation="MSVASNIHSLLARLLPERVIAPPAPAGRRQRLFSGVGLPSQRSL
                     LVNRLDEANDLQAVYVDLRRQALQGSVSALNDLGWIWLNGKYWRADTVLAGHLLRMAA
                     LQGNAAAWFNLGQQHYFGKGIDPSYVQAAECYRQAFDRGMLHAAAALGDLYEEEVCDG
                     DLEWQVDLVQAYQWFLRGAEQGEARCRFEVGYRLMHGLHVEANLKAALYWLELAAAAG
                     VVQAAEELAVHFSSRDAVRYQEWRDRAVQMGSTLALTMKLEDQIHP"
     gene            253229..253681
                     /locus_tag="PPUBIRD1_RS01040"
                     /old_locus_tag="PPUBIRD1_0204"
     CDS             253229..253681
                     /locus_tag="PPUBIRD1_RS01040"
                     /old_locus_tag="PPUBIRD1_0204"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_026031987.1"
                     /translation="MSLDFLRLQVSSGLVVAARHWRRICHTALTGYGISEACAAPLLM
                     IVRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLTAEGR
                     ALAEAIEAELVRLRRDVLGGIDQADLEAALRVLHAFEAAGLGSAGGVA"
     gene            253678..255765
                     /locus_tag="PPUBIRD1_RS01045"
                     /old_locus_tag="PPUBIRD1_0205"
     CDS             253678..255765
                     /locus_tag="PPUBIRD1_RS01045"
                     /old_locus_tag="PPUBIRD1_0205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FUSC family protein"
                     /protein_id="WP_014589293.1"
                     /translation="MNGFFSSVPPARDWFYGVRTFGASMIALYIALLMQLPRPYWAMA
                     TVYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLF
                     LSLNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAI
                     FWPRRLAPVVVGATGNWFTEAIRYSDTYLARDASADKVGGMRGAMVTTFNSLELMIGQ
                     LAHEGAGPHTLKNARELRGRMIHLLPVIDALGDALVALEGRAPAQFAQLQPVLEAARE
                     WLKGTADSASVAHWAALHEQIGRLQPATAALDQRAELLLSNALYRLTEWADLWQDCCT
                     LQHALRTDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWN
                     DGASAVILAAVACSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLV
                     LAFAVPFICIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNSNLAGPAGL
                     LFAFIWTLVMRPFGVELAAKRMTRFAWRDIVEMTEPATLAEHRQVGVQMLDRLMQHLP
                     RLSQTGQDSGVALRDLRVGLNLLDLLAYMPRAGQQARERLNTVVEEVGAHYAACLRAG
                     ERLHAPAALLRNMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAE
                     QPQLPPGLDGAPL"
     gene            255762..255974
                     /locus_tag="PPUBIRD1_RS01050"
                     /old_locus_tag="PPUBIRD1_0206"
     CDS             255762..255974
                     /locus_tag="PPUBIRD1_RS01050"
                     /old_locus_tag="PPUBIRD1_0206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1656 domain-containing protein"
                     /protein_id="WP_003255905.1"
                     /translation="MIGELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWH
                     RALFNVALYAVLLGAVDHFCRNLMLP"
     gene            255971..256846
                     /locus_tag="PPUBIRD1_RS01055"
                     /old_locus_tag="PPUBIRD1_0207"
     CDS             255971..256846
                     /locus_tag="PPUBIRD1_RS01055"
                     /old_locus_tag="PPUBIRD1_0207"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_010951565.1"
                     /translation="MKKPLLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIR
                     ADVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFTLALRQAKATLGERQETLA
                     QASREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPV
                     DGYLNDRAPRNHEFVTAGRPVLSVVDSASYHVDGYFEETKLGGIHIGDAVDIRVMGDN
                     TRLRGHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMI
                     AGRTATVSIIEGQRP"
     gene            256843..258261
                     /locus_tag="PPUBIRD1_RS01060"
                     /old_locus_tag="PPUBIRD1_0208"
     CDS             256843..258261
                     /locus_tag="PPUBIRD1_RS01060"
                     /old_locus_tag="PPUBIRD1_0208"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="WP_010951566.1"
                     /translation="MKQLILAGLCLSLGACMMVGPDYEVPGDAAVQRNDLNGPLRQDA
                     DSVVSAPVPEDWWQLYQDQRLNELVRQALSANTELRVAAANIAKARAQVEVAESQGGF
                     NGGVKLGAQRLQESGEAFLQPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANAD
                     AVQAAADTARITLVADVVKAYTQVCSANEEYHIARESLDLQEQSVKLNQRLRDAGRGD
                     ETQVTRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQ
                     LVPVGDGAALLKRRPDVRQAERQLAAATAYIGVATGALYPDISIGAQVGTIGILENLG
                     EPSTNRWGFGPQISWSIPTNGTRARIRMAEASTQAALAHFDGVVLNAIRETQTRLAQY
                     SALLDRRDALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRTYTDMRAQLAAANSQ
                     VAQGQIAVFLALGGGWKGTAKP"
     gene            258372..260315
                     /locus_tag="PPUBIRD1_RS01065"
                     /old_locus_tag="PPUBIRD1_0209"
     CDS             258372..260315
                     /locus_tag="PPUBIRD1_RS01065"
                     /old_locus_tag="PPUBIRD1_0209"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_014589294.1"
                     /translation="MFSFAFPSRLAMKTRSRLLAWLPAALLGPVLALCSTLALAESPA
                     NAAKAQHLLDYIGADYPPTVQDGKVIDEGEYREQQEFSAVLADLVKGLPANTEQAALE
                     QGVQALRQAIDQRQEGTAVAKQARQLGARLAVAYEVSQAPVITPDPARGAALYAQNCS
                     ICHGDTGAGDGPAGVGLEPAPANLRDVSRLDQLSLFDLYNTLALGIDGTEMPSFADQL
                     DDRQRWDVAAYIASFTAKPEAGKGDKTWNLADLARQTPAEVAVNEGTAAVEAFRAQRA
                     QPPQVKRGPAQLLEYTASTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNID
                     TQARKDTEKSLMAYRQSLQDGLPEAQAEQRLADAKTKLEQAAKLLGSDGLSWTLSYIS
                     GLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWALAAYVID
                     VGGAQRELLEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYIKSSLVSGGGRFGFAVLA
                     FFSVYRELFEVILFYETLWLQAGPAGHQAVLAGGATALVLLVGLAWVILRGSAKLPLS
                     LFFSINAALLCALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAV
                     ALLAIVFLYGRSWLAEKRSAAVN"
     gene            complement(260378..260623)
                     /locus_tag="PPUBIRD1_RS01070"
                     /old_locus_tag="PPUBIRD1_0210"
     CDS             complement(260378..260623)
                     /locus_tag="PPUBIRD1_RS01070"
                     /old_locus_tag="PPUBIRD1_0210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_003255900.1"
                     /translation="MPFTPDLIDEMEVLALFKHDSSQEGIKITSTASPALIAAAQRLH
                     EKGLTDQPDGGYLTSLGHDAVESVQLLQNILKAPQPA"
     gene            complement(260693..260995)
                     /locus_tag="PPUBIRD1_RS01075"
                     /old_locus_tag="PPUBIRD1_0211"
     CDS             complement(260693..260995)
                     /locus_tag="PPUBIRD1_RS01075"
                     /old_locus_tag="PPUBIRD1_0211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951568.1"
                     /translation="MSEPTDIDNDDDEAFAEATLTQAIENQIESGEPPAAKATFNKLT
                     LVGYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGDDE"
     gene            261144..261806
                     /locus_tag="PPUBIRD1_RS01080"
                     /old_locus_tag="PPUBIRD1_0212"
     CDS             261144..261806
                     /locus_tag="PPUBIRD1_RS01080"
                     /old_locus_tag="PPUBIRD1_0212"
                     /EC_number="2.5.1.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009682192.1"
                     /note="glutathione S-transferase family protein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_014589295.1"
                     /translation="MLKLYGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALEVS
                     PRGKVPVLETEHGFLSETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIEL
                     PARTCYAESFFGMSVDPLIKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCF
                     SVDLANAVGKKVLDIDFLVDFPQAKALLQLMGENPHMPRILADKEASMPAFMEMIRSG
                     KR"
     gene            complement(261931..263325)
                     /gene="argH"
                     /locus_tag="PPUBIRD1_RS01085"
                     /old_locus_tag="PPUBIRD1_0213"
     CDS             complement(261931..263325)
                     /gene="argH"
                     /locus_tag="PPUBIRD1_RS01085"
                     /old_locus_tag="PPUBIRD1_0213"
                     /EC_number="4.3.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005792438.1"
                     /note="Argininosuccinate lyase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_014589296.1"
                     /translation="MSTEKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSI
                     AHATMLAQVGVLSDAERDTIIDGLKTIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIG
                     ITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAETIMPGFT
                     HLQTAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIDRELTC
                     KLLGFEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPD
                     RFCTGSSIMPQKKNPDVPELVRGKSGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLF
                     DAADTLRDSLRAFADMIPAIKPKHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEI
                     VGHAVKYGVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARDHIGGTAPAQV
                     RAAVVRGKALLASR"
     gene            263623..264366
                     /locus_tag="PPUBIRD1_RS01090"
                     /old_locus_tag="PPUBIRD1_0215"
     CDS             263623..264366
                     /locus_tag="PPUBIRD1_RS01090"
                     /old_locus_tag="PPUBIRD1_0215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017902004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010951571.1"
                     /translation="MNVLIVDDEPQGRERLTRLLGELEGYTVLEPSATNGDEALALIE
                     SLKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCSGDDEYGAEAFKDSTLSHVTK
                     PFQAHALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPLPQVIYF
                     IADHKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHF
                     QLYLKGLDGDALTVSRRHVAGVRKMMQTL"
     gene            264486..265427
                     /locus_tag="PPUBIRD1_RS01095"
                     /old_locus_tag="PPUBIRD1_0216"
     CDS             264486..265427
                     /locus_tag="PPUBIRD1_RS01095"
                     /old_locus_tag="PPUBIRD1_0216"
                     /EC_number="2.5.1.61"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008099463.1"
                     /note="Porphobilinogen deaminase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_014589297.1"
                     /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHTGLQVTLVPMVSR
                     GDKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICERE
                     DPRDAFVSNTFDSLEALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLD
                     AGEYDAIILAAAGLIRLGFEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAP
                     LHHVDTADRVMAERALNKRLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADA
                     RAPRAAAEALGVQVAEDLLGQGAEAILKEVYGEAGHP"
     gene            265424..266191
                     /locus_tag="PPUBIRD1_RS01100"
                     /old_locus_tag="PPUBIRD1_0217"
     CDS             265424..266191
                     /locus_tag="PPUBIRD1_RS01100"
                     /old_locus_tag="PPUBIRD1_0217"
                     /EC_number="4.2.1.75"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016714406.1"
                     /note="uroporphyrinogen-III synthase; catalyzes the
                     formation of uroporphyrinogen-III from
                     hydroxymethylbilane; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen III methyltransferase"
                     /protein_id="WP_014589298.1"
                     /translation="MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLEIEPITVQA
                     PQRLSLEGLHDFQAIIVVSKPAARLLLEHLAETSIQPPQRGWFTVGEATAGVLQGAGL
                     EVSFPPRGDDSEALLALPALRQALTELAPRVLIVRGVGGRELLAERLAEQGASVEYLE
                     LYRRCLPAYPAGTLMRRIEAERLNGLVVSSGQGFEHLQQMAGADWLRLAQLPLFVPSP
                     RVAEQAKAAGAQQVVDCRGASATALLAAVQRSAAPAS"
     gene            266237..267337
                     /locus_tag="PPUBIRD1_RS01105"
                     /old_locus_tag="PPUBIRD1_0218"
     CDS             266237..267337
                     /locus_tag="PPUBIRD1_RS01105"
                     /old_locus_tag="PPUBIRD1_0218"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis operon protein HemX"
                     /protein_id="WP_003255892.1"
                     /translation="MSETVLSNNDQPSAQAPAEPVTTPPAKRSGSGLAALALLLGAAG
                     VAVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDR
                     RRLVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALV
                     EGADEILREQSDPGAFAAREQLARSLATLNSTQQPDRTGLFLKLAAQRELVQQLSAQS
                     PEFDSNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRL
                     ALSLTIEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLDSLNALADQPV
                     SVVTPDLSESLAAVQAYIQRRHLPAEAEGGKP"
     gene            267334..268572
                     /locus_tag="PPUBIRD1_RS01110"
                     /old_locus_tag="PPUBIRD1_0219"
     CDS             267334..268572
                     /locus_tag="PPUBIRD1_RS01110"
                     /old_locus_tag="PPUBIRD1_0219"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255891.1"
                     /note="HemY domain protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis protein HemY"
                     /protein_id="WP_014589299.1"
                     /translation="MKRVYLLAVLAIVVAAALGIAVAKHSGYVLISYGGFRYQSGLWA
                     ALAGILAVVLLLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRLAIEQGQLDLAEGRWA
                     SAQRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTH
                     AQLQMDRGENDGALETLLAMQERHPHNGQVLRLLQRLYVERGDWSALIRLLPDLRKGK
                     VLPAAELAALEQRAWGQNLSLATTRGEDALSARQSLERAWQQLTAAQRQEPQLVLAYA
                     EQLRQVGAQNEAEQVLRTALKRDYESHLARLYGLVRGDDPVRQLQTAEGWLKAHPQDA
                     SLLLTLGRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQE
                     GLGLLDERLLALPLPEGVRA"
     gene            268795..269301
                     /locus_tag="PPUBIRD1_RS01115"
                     /old_locus_tag="PPUBIRD1_0220"
     CDS             268795..269301
                     /locus_tag="PPUBIRD1_RS01115"
                     /old_locus_tag="PPUBIRD1_0220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589300.1"
                     /note="Disulfide bond formation protein B 2; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein B"
                     /protein_id="WP_014589300.1"
                     /translation="MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRL
                     LLGGYALLCFAAVLQAPGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPV
                     PIGRVFEQSWGEAARQLLLGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAY
                     RFRTLARA"
     gene            269533..270003
                     /locus_tag="PPUBIRD1_RS01120"
                     /old_locus_tag="PPUBIRD1_0221"
     CDS             269533..270003
                     /locus_tag="PPUBIRD1_RS01120"
                     /old_locus_tag="PPUBIRD1_0221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255887.1"
                     /note="anti-RNA polymerase sigma 70 factor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rsd/AlgQ family anti-sigma factor"
                     /protein_id="WP_014589301.1"
                     /translation="MLDSCQNAQERWGGVHKLIDRWLEERQELVQAFRALRDVRPAFA
                     DKDTNGDFCALLVDYVSAWHFEVCEQLVSEAKAFGDEKALKLAEEINPRINDSTQIAL
                     AFNDHCAKGECKDTERFAEKLAKLGGLLHERFELEDCLIEVLHNAHKEEGAVQA"
     gene            complement(270012..270650)
                     /locus_tag="PPUBIRD1_RS01125"
                     /old_locus_tag="PPUBIRD1_0222"
     CDS             complement(270012..270650)
                     /locus_tag="PPUBIRD1_RS01125"
                     /old_locus_tag="PPUBIRD1_0222"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_041166816.1"
                     /translation="MPRNLVLGLCLMAPLALADNDDHDLAYSLGASLGERLRQEMPGL
                     QLDALVEGLKQSYQGQPLKLDKTRMQAVLQQLEAQEGDAATQKLQAAETRFMANERGR
                     YGVHELTEGVLYSELQAGTGAQPKAGGKVQVRYVGRLPDGSIFDQNQTPQWFNLDSVI
                     EGWQVALPKMHTGAKWRLVIPSAQAYGAEGAGDLIAPYTPLIFEIELLAVGD"
     gene            270829..271764
                     /locus_tag="PPUBIRD1_RS25850"
                     /old_locus_tag="PPUBIRD1_0223"
     CDS             270829..271764
                     /locus_tag="PPUBIRD1_RS25850"
                     /old_locus_tag="PPUBIRD1_0223"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953192.1"
                     /note="alginate regulatory protein AlgP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589303.1"
                     /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEEACSQALADAEKLLAKL
                     EKQRGKAQEKLHNGRLKLQDAAKAGKAKAQNKAQKAIGELEELLESLKERQTQTRSYI
                     QQLKRDAQDSLKLAQGVGKVREAAGKALDQRAAKPAAKATAAAKPAAKPAAKATAAAK
                     PAAKPAAKATATAKPAAKPAAKTTAAAKPVAKPAAKATAAAKPAAKPAAKVTAAAKPA
                     AKPAARATAAAKPAAKATAAAKPAAKPAAKAPAAKPAAKPAAAKAPARTAAKPAANPA
                     EAKPATPAAATNSVSPAAAAPSAPVSTPSQVPSAS"
     gene            complement(271743..272222)
                     /locus_tag="PPUBIRD1_RS01140"
                     /old_locus_tag="PPUBIRD1_0224"
     CDS             complement(271743..272222)
                     /locus_tag="PPUBIRD1_RS01140"
                     /old_locus_tag="PPUBIRD1_0224"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR02444 family protein"
                     /protein_id="WP_014589304.1"
                     /translation="MHTDLWNYALALYARPGVEAACLELQALGGDVCLLLCATWLQAR
                     GVAVLGERAHALQELAEPWQRDVVTPLRSLRQQWRTPASADAQLAALREQVKGLELQA
                     EKALLERLQERSQQWPAGSHEPTDDWLARLAPDQALHHDALVQLRVAAAALQDAEGT"
     gene            272273..274183
                     /locus_tag="PPUBIRD1_RS01145"
                     /old_locus_tag="PPUBIRD1_0225"
     CDS             272273..274183
                     /locus_tag="PPUBIRD1_RS01145"
                     /old_locus_tag="PPUBIRD1_0225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041166818.1"
                     /translation="MIRLSNLTLQRGPQRLLEGAEMTLHAGHKAGLIGANGAGKSSLF
                     ALLRGELSPDAGDCQLPGDWRIAHMRQEVDTLDRLAVDYVLDGDVRLRKVQAELAAAE
                     QAHDGTALARLHSELESADGYTADARARKLLAGLGFTNDQMDRRVGDFSGGWRMRLNL
                     AQALMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLH
                     VEQRKLNLYKGGYTAFERTRAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQA
                     QSRIKALERMEELSAAHVDSPFDFVFRESQKISSPLLSLSEGRLGYGDKAILDKVKLQ
                     LTPGARIGLLGPNGAGKSTLIKNLAGELEPLSGRLVRGENLAVGYFAQHQLDSLDDKA
                     SPLLHLQRIAPAEREQTLRDFLGGFDFHGARCDEPVVNFSGGEKARLALALIAWERPN
                     LLLLDEPTNHLDLEMRLALTMALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVDTF
                     DGDLEDYSRWLVEYRQRSAPASTAPVNPDKTDKKAQRQAAAALRQQLAPHKKAADKLE
                     TELNQVHAQLAEIETALGDGGLYDAARKDELRDLLARQTRLKQREGELEEAWMEALET
                     LESMQAELEALS"
     gene            274183..274770
                     /locus_tag="PPUBIRD1_RS01150"
                     /old_locus_tag="PPUBIRD1_0226"
     CDS             274183..274770
                     /locus_tag="PPUBIRD1_RS01150"
                     /old_locus_tag="PPUBIRD1_0226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589306.1"
                     /translation="MEELRSLLPGQWMDTFWLGLQILLILAAAFILQRIVARGLSRLG
                     QRYPLPPELLVPVRGGLRWLIMGSALLFVLERMGVSATVLWTALSGFVAVAAVAFFAM
                     WSVLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEVPEAGG
                     ALVQVPNSQFFQKSVRRWRGAEVQALHKDTAAEAD"
     gene            274969..275601
                     /locus_tag="PPUBIRD1_RS01155"
                     /old_locus_tag="PPUBIRD1_0227"
     CDS             274969..275601
                     /locus_tag="PPUBIRD1_RS01155"
                     /old_locus_tag="PPUBIRD1_0227"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009395674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_010951582.1"
                     /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNAL
                     GLQLGLIMQIAIIAAGVGAVLAASATAFQVIKWFGVGYLVYLAYKQWRALPMDMSDES
                     GVRPIGKPLSLVFRGFLVNISNPKALVFMLAVLPQFLNPHAPLLPQYVAITVTMVTVD
                     LLVMAGYTGLASHVLRMLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPV"
     gene            complement(275650..276402)
                     /locus_tag="PPUBIRD1_RS01160"
                     /old_locus_tag="PPUBIRD1_0228"
     CDS             complement(275650..276402)
                     /locus_tag="PPUBIRD1_RS01160"
                     /old_locus_tag="PPUBIRD1_0228"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589307.1"
                     /translation="MFMQFGFGAVLIVLAMLVLSAFRILREYERGVVFQLGRFWQVKG
                     PGLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQV
                     EDFLVATSQLAQTTLRAVLGKHELDELLAEREQLNLDIRQVLDAQTDAWGIKVANVEI
                     KHVDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLSKEPGAMQLRY
                     MQTLGMIAGDKSSTIVFPLPIDLLKGLVDKEK"
     gene            complement(276405..277751)
                     /locus_tag="PPUBIRD1_RS01165"
                     /old_locus_tag="PPUBIRD1_0229"
     CDS             complement(276405..277751)
                     /locus_tag="PPUBIRD1_RS01165"
                     /old_locus_tag="PPUBIRD1_0229"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_014589308.1"
                     /translation="MIARCWRLLLLLLLLGITPGGQAAPGAVWVLNIDDAIGPASADY
                     LVRSLSQAQAQGAQLVVIRMDTPGGLDSAMRQMIKAILASPVPVASYVAPSGARAASA
                     GTYILYASHVAAMAPGTNLGAATPVRIGGAPGTPSDDKAKGGDDETLARKQVNDAAAY
                     IRGLAQMRGRNADWAEQAVREAVSLSASEALRLNVIDQVADDLSDLLRKLDGKTLQVA
                     GQPRQLQTAGASVVEHLPDWRTRVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGG
                     VVGGICLLLALYALQLLPVSFAGVALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGA
                     LILIDTDAPGFGIPLALIGTLALLSALLIGGVLGMALKARQRALVSGDAGLVGSLVTV
                     TQVMASDPFCGVVLAQGEPWQARCATPLQTGQNVRVTARHGVMLEVSAAAPATQGE"
     gene            277850..278308
                     /locus_tag="PPUBIRD1_RS01170"
                     /old_locus_tag="PPUBIRD1_0230"
     CDS             277850..278308
                     /locus_tag="PPUBIRD1_RS01170"
                     /old_locus_tag="PPUBIRD1_0230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019473110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255874.1"
                     /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVA
                     KSVMLDDRHGNYIMAVLPANRHLDMTKVRMSGAWHLTRESGLPSLFNDCERGAVPALG
                     DAYQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
     gene            278370..278612
                     /locus_tag="PPUBIRD1_RS01175"
                     /old_locus_tag="PPUBIRD1_0231"
     CDS             278370..278612
                     /locus_tag="PPUBIRD1_RS01175"
                     /old_locus_tag="PPUBIRD1_0231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011531604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2789 domain-containing protein"
                     /protein_id="WP_014589309.1"
                     /translation="MEAPIHPFADLFKQLGLPDDPTSIDQFITSHSPLKNEIKLVDAP
                     FWNDSQRAFLKDSIIEDSDWAVPFDQLNEALRRPRK"
     gene            278682..279320
                     /locus_tag="PPUBIRD1_RS01180"
                     /old_locus_tag="PPUBIRD1_0232"
     CDS             278682..279320
                     /locus_tag="PPUBIRD1_RS01180"
                     /old_locus_tag="PPUBIRD1_0232"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012312218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255871.1"
                     /translation="MKDPYAPGFWCSVTILGTLTASYFYGIRQTQQMNQAVHFLYAAA
                     AVTVAVALVALTWIAWQQLRLNKREVVQGRTLLTIWNTKVALRRVETVFDRYFWGSYW
                     HSGRTFEEVMGELRGTPLEQSLDALKRQCRVLDREIHDRHHHWLANARDLSSVAQAMA
                     RERYQLDLGEPTHSGHGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
     gene            complement(279327..279764)
                     /locus_tag="PPUBIRD1_RS01185"
                     /old_locus_tag="PPUBIRD1_0233"
     CDS             complement(279327..279764)
                     /locus_tag="PPUBIRD1_RS01185"
                     /old_locus_tag="PPUBIRD1_0233"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014589311.1"
                     /translation="MKNVEQILKTKSQHQTVYTIGPDDSVLDALKLLAEKNVGALPVV
                     EGGQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKQKLDFCMNLMTDRH
                     LRHLPVVDNGRLLGLLSIGDLVKETIDEQASLIKQMEQYIRGE"
     gene            complement(279934..281664)
                     /locus_tag="PPUBIRD1_RS01190"
                     /old_locus_tag="PPUBIRD1_0234"
     CDS             complement(279934..281664)
                     /locus_tag="PPUBIRD1_RS01190"
                     /old_locus_tag="PPUBIRD1_0234"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptidase"
                     /protein_id="WP_014589312.1"
                     /translation="MQLKKLTATTLLLASIGLFTQPAQANLTQQQSAAIVKAFDGSDP
                     SDFKQFLGKLKGSDLGKANNLEATVDAYLANKPLAAGQQDEINRLLGLYTRIKYGKAA
                     TETLRELVAIPTFNVEGTPQYENPEFLKIADKIKALADRFGLAFRNIDNRVYEISLGS
                     GKEVIGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGIVVAMY
                     ALKVAKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPDYNLALDGGYPVVIAEK
                     GYGTVMASFTKRPASGKGAEIVNLTGGLATNQIPTTSVATLISDNPAQLTKHLQQAGA
                     KYVKQHGSDFSIDAKADGKQVLLTVTGVSAHSSEPESGINPVARMLDFINGLGQQVPL
                     KHNHFTDAARYAADNWGLDYLGNKLGVAFKDPFMGPLTTSLTFVGVDDKGLKLAVNLR
                     IPKGKPIATIKDELADKLGKWTRQSNTSVAFDYSLDEPMYRNPEGEWVKALLAVATEN
                     LGMKHEFGTSAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVEQFMLDLQVVSEM
                     VARIGQMPKL"
     gene            complement(281827..281903)
                     /locus_tag="PPUBIRD1_RS01195"
                     /old_locus_tag="PPUBIRD1_t0064"
     tRNA            complement(281827..281903)
                     /locus_tag="PPUBIRD1_RS01195"
                     /old_locus_tag="PPUBIRD1_t0064"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(281867..281869),aa:Arg,seq:ccg)
     gene            <282045..>282146
                     /locus_tag="PPUBIRD1_RS25985"
                     /old_locus_tag="PPUBIRD1_0235"
                     /pseudo
     CDS             <282045..>282146
                     /locus_tag="PPUBIRD1_RS25985"
                     /old_locus_tag="PPUBIRD1_0235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008096619.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfotransferase"
     gene            282379..283821
                     /locus_tag="PPUBIRD1_RS01200"
                     /old_locus_tag="PPUBIRD1_0236"
     CDS             282379..283821
                     /locus_tag="PPUBIRD1_RS01200"
                     /old_locus_tag="PPUBIRD1_0236"
                     /EC_number="1.2.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016705020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent succinate-semialdehyde
                     dehydrogenase"
                     /protein_id="WP_003255867.1"
                     /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPK
                     MGTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPL
                     AEAKGEIAYAASFIEWFAEEAKRIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPA
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGG
                     ELTGNSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFIVFDDADLDKAVEG
                     AIISKYRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEEGTTTGPLIDG
                     KAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPL
                     FRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPF
                     GGIKASGLGREGSKYGIEDYLEIKYLCISV"
     gene            284004..285281
                     /locus_tag="PPUBIRD1_RS01205"
                     /old_locus_tag="PPUBIRD1_0237"
     CDS             284004..285281
                     /locus_tag="PPUBIRD1_RS01205"
                     /old_locus_tag="PPUBIRD1_0237"
                     /EC_number="2.6.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-aminovalerate aminotransferase DavT"
                     /protein_id="WP_003255866.1"
                     /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGREL
                     IDFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDF
                     DKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPA
                     PKELMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFP
                     LAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTA
                     GLREIQKKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGT
                     YGNVLRILVPLTAEDALLDKGLAIIEECFAEIA"
     gene            285419..286678
                     /locus_tag="PPUBIRD1_RS01210"
                     /old_locus_tag="PPUBIRD1_0238"
     CDS             285419..286678
                     /locus_tag="PPUBIRD1_RS01210"
                     /old_locus_tag="PPUBIRD1_0238"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_014589314.1"
                     /translation="MSAAAPTPPSVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGS
                     QALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGVPFILMSNRNDSASVREALPL
                     HPTAYLSKPLNLDNLRKRLQELLLAVGEEIACPIPALQAGASLPAYLEQRRATADGGP
                     LLADVQVAINRALNPQGLNLRVLEEEVRNDPQVTAVLIAAANSAALHRDAPVQTLLQA
                     LNKLGSTQSMNLILGMTLKRSARLSDPLLAEHATRYWDLSLHTAEYGRTLARMLELDE
                     GRCYCAGLLHCLGDLAVLRCLQEWRLAGGDLDERNVQQSLEEFGAAFGSALRTRWRLP
                     LALRELIAAIYQLGGGVYSREILAMNLAGQLSRLPAEQGLEKVASGKTARLLKLGLPE
                     LRRLRKVENPEVKPQEDPPVAGAEVSS"
     gene            complement(286769..287797)
                     /locus_tag="PPUBIRD1_RS01215"
                     /old_locus_tag="PPUBIRD1_0239"
     CDS             complement(286769..287797)
                     /locus_tag="PPUBIRD1_RS01215"
                     /old_locus_tag="PPUBIRD1_0239"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016497527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_014589315.1"
                     /translation="MLAARFHVETCSVHMAKNIPTIFPGTPPPEAAQTLLALLHAQGE
                     VARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWR
                     DSIYPDDLEFAERSLAQVLLKGAVEDREYRILNADGQLRWLSDKCYINQQHDGDRVII
                     VGIAEDITEKKQLEGELQRLATTDVLTQSSNRRHFFECAQQAFDSARADGTPLAFLLL
                     DIDDFKRINDSYGHQEGDQVLQHIADSGKAVLRRGDLFGRIGGEEFAAVFPGCNAQVA
                     EQIAERLQRQIQHLSFSHGQQTYGVTVSQGLTGLTDEDVALDSLYARADAAMYQAKRQ
                     GKNQIVRG"
     gene            complement(287897..289081)
                     /locus_tag="PPUBIRD1_RS01220"
                     /old_locus_tag="PPUBIRD1_0240"
     CDS             complement(287897..289081)
                     /locus_tag="PPUBIRD1_RS01220"
                     /old_locus_tag="PPUBIRD1_0240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019473677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_014589316.1"
                     /translation="MWYNGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALEL
                     NGALKHFFRFWLWLTTAQNTREWTAVHRKHHAKCETPDDPHSPVYKGLGTVLRKGAEL
                     YREEARNPETLRIYGKNCPDDWIERNLYSRYKLGGIALMAVIDLLLFGTLGITIWAVQ
                     MMWIPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKL
                     SVKRWEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKASLDMDTAMAILNNRFQIMA
                     QYRKLVIGPLVKQELARVDASVRHRFRRAKRLLSRETSLLEDRHHVRIESMLAHSQAL
                     KTIYEKRLALQQIWARTSANGHDMLAAMKDWVHEAETSGIQALRDFAAQLKTYSLRPT
                     GA"
     gene            289228..291123
                     /locus_tag="PPUBIRD1_RS01225"
                     /old_locus_tag="PPUBIRD1_0241"
     CDS             289228..291123
                     /locus_tag="PPUBIRD1_RS01225"
                     /old_locus_tag="PPUBIRD1_0241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_014589317.1"
                     /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHSMTDDPLALTVGR
                     QINVVVWVLLSALLIYVSRVRLLNFIGHGARLRCEDRERLRMAAAVFDSTLEGVLVTD
                     RQGLIVHVNRAFMRITGYQQDEVIGQRPSKFKSGHHGLAFYQEVFATLAEKGEWSGEI
                     WNRRKSGEIYPQWQTICAIRDDEGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGL
                     PNRLLFTDRVEQALAAAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLG
                     EVLGNGVTLARLGGDEFGVLVENCQQVGQAGKLAQCIIERMREPFQFEGNRLFISASV
                     GISLYPSDALGAEQLLRNADSALYKAKSNGRACYALYTEELTAHAQHRVETAAELRRA
                     LEQDELRVYFQPVHDLASGRQVGVETLVRWQHPRRGLVPPGEFIPIAERTGLIAEIDT
                     WVLQQACRQMVQWQAQGRQLTFVGVNISSRLFGQHELYRQVAEVLHDTGLAPALLELE
                     VTESAVMEDPEVALEQLHRLRELGVTLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVA
                     GLPVDEDDIAIVRVIIALARSMGMQVHAEGIEQAEQASFLLQEECQLGQGYWFGRPVP
                     AEDLRWD"
     gene            complement(291151..291795)
                     /locus_tag="PPUBIRD1_RS01230"
                     /old_locus_tag="PPUBIRD1_0242"
     CDS             complement(291151..291795)
                     /locus_tag="PPUBIRD1_RS01230"
                     /old_locus_tag="PPUBIRD1_0242"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017736886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_014589318.1"
                     /translation="MWIDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIF
                     EARLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFA
                     RIAEVSLREVDHGLVEAAQAMGCRRRHIIWHVLLPEALPGIVGGFTITLVTLINSSAM
                     AGAIGAGGLGDIAYRYGYQRFDSQIMLTVIAMLVALVALIQLGGDRLAKGLNKR"
     gene            complement(291785..292894)
                     /locus_tag="PPUBIRD1_RS01235"
                     /old_locus_tag="PPUBIRD1_0243"
     CDS             complement(291785..292894)
                     /locus_tag="PPUBIRD1_RS01235"
                     /old_locus_tag="PPUBIRD1_0243"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589319.1"
                     /note="Methionine import ATP-binding protein metN2;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_014589319.1"
                     /translation="MSQANALRAPTPQALPPLAREQALRPEVNEAHVRFIGLGKTYPG
                     QAQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEKPSQGRVLIDQVDIALFD
                     EDHLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPKAERQRKVRELLELVGLQ
                     EKHHVYPAQLSGGQKQRVGIARALVHSPEILLCDEATSALDPETTASILELLRDINQR
                     LGLTIVLITHEMAVIRDICHRVVVLERGAVVEQGEVWRVFGSPRHEVTRTLLAHLQAK
                     LPAALQASLQARPASGNSAVVLKLTVLGEPELSALFNDLGGRVRLLQGGVETIGEHAL
                     GQLILSVQHSPHDTHQLLERARRWAEDVEVLGHVD"
     gene            complement(292896..293696)
                     /locus_tag="PPUBIRD1_RS01240"
                     /old_locus_tag="PPUBIRD1_0244"
     CDS             complement(292896..293696)
                     /locus_tag="PPUBIRD1_RS01240"
                     /old_locus_tag="PPUBIRD1_0244"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589320.1"
                     /translation="MLEKLFRPVAAIAITLGLCAGALAAEPLKIGTTSAFAIPLEAAV
                     EEAHKRGLEVKLIEFSDWIAPNVSLNSGDIDANYFQHIPFLENAKAAAGFNLVPYAPG
                     IINNVGLYSKKYKSFAELPEGASVAIANDPINSGRGLLLLAKAGLITLKPGVGYKATE
                     DDIVANPKKLKILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKE
                     YVIQFVIRPQSKDDPRLAKFVDIYQHSPAVRAALNKAHGKLYQAGWEG"
     gene            complement(293689..295074)
                     /locus_tag="PPUBIRD1_RS01245"
                     /old_locus_tag="PPUBIRD1_0245"
     CDS             complement(293689..295074)
                     /locus_tag="PPUBIRD1_RS01245"
                     /old_locus_tag="PPUBIRD1_0245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951604.1"
                     /note="Dibenzothiophene desulfurization enzyme A; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5,N10-methylene tetrahydromethanopterin
                     reductase"
                     /protein_id="WP_014589321.1"
                     /translation="MAKQILLNAFNMNCIGHINHGLWTHPRDTSTQYKTLDYWTNLAR
                     LLERGLFDGLFIADIVGTYDIYGQSLDVTLKESIQLPVNDPLLLVSAMAAVTRHLGFG
                     LTANLTYEAPYLFARRLSTLDHLSNGRVGWNIVTGYLDSAARAMGLAQQPEHDRRYDQ
                     ADEYLQVLYKLLEGSWADDAVVADREHRVYASPDKVRKVQHQGEFYKVEGYHLCEPSP
                     QRTPVLFQAGSSQRGLAFAGNHAECVFISGQDKAATRAQVDKVRAATQAAGRDPQAVK
                     VFMGITVIVAATEQLAQAKHAEYLRHASAEAGVAHFAASTGIDFAAYELDQPIAFSQG
                     NAIQSATRQLQDNAWTRRRLLQQHALGGRYVTLVGAPEQVAEQLIAWIDETGLDGFNL
                     TRTVTPESFEDFIELVIPQLQQRGRYKTAYTEGTLREKLFQADRPHLPADHPGSAYRF
                     TPAPTGALHHA"
     gene            complement(295074..296255)
                     /locus_tag="PPUBIRD1_RS01250"
                     /old_locus_tag="PPUBIRD1_0246"
     CDS             complement(295074..296255)
                     /locus_tag="PPUBIRD1_RS01250"
                     /old_locus_tag="PPUBIRD1_0246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576379.1"
                     /note="Dibenzothiophene desulfurization enzyme C; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SfnB family sulfur acquisition oxidoreductase"
                     /protein_id="WP_014589322.1"
                     /translation="MTIAIITSDAQALAVAEDIAQQLRRDSALRDRERRLPLAELELF
                     TRSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSP
                     EQQQRLYAEVLAGRRFGNALAELGTKTAHERTTRLSRDGDGFRINGRKFYSTGAIYAQ
                     RIPTSVVDEQGIQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVP
                     FQSVFERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPL
                     TLKSFGHLAVRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLT
                     AGTTLFELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAVGNYYLNDANPPRRGT
                     I"
     gene            complement(296398..297639)
                     /locus_tag="PPUBIRD1_RS01255"
                     /old_locus_tag="PPUBIRD1_0247"
     CDS             complement(296398..297639)
                     /locus_tag="PPUBIRD1_RS01255"
                     /old_locus_tag="PPUBIRD1_0247"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268586.1"
                     /note="Dibenzothiophene desulfurization enzyme C; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SfnB family sulfur acquisition oxidoreductase"
                     /protein_id="WP_014589323.1"
                     /translation="MPSQANTQFHSDLDSSPPLLPAKVLRNDAEALQAARELAKVARE
                     QAARRDQQRKLPWAEIELFTRSGLGSISVPKAYGGPDVSFATVAEVFRLISAADPALG
                     QIPQNQFGMLQLLRLTASEAQQALIFRSVLDGWRIGNAGPERGTRDTLTLKARITRAG
                     DSYRISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGSPGLRIVDDWSGFGQRTT
                     ASGTVLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVR
                     EKSRPWIEANVERASDDPYVIADIGRLKLELHAAEALLRKAARVLDEVNAAPIDADAA
                     ARASIAVAEAKVLTTEIALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRW
                     KYHAVGAYHLNGTLPARHSWI"
     gene            complement(297953..298711)
                     /locus_tag="PPUBIRD1_RS01260"
                     /old_locus_tag="PPUBIRD1_0249"
     CDS             complement(297953..298711)
                     /locus_tag="PPUBIRD1_RS01260"
                     /old_locus_tag="PPUBIRD1_0249"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019096908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-cystine ABC transporter ATP-binding protein
                     YecC"
                     /protein_id="WP_003255850.1"
                     /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFL
                     RCLNLLETPDAGQIQIGAISIDANRPLGGQQGAIRRLRQQAGFVFQNFNLFPHRTALE
                     NVIEGPVIVKKTPREQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAME
                     PEVILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKG
                     VIVEQGEAKALFAAPKEERTRQFLRKFLGTAASE"
     gene            complement(298714..299382)
                     /locus_tag="PPUBIRD1_RS01265"
                     /old_locus_tag="PPUBIRD1_0250"
     CDS             complement(298714..299382)
                     /locus_tag="PPUBIRD1_RS01265"
                     /old_locus_tag="PPUBIRD1_0250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016714445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_003255849.1"
                     /translation="MIAESLQLVVDSAPFLLKGAGYTVLLSVGGMFFGLVLGFALALM
                     RLSKILPLNWLARVYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAA
                     YICEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKD
                     TALAATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQH
                     DQEH"
     gene            complement(299379..300173)
                     /locus_tag="PPUBIRD1_RS01270"
                     /old_locus_tag="PPUBIRD1_0251"
     CDS             complement(299379..300173)
                     /locus_tag="PPUBIRD1_RS01270"
                     /old_locus_tag="PPUBIRD1_0251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystine transporter subunit"
                     /protein_id="WP_014589324.1"
                     /translation="MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGL
                     EGTYPPFSFQDENGKLTGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVV
                     NQVTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYE
                     QWVKKDVPQADVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTQLAGDAFS
                     RLESGVAMRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
     gene            300483..301415
                     /locus_tag="PPUBIRD1_RS01275"
                     /old_locus_tag="PPUBIRD1_0252"
     CDS             300483..301415
                     /locus_tag="PPUBIRD1_RS01275"
                     /old_locus_tag="PPUBIRD1_0252"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="WP_003255846.1"
                     /translation="MSEQPSSAHWQLQSIVTGLRGAREQWRTRNGRSIGEQGGRELPS
                     REAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLAQARLELRYAAR
                     QSKAELAGVDARALSLIQGFAAALPELRVLLDTDVLAAYHGDPAARSVDEVLLCYPGI
                     LAIIHHRLAHHLYKAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGE
                     TAIIGERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIG
                     KGSTIGGNVWLTRSVPAESNITQANLQLDCQDKN"
     gene            301686..303688
                     /locus_tag="PPUBIRD1_RS01280"
                     /old_locus_tag="PPUBIRD1_0254"
                     /pseudo
     CDS             301686..303688
                     /locus_tag="PPUBIRD1_RS01280"
                     /old_locus_tag="PPUBIRD1_0254"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795000.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="choline transporter"
     gene            complement(303813..304646)
                     /locus_tag="PPUBIRD1_RS01285"
                     /old_locus_tag="PPUBIRD1_0256"
     CDS             complement(303813..304646)
                     /locus_tag="PPUBIRD1_RS01285"
                     /old_locus_tag="PPUBIRD1_0256"
                     /EC_number="1.14.11.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016714449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine dioxygenase"
                     /protein_id="WP_014589327.1"
                     /translation="MSLTITPLSPALGAQISGVDLSRDISAEERDAIEQALLQHQVLF
                     LRDQPINPEQQARFAARFGDLHIHPIYPNVPDTPQVLVLDTAVTDVRDNAVWHTDVTF
                     LPTPALGAVLSAKQLPAYGGDTLWASGIAAFEALSAPLREMLDGLTATHDFTKSFPLE
                     RFGTTPQDLARWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDA
                     LLRLLFAHATRPEFSIRWRWQEHDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAP
                     F"
     gene            complement(304695..305534)
                     /locus_tag="PPUBIRD1_RS01290"
                     /old_locus_tag="PPUBIRD1_0257"
     CDS             complement(304695..305534)
                     /locus_tag="PPUBIRD1_RS01290"
                     /old_locus_tag="PPUBIRD1_0257"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019472326.1"
                     /note="Taurine transport system permease protein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter permease"
                     /protein_id="WP_014589328.1"
                     /translation="MSSLDLPVAGKHDAQTRPAATLRRPLSTRWISTLTLASLLLVWW
                     LVTAAGWVEPLFLPSPGDILSKAWTLLTQGYMDASLWQHLGASLGRIGLALVAATLTA
                     IPVGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAP
                     IAIATATGVRTVDPAKLRAAQSLGATKAQLIRHVILPSALPDILTGIRIGLGVGWSTL
                     VAAELIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHG
                     QIH"
     gene            complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_RS01295"
                     /old_locus_tag="PPUBIRD1_0258"
     CDS             complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_RS01295"
                     /old_locus_tag="PPUBIRD1_0258"
                     /EC_number="3.6.3.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951613.1"
                     /note="Taurine import ATP-binding protein tauB; Part of
                     the ABC transporter complex tauABC involved in taurine
                     import; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine import ATP-binding protein TauB"
                     /protein_id="WP_014589329.1"
                     /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGK
                     TSLLNLIAGFVAPSGGHITLDGVPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELA
                     GVPRAQREAKAREMLTLVDLNGFGERRIWQLSGGQKQRVGLARALAADPRLLLMDEPF
                     GALDAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQ
                     LNFGQRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQERA"
     gene            complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_RS01300"
                     /old_locus_tag="PPUBIRD1_0259"
     CDS             complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_RS01300"
                     /old_locus_tag="PPUBIRD1_0259"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016497544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003255840.1"
                     /translation="MIPHAPLRLFAALTLASTSWLAQAADLTVAYQTTVDPAKVAQVD
                     GDYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIAT
                     QIGAGEALVARDSIKSPQDLIGKKVAVPFVSTGHYSLLAALKSWNIDPSKVQILNLAP
                     PAIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFAEK
                     HPDVVKAFAKVTLDAYADYRKDPKAWLADKGNVDKLVKLSGAKASDIPVLLEGNVYPL
                     AADQANALGAPTTQALTDTANFLKQQGKVEAVLPDYSPYVSAKFLPN"
     gene            307779..309119
                     /locus_tag="PPUBIRD1_RS01305"
                     /old_locus_tag="PPUBIRD1_0260"
     CDS             307779..309119
                     /locus_tag="PPUBIRD1_RS01305"
                     /old_locus_tag="PPUBIRD1_0260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin, OprD family"
                     /protein_id="WP_014589330.1"
                     /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNR
                     EDHAKPGAERPDQRESGQGFKLDYISGFTQGTVGFGVDAQALWGIHLDGGEGYHKSGF
                     FPDDGKGSAAQWARFGANAKARFSKTEAHFGSALAPNLPILVSNDGRLLPQTFEGGTI
                     QSKEIDNLTINAGQLTHAMGRASSNRTGLSVAGSNAESNKFRYGGLDYKLTPDLTLQY
                     YYSNLEDFYKQHFLGATHVFKIADDQSFKTDLRYFDSSSDGKNGNDSAYNFNNNGGYA
                     KNTGEIDNKTWSAMFTYTLGGHALMLGHQQVGDDGGFVWLNQGSLSNDSGTSEGAGGS
                     SFYLFTDSMINQFARAGENTTFGQYSYDFAALGVPGLKASVAYLRGDDIRNKSGSGTY
                     NEWERDARIDYTLQEGALKGLGFSLRQGVYRGAGESSSDQDQARFIVNYTYSFL"
     gene            309285..309923
                     /locus_tag="PPUBIRD1_RS01310"
                     /old_locus_tag="PPUBIRD1_0261"
     CDS             309285..309923
                     /locus_tag="PPUBIRD1_RS01310"
                     /old_locus_tag="PPUBIRD1_0261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase"
                     /protein_id="WP_003255836.1"
                     /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPV
                     CTTELGLTAKLKDEFAKRGVKAIALSVDPVDSHHKWIDDINETQNTVVNFPIIADADR
                     KVSDLYDLIHPNASDTLTVRSLFIIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLT
                     DNHKVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
     gene            310143..310736
                     /locus_tag="PPUBIRD1_RS01315"
                     /old_locus_tag="PPUBIRD1_0262"
     CDS             310143..310736
                     /locus_tag="PPUBIRD1_RS01315"
                     /old_locus_tag="PPUBIRD1_0262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent FMN reductase"
                     /protein_id="WP_003255835.1"
                     /translation="MLVVSIGGSPSLRSRSGVLLERSRQWLQDRGVEVVTFQVRDFPA
                     EDLLHARFDSPHVQHFQQLVAQADGLIVSTPVYKASFSGALKTLLDLLPERALAHKIV
                     LPIATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVAYAEGTKPAQLVQALE
                     ERLHDSLETFHVALARRPRPVAPGVLNERLISARWSI"
     gene            310822..311787
                     /locus_tag="PPUBIRD1_RS01320"
                     /old_locus_tag="PPUBIRD1_0263"
     CDS             310822..311787
                     /locus_tag="PPUBIRD1_RS01320"
                     /old_locus_tag="PPUBIRD1_0263"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009400141.1"
                     /note="ABC-type transporter periplasmic sulfonate-binding
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589331.1"
                     /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLL
                     KAKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLL
                     YVAYEPPAPHSEAILVPKGSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSD
                     IQPVYLPPADARAAFERGSVDAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLAT
                     RNYATQHPAVINTVIEEVRAVGEWSQANPQEVTDQVAPLLGLPADITLTSVKRQGYGA
                     APLTPDVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
     gene            311847..312995
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_RS01325"
                     /old_locus_tag="PPUBIRD1_0264"
     CDS             311847..312995
                     /gene="ssuD"
                     /locus_tag="PPUBIRD1_RS01325"
                     /old_locus_tag="PPUBIRD1_0264"
                     /EC_number="1.14.14.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_252134.1"
                     /note="Alkanesulfonate monooxygenase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_014589332.1"
                     /translation="MSLNIFWFLPTHGDGKYLGTSEGARAVDHGYLQQIAQAADRLGF
                     GGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGR
                     ALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGA
                     KLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVRKKAAAQ
                     GREVRFGIRLHVIVRETNEAAWAAAERLISHLDDDTISRAQASLARFDSVGQQRMAAL
                     HGGNRDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGIDTFIFSGYPH
                     LEESYRVAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
     gene            313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_RS01330"
                     /old_locus_tag="PPUBIRD1_0265"
     CDS             313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_RS01330"
                     /old_locus_tag="PPUBIRD1_0265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257431.1"
                     /note="part of the ABC type transport system for
                     alkanesulfonate SsuABC; SsuB the ATP-binding subunit and
                     SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter"
                     /protein_id="WP_003255831.1"
                     /translation="MSRATSSNLTQRLAPWALPVLLLAIWQLAVSAGWLSTRILPAPS
                     AVVSAGVELVRSGEIWTHLAISGWRAGLGFVIGGSIGLVLGFITGLSNWGERLLDSSV
                     QMIRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMAR
                     SYGLSGFGLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNARE
                     FLQTDVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVARKEGA"
     gene            313800..314612
                     /locus_tag="PPUBIRD1_RS01335"
                     /old_locus_tag="PPUBIRD1_0266"
     CDS             313800..314612
                     /locus_tag="PPUBIRD1_RS01335"
                     /old_locus_tag="PPUBIRD1_0266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237939.1"
                     /note="Aliphatic sulfonates import ATP-binding protein
                     ssuB; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonate ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_014589333.1"
                     /translation="MTVLKEQPPRLLRGTPLASKGLRKTFGQREVLKGIDLHIPAGQF
                     VAIVGRSGCGKSTLLRLLAGLDQPSAGQLLAGAAPLEEAREETRLMFQDARLLPWKKV
                     IDNVGLGLSGDWRPRALEALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLL
                     LDEPLGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGL
                     DLTVDLARPRARGSHRLAALESEVLNRVLSTPGTAPEPDPVAPLPTQLRWAH"
     gene            314640..314855
                     /locus_tag="PPUBIRD1_RS01340"
                     /old_locus_tag="PPUBIRD1_0267"
     CDS             314640..314855
                     /locus_tag="PPUBIRD1_RS01340"
                     /old_locus_tag="PPUBIRD1_0267"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007163030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_003255829.1"
                     /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTR
                     SVRELELQVGSEVIAFVKSTEVSIAKL"
     gene            complement(314998..315630)
                     /locus_tag="PPUBIRD1_RS01345"
                     /old_locus_tag="PPUBIRD1_0268"
     CDS             complement(314998..315630)
                     /locus_tag="PPUBIRD1_RS01345"
                     /old_locus_tag="PPUBIRD1_0268"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_010951618.1"
                     /translation="MNRTTTPRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAE
                     RAQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPIDSSAFSTWHELSRLIEQRM
                     LDIYHEDAAARQLILAQHGLSEVVQADRQHDMELGDLMHKLFDQHFHLPVMPPDVDVF
                     ALAMELSDRVYARSVQLHEAITPRMAEEGKRVFEAYLGLYLPPFLAKRSS"
     gene            complement(315630..317222)
                     /locus_tag="PPUBIRD1_RS01350"
                     /old_locus_tag="PPUBIRD1_0269"
     CDS             complement(315630..317222)
                     /locus_tag="PPUBIRD1_RS01350"
                     /old_locus_tag="PPUBIRD1_0269"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016986274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_041166819.1"
                     /translation="MKEYILSELLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRL
                     AQTPHPEALGSALTNEQITTDYSESLLEFITPALADPAKVLESLEETHRFVYSKLGDE
                     YLWSPSMPCTLPAEEDIPIAEYGSSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSL
                     PEALWPLLREAEGSTENDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGR
                     PHQLEELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYP
                     PYVEIGTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVR
                     CLDINPFLPVGIDLTEARFLDAFLLFCALEDSPQLDNGECGQCTSNFLTVVKEGRRPG
                     LELHRNGQPISLKDWASELIERIRQLANLLDQAQGTDEHAKALDAQQAKVDDTSLTPS
                     AQVLARMTEHDESFVQFSLRQSRVHAETFREQPLSNEKQQAFETLARESLARQSELEQ
                     DEVGDFDLFVGAYQASILAISS"
     gene            complement(317361..317744)
                     /locus_tag="PPUBIRD1_RS01355"
                     /old_locus_tag="PPUBIRD1_0270"
     CDS             complement(317361..317744)
                     /locus_tag="PPUBIRD1_RS01355"
                     /old_locus_tag="PPUBIRD1_0270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_010951620.1"
                     /translation="MDVPREYVESAFSQLLGCRLQHLDSGVAEVALALEPQLRNRGQK
                     LHGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRR
                     TLVVDADVVQGDKLVAKAQGTFAVL"
     gene            complement(317744..320068)
                     /locus_tag="PPUBIRD1_RS01360"
                     /old_locus_tag="PPUBIRD1_0271"
     CDS             complement(317744..320068)
                     /locus_tag="PPUBIRD1_RS01360"
                     /old_locus_tag="PPUBIRD1_0271"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding transcriptional accessory protein"
                     /protein_id="WP_014589335.1"
                     /translation="MDSINSRIAEELGVRPQQVEAAVSLLDEGSTVPFIARYRKEVTG
                     SLDDTQLRHLEERLRYLRELDERRASILSSIEEQGKLTPELAREIKLADTKTRLEDLY
                     LPYKQKRRTKGQIALEAGLGELADGLFNDPTLAPESEAARFVNAEKGVADVKAALEGA
                     KYILMERFAEDAALLDKLRSYLKQEAVLSARVVAGKEEEGAKFRDYFAHDELLRTAPS
                     HRALAIFRGRNEGVLSVSLKVGEELPGTLHPCELMIGNHVGIENRSRPADKWLGEVVR
                     WTWKVKLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRT
                     GCKIAVVDATGKLLDHTTVYPHAPKNDWDRTISIMAALCAKHSVELIAIGNGTASRES
                     DKLVAELVKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQD
                     PLAELVKIDPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRIS
                     GLNATLAQNIVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAV
                     HPEAYPLVQRIAADTDRDIRSLIGDSSFLKRLDPKKFTDETFGLPTVTDILQELDKPG
                     RDPRPEFKTATFQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALS
                     EKFVKDPREAVKAGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVEGNRGGNRGNGGN
                     RQPQAPRQRETATAAPANNAMASLFANAKQLKKK"
     gene            320286..321026
                     /locus_tag="PPUBIRD1_RS01365"
                     /old_locus_tag="PPUBIRD1_0273"
     CDS             320286..321026
                     /locus_tag="PPUBIRD1_RS01365"
                     /old_locus_tag="PPUBIRD1_0273"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020795794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_012270052.1"
                     /translation="MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTE
                     QMDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLE
                     LGADDYLGKPFNPDELMARVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKR
                     GDEVHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMI
                     EPDPSKPRYIQTVWGVGYVFVPDGNAGK"
     gene            321040..322353
                     /locus_tag="PPUBIRD1_RS01370"
                     /old_locus_tag="PPUBIRD1_0274"
     CDS             321040..322353
                     /locus_tag="PPUBIRD1_RS01370"
                     /old_locus_tag="PPUBIRD1_0274"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007925244.1"
                     /note="integral membrane sensor signal transduction
                     histidine kinase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_014589336.1"
                     /translation="MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDR
                     QYSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAE
                     LGDDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLST
                     ASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQA
                     GRERELMLAGVSHDLRTPLTRLRLSLSLLNSDNELSDDMVRDIEDMDAILDQFLAFIR
                     DGRDEPVEEVDLADLVREVVAPYNQPVERVRLCLEPIPPFPLRRVSLKRMLGNLIGNA
                     LHHAGKGVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGT
                     GLGLAIVKRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
     gene            complement(322451..323356)
                     /locus_tag="PPUBIRD1_RS01375"
                     /old_locus_tag="PPUBIRD1_0275"
     CDS             complement(322451..323356)
                     /locus_tag="PPUBIRD1_RS01375"
                     /old_locus_tag="PPUBIRD1_0275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007161257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6--L-glutamate ligase"
                     /protein_id="WP_003255817.1"
                     /translation="MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIASH
                     KPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLR
                     SLQLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETPQAA
                     ESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGG
                     VASLIKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGK
                     NVAGMIIEHLEKNGGPNQTRTKGKG"
     gene            complement(323353..323835)
                     /locus_tag="PPUBIRD1_RS01380"
                     /old_locus_tag="PPUBIRD1_0276"
     CDS             complement(323353..323835)
                     /locus_tag="PPUBIRD1_RS01380"
                     /old_locus_tag="PPUBIRD1_0276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018608792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc protease"
                     /protein_id="WP_004576370.1"
                     /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEV
                     EPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSSNGHAQTRYVIRTSLALG
                     DGVWEVEFTLACRKNMRYRLLLGSKALIHGQLVVNPGLKYVQDKPAFPATLSPVTGAA
                     "
     gene            323945..324346
                     /locus_tag="PPUBIRD1_RS01385"
                     /old_locus_tag="PPUBIRD1_0277"
     CDS             323945..324346
                     /locus_tag="PPUBIRD1_RS01385"
                     /old_locus_tag="PPUBIRD1_0277"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016497557.1"
                     /note="RNA-binding S4 domain protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein S4"
                     /protein_id="WP_014589337.1"
                     /translation="MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGER
                     CKPGKEPRVGDEFLLRTGFDERTVVVKALSVVRRGAPEAQALYEETEESVRRREQAAE
                     MRKAGAMGVTTDGRPTKKQRRQIHQLHGSYD"
     gene            complement(324374..325168)
                     /locus_tag="PPUBIRD1_RS01390"
                     /old_locus_tag="PPUBIRD1_0278"
     CDS             complement(324374..325168)
                     /locus_tag="PPUBIRD1_RS01390"
                     /old_locus_tag="PPUBIRD1_0278"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_014589338.1"
                     /translation="MDNRPLFQARWSWGPLAACTLLPIALLCFWIWPFGQILCLTFDE
                     WLFRSLNAPLADSTTWRYIWTIGSLRPFDIVVGLILLAVLIRGDWVFKATQVRQAFFG
                     FLVTLLLLVVIRALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEAAWELKDRSSK
                     SFPGDHASVLLIWALFMSVFSRGLAQYLVVWGLAALFMLPRLVAGAHWGQDDYIGGLL
                     MAVLALGWSYYTPLAAKGSEALMRWTAPLFKLLSTLPLVGRMAVLR"
     gene            325289..326188
                     /locus_tag="PPUBIRD1_RS01395"
                     /old_locus_tag="PPUBIRD1_0279"
     CDS             325289..326188
                     /locus_tag="PPUBIRD1_RS01395"
                     /old_locus_tag="PPUBIRD1_0279"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008099002.1"
                     /note="33 kDa chaperonin; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="redox-regulated molecular chaperone Hsp33"
                     /protein_id="WP_014589339.1"
                     /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPV
                     KVLLGELMAATALLVGAMKFDGLLILQARSAGPIPLLMVECSSEREIRGMARYEADQI
                     PAGATLSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWL
                     NAAGGKARGLLLQQLPRDRQPDDEEREDSWQHVVALAKTLKPEEWTEGNETLLHRLYH
                     EDAVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDECGGTVEIDCQFCNERYF
                     FDASDVAQLFAGGGTDVASETRH"
     gene            326368..327909
                     /locus_tag="PPUBIRD1_RS01400"
                     /old_locus_tag="PPUBIRD1_0280"
     CDS             326368..327909
                     /locus_tag="PPUBIRD1_RS01400"
                     /old_locus_tag="PPUBIRD1_0280"
                     /EC_number="4.1.1.49"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750189.1"
                     /note="Phosphoenolpyruvate carboxykinase [ATP]; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase (ATP)"
                     /protein_id="WP_014589340.1"
                     /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTG
                     RSPADRFIVEEPSTQDAIAWGPINRKFPADKFDALWDRVEAFNNAQDHFVSYVHVGAA
                     AEHYLPVKMTTQTAWQNLFGRCLFINPEQYNPAGRGEWQVLNVANFVCEPERDGTNSD
                     GCVIINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLF
                     FGLSGTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAI
                     KHGAVLENVVLDANKHADYSDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCD
                     LTGVLPPVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGE
                     YAELLIKRINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEH
                     LDIINLDVPKAVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKA
                     AGPQL"
     gene            328191..328631
                     /locus_tag="PPUBIRD1_RS01405"
                     /old_locus_tag="PPUBIRD1_0281"
     CDS             328191..328631
                     /locus_tag="PPUBIRD1_RS01405"
                     /old_locus_tag="PPUBIRD1_0281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014589341.1"
                     /translation="MTEALQRIAFSHFHPILTRPQDNDLNGHIAGATVHSFFETAIQA
                     FLVEQAELDLRHGELAAFVVSSAADFYALPGFPDLLEVGLGVTRLAGSTVEYRLALYR
                     PGEPEACAAGTVVQVFIERDSGRPVALPEALQVILSGLVLERQA"
     gene            complement(328688..329170)
                     /locus_tag="PPUBIRD1_RS01410"
                     /old_locus_tag="PPUBIRD1_0282"
     CDS             complement(328688..329170)
                     /locus_tag="PPUBIRD1_RS01410"
                     /old_locus_tag="PPUBIRD1_0282"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020189999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951626.1"
                     /translation="MKKYSSILLLSFSLLSGVAMAGGTTEAGIGGALGGVLGSVVGNS
                     IGGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIG
                     AAAGGGAGGALGNYLGKEADKDDYRDGRRYRRGYDDDRRHWDRGHHYGHRKHKRHWRD
                     "
     gene            complement(329367..331712)
                     /locus_tag="PPUBIRD1_RS01415"
                     /old_locus_tag="PPUBIRD1_0283"
     CDS             complement(329367..331712)
                     /locus_tag="PPUBIRD1_RS01415"
                     /old_locus_tag="PPUBIRD1_0283"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_019438881.1"
                     /translation="MTSYQQFPDNTPASPPRYKPYHGPAGGWGALRSVAKAWAGSDNA
                     LKNIRALLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDAAFFAR
                     YSVTSLLQQSDYWLEYQGRLTEPMVYDAPSDRYLPISWDAAFALIARELNKLANPDQA
                     EFYTSGRASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALGQSVGVGKGTVTFDD
                     FEHADAIFVWGQNPGTNHPRMLDPLRDAVKRGAQVVCINPLKERGLERFQHPQNPLEM
                     LTNSDRPTNTAFFRPALGGDMAMLRGMAKFVLQWEREAQANGEPAVFDHAFIAEHGHG
                     VDEYLAVVDATPWSHIQAQSGLSLADIELAARMYCRGKRVIMCWAMGITQHRHSVPTI
                     QEIVNLQMLRGNIGVPGAGLCPVRGHSNVQGDRTMGINERPPEALLDAIEKRFGFPVP
                     RRNGHNTVEAIHAMLDGRAKVFIGLGGNFAQATPDTERTAQALRNCELTVHISTKLNR
                     SHLVHGKQALILPCLGRTDIDLQAEGPQAVTVEDSFSMVHASNGQLKPLSTQMRSEPA
                     VIAGIAAATLGKQPVDWHWLVADYDRIRDLIGDTIAGFSGFNQRLRHPGGFYLGNSAA
                     SREWATSTGRANFKANLLPDTLLDERVRASGQLPDLIMQSMRSHDQYNTTIYGLDDRY
                     RGVRGQREVLFANEADIIRLGFQPGQKVDIVSLWGDEHVRRVQGFTLLAFDIPAGQAA
                     AYYPEVNPLVPLESIGVGSHTPTSKFIAIKLERASEDRRIL"
     gene            complement(331718..332548)
                     /locus_tag="PPUBIRD1_RS01420"
                     /old_locus_tag="PPUBIRD1_0284"
     CDS             complement(331718..332548)
                     /locus_tag="PPUBIRD1_RS01420"
                     /old_locus_tag="PPUBIRD1_0284"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase FdhD"
                     /protein_id="WP_019438880.1"
                     /translation="MNSKPPVCAASSPLSMPAASNTYDYVQLSDAKRDSTPLAEEVAL
                     AIVYNGLNQAVMLVSPTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEIS
                     SRAFWNLKNQRRQLAGTSGCGLCGVEALEQALPDLAVLPGAPLPPAQWLVGLRERIDA
                     FQPLGQHCGAVHAALFMDRQGQLLLGREDIGRHNALDKLIGALLRQRIDTQGGLAIVT
                     SRCSLELIQKVLRAGIQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES
                     "
     gene            332724..333164
                     /locus_tag="PPUBIRD1_RS01425"
                     /old_locus_tag="PPUBIRD1_0285"
     CDS             332724..333164
                     /locus_tag="PPUBIRD1_RS01425"
                     /old_locus_tag="PPUBIRD1_0285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014336051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_014589344.1"
                     /translation="MSLFSFVKEAGEKLIDLLTPGNANADEQLKKHVEAVGLGNPNIT
                     ATVEGDKIILKGEVASQEEKEKIILAAGNINGVACVDDQITVTGPVVKAARFVTVKKG
                     DTLSAISVVVYGNANQYNKIFEANKPMLSHPDKIYPGQVLRIPE"
     gene            complement(333276..333938)
                     /locus_tag="PPUBIRD1_RS01430"
                     /old_locus_tag="PPUBIRD1_0286"
     CDS             complement(333276..333938)
                     /locus_tag="PPUBIRD1_RS01430"
                     /old_locus_tag="PPUBIRD1_0286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008098990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_003255795.1"
                     /translation="MPVLPWSAIDTVLLDMDGTLLDLHYDNRFWLDHLPQRYAELHGV
                     SRAMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKREIADLIALRPDADTFLA
                     AIRQAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQAD
                     IGFEPERSLFIDDTLAILRSARRFGVGHLLAVRQPDSKAGPRDTEEFAAVEDYRELLV
                     GL"
     gene            334003..334569
                     /locus_tag="PPUBIRD1_RS01435"
                     /old_locus_tag="PPUBIRD1_0287"
     CDS             334003..334569
                     /locus_tag="PPUBIRD1_RS01435"
                     /old_locus_tag="PPUBIRD1_0287"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP compounds hydrolase NudE"
                     /protein_id="WP_003255794.1"
                     /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGAERTYERLVGRGN
                     GYGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGF
                     GARQLEHLTELSLSPGYMSQKIQVVLASDLYEERLEGDEPEPMRVDKVNLRELSALAM
                     HPQFTEGRALAALYLARDLLIQRGLLEL"
     gene            334566..335384
                     /gene="cysQ"
                     /locus_tag="PPUBIRD1_RS01440"
                     /old_locus_tag="PPUBIRD1_0288"
     CDS             334566..335384
                     /gene="cysQ"
                     /locus_tag="PPUBIRD1_RS01440"
                     /old_locus_tag="PPUBIRD1_0288"
                     /EC_number="3.1.3.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019438879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="WP_014589345.1"
                     /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAAD
                     LAAHRVIADGLLALAPQIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEF
                     TVNIALIENGDVVFGVVSMPTNGRCYFGGRGMGAWRADAGEAPQLIQVRNAPAQGERF
                     TVVASRRHSSPEQEALLAGLGAAVGDLELANIGSSLKFCLLAEGSADCYPRLAPTSQW
                     DTAAAQGVVEGACGEVIGLDGLPFRYPPRESLLNPYFLALPANAAWRQAFLNLI"
     gene            complement(335545..336000)
                     /locus_tag="PPUBIRD1_RS01445"
                     /old_locus_tag="PPUBIRD1_0289"
     CDS             complement(335545..336000)
                     /locus_tag="PPUBIRD1_RS01445"
                     /old_locus_tag="PPUBIRD1_0289"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014589346.1"
                     /translation="MSTDSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANV
                     NHKSTMFGGSLYCAAVLVGWGWLHLRLRELGINDGHIVIQEGQISYPLPVTGTAVARC
                     TAPDKKTWERFLAMYQRRGRARLPLETTVSNAGSDEPAVKFSGQYVLHR"
     gene            complement(336000..337406)
                     /locus_tag="PPUBIRD1_RS01450"
                     /old_locus_tag="PPUBIRD1_0290"
     CDS             complement(336000..337406)
                     /locus_tag="PPUBIRD1_RS01450"
                     /old_locus_tag="PPUBIRD1_0290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_014589347.1"
                     /translation="MTTETLIDSRAQVILVDDDPHLRQALSQTLDLAGLKVVALAEAQ
                     GLAERIEADWPGVVVSDIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMR
                     AGAYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAML
                     RLREQIGALAGTRADVLILGETGAGKEVVARALHDLSSRSEGPFVAINAGALAESVVE
                     SELFGHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERL
                     GGNQLIPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLF
                     QHFADAASQRHGLSPHALQPAQRALLLRHDWPGNVRELQNAAERFALGLELALDGQAP
                     SAAAPAAPMLSGNLSEQVEQFERSLIAAELAQPHGSMRSLAEALGIPRKTLHDKLRKH
                     GLNFDGGSGGHDDQEDNR"
     gene            complement(337403..339217)
                     /locus_tag="PPUBIRD1_RS01455"
                     /old_locus_tag="PPUBIRD1_0291"
     CDS             complement(337403..339217)
                     /locus_tag="PPUBIRD1_RS01455"
                     /old_locus_tag="PPUBIRD1_0291"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019438877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_014589348.1"
                     /translation="MIAKPTPPRRPRWRSLALLALSLAPLLWPLHHLAERYYQEELAS
                     QNRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQ
                     QTGAEVMYLMDVSGNTLAASNWDKHDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSA
                     KRGYFFAAAVRDRERIVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWR
                     FRATRTLTDAERQAIIAIQPYPTQAPQPLVLNPQAWITQTRDIKETGWQVSILAPRTL
                     VDRSVQTVMAIGAGTLLVLMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAERTADL
                     EGLNTRLKNAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSY
                     AENAEILLDHQRTEDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALD
                     DALALLAKRRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRR
                     LWLSAEQRDDCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRA
                     LGGELLLANHPEGGAMLTLQLRVAASGATLPNSEDPSA"
     gene            complement(339260..339805)
                     /gene="rfbC"
                     /locus_tag="PPUBIRD1_RS01460"
                     /old_locus_tag="PPUBIRD1_0292"
     CDS             complement(339260..339805)
                     /gene="rfbC"
                     /locus_tag="PPUBIRD1_RS01460"
                     /old_locus_tag="PPUBIRD1_0292"
                     /EC_number="5.1.3.13"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019096884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="WP_014589349.1"
                     /translation="MNIIPTAIPEVLIIEPKVFADSRGFFFEAFNAREFSQQTGVNVA
                     FVQDNHSRSIKGVLRGLHYQVANTQGKLVRVVHGEIRDIAVDVRKSSPTFGKWVAVHL
                     SADNHRQLWIPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLDIDWGLQQ
                     PPLLSDKDKVGLPLAEAELLP"
     gene            340082..341188
                     /gene="aguA"
                     /locus_tag="PPUBIRD1_RS01465"
                     /old_locus_tag="PPUBIRD1_0293"
     CDS             340082..341188
                     /gene="aguA"
                     /locus_tag="PPUBIRD1_RS01465"
                     /old_locus_tag="PPUBIRD1_0293"
                     /EC_number="3.5.3.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484426.1"
                     /note="Agmatine deiminase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_014589350.1"
                     /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQ
                     AAHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVI
                     NDHGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKLLEMERCQRYQTEGFVLEGGSI
                     HVDGEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLF
                     ATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILARI
                     FPDHEVVMIPGRELLLGGGNIHCLTQQQPAPVKR"
     gene            341381..341578
                     /locus_tag="PPUBIRD1_RS25990"
     CDS             341381..341578
                     /locus_tag="PPUBIRD1_RS25990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011953221.1"
                     /translation="MNAASESALRPSAVDRQSLRLLAKRLKHHGSIRVRTTDPRRLLA
                     GRYPQGLISEAEMQALMAVWH"
     gene            complement(341645..343714)
                     /locus_tag="PPUBIRD1_RS01470"
                     /old_locus_tag="PPUBIRD1_0294"
     CDS             complement(341645..343714)
                     /locus_tag="PPUBIRD1_RS01470"
                     /old_locus_tag="PPUBIRD1_0294"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020190007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_014589351.1"
                     /translation="MLVPCRLSPLTLGLSLLFSASLASAATTTLPESSVTADSEREKD
                     NPRVKEVSTATRTSTPVRYVPQAIDTVKTANVLDYGSNTLGKALEGIPNVSSGADTRF
                     DSVRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRV
                     SKAPEPGRRSTIEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFRDGIDGSR
                     QLFAPSISWQITPDLNWLVQYEYSRYNRTPDRGIPSVNGRPADVSRSATYGDNRDYID
                     DRAQSLRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVTGYNAGTNTLTRQRWQQDLN
                     TRNLFNNLEAEGDFDTLGLEHKLLLGLEFGNQRRDPLLYSAGSQSLPGLGKPSQPHNG
                     TLAVSSNNHTVVDSRGVYLQDQIRLNDQWQVLAGVRFDQFEVETTNKDGVREPQDSNS
                     TSPRLGVVYTPWRDHSFYASWSKTFSPVGGGLIGITPGAPGNTNKTDPEETRQKEIGV
                     KSDWLDQRLTTTLAIYELELYNRRTRDPNDPNIILLSGMQRSRGIELTATGNIVGNWY
                     VRGGIGLQDAIIVKDNNGQEGNRINDVAKRNGSLFVTWKPELGWYAETGLTLVGERYA
                     DNQNTTVLPGYGRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRSLV
                     VTGSYSF"
     gene            344189..345508
                     /locus_tag="PPUBIRD1_RS01475"
                     /old_locus_tag="PPUBIRD1_0295"
     CDS             344189..345508
                     /locus_tag="PPUBIRD1_RS01475"
                     /old_locus_tag="PPUBIRD1_0295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019438875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane porin, OprD family"
                     /protein_id="WP_003255784.1"
                     /translation="MLKTRISLVALAMIAATQAQANDQADSKGFIEDSHANVLLRNAY
                     INRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGV
                     DFFKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLP
                     ESFTGTLITSKEIQGLELNAGRFTQEARKSAERRDGGGLKSINVLGGSYKFTDNFTAS
                     LYTADNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDINNKYVKAAGLNGDSNTIW
                     SLAATYAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAED
                     ERSWQLGYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYV
                     VQDGPAKDLSIKLRSSFLRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
     gene            complement(345634..346590)
                     /locus_tag="PPUBIRD1_RS01480"
     CDS             complement(345634..346590)
                     /locus_tag="PPUBIRD1_RS01480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="WP_014589352.1"
                     /translation="MGKYTEQFKLTAITAYLDGSNGFRKVAQHLGIDFSLLRRWVARY
                     QANNGIGPGSHGRRYSSDFKQQVLSYMHEHRLSLRQTAAHFGLGQSSQIGIWQRQYYS
                     GSPAPSTAIKPRKPIDVSKKIKPVNSVVRPKKYRSYRGTVGKVAANVLERNFVAQRPN
                     QKWVTDVTEFKVAQQKLYLSPVMDLYNGEIVAYEMASRPCYSLVGNMLGKALDCLGEK
                     PKLVLHSDQGWHYQQAQYRRKLSECGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLK
                     RFESIDELRAGLDEYIHYYNHDRIKLRLNGLSPVEYRAQAAA"
     gene            complement(346695..348365)
                     /locus_tag="PPUBIRD1_RS01485"
                     /old_locus_tag="PPUBIRD1_0297"
     CDS             complement(346695..348365)
                     /locus_tag="PPUBIRD1_RS01485"
                     /old_locus_tag="PPUBIRD1_0297"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding glutamate synthase family protein"
                     /protein_id="WP_014589353.1"
                     /translation="MKHSLPSHYACLVLCLVFTFASLPLLAQHAWLWPVTLITALLSL
                     VGLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYA
                     RAKNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRMPYSASIF
                     NISAMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGC
                     RTEDGRFDPQRFAEQARSAQVKMIEIKLSQGAKPGHGGILPGHKVSPEIAETRGVRAG
                     EDCISPAAHSAFRTPVELLQFVAGLRELSGGKPVGFKFCLGHPWEFMGIAKAMLATGI
                     TPDFIVVDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIV
                     SAFDIASVLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPD
                     KAERVASFHRNTLHALAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPG
                     ELLSGSIESEFYARMWRMARSDSFAPETGDTATRTVASRLRHEETEPA"
     gene            complement(348567..349934)
                     /locus_tag="PPUBIRD1_RS01490"
                     /old_locus_tag="PPUBIRD1_0298"
     CDS             complement(348567..349934)
                     /locus_tag="PPUBIRD1_RS01490"
                     /old_locus_tag="PPUBIRD1_0298"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_014589354.1"
                     /translation="MRWFHRLWPRTLFGQLLLIMVSGTLVIQLMSSSIWFDVRFAQAL
                     EVPVRLVAARSAPLIAQADCHGGTLQAPSHYQLRCVESLPAQEHDERRGHRRVELLLQ
                     QALKYELGRAQDVRLMNVQLTDELGQPIVWRSLFGLRTAQAHIQFAVPLPDGQWLTVA
                     GQELQGWSGESAWVLISDYLLRVYALRIVAVLLVCLVAVRLCLRPLRRLADAARGLGS
                     NLEQPPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMRLRL
                     ERLHDDEHRQRLRQNITQMDDMIGQVLDYLRAGEQQNLQQVDLDRLVARQCADLATAE
                     EPLTVHGKAGSLRVDALLLQRCLQNLLVNALRYAKNISVTLERATTGVFIHIDDCGPG
                     IAPGLLATITDPFVRGDGSRNQASGGYGLGLSIAQRIAASHGGELMLSNRESGGLRVS
                     ILLPG"
     gene            complement(349936..350655)
                     /locus_tag="PPUBIRD1_RS01495"
                     /old_locus_tag="PPUBIRD1_0299"
     CDS             complement(349936..350655)
                     /locus_tag="PPUBIRD1_RS01495"
                     /old_locus_tag="PPUBIRD1_0299"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436731.1"
                     /note="winged helix family two component transcriptional
                     regulator; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_014589355.1"
                     /translation="MSTTLLVVDDDDEIRELLCDYLTDAGYNVLAAADGQQMRDQLAR
                     HKVELVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAK
                     PFEPRELIARIKAVLRRPQRLGTSAEEPVVDAQLFAGFRLEHVKRLLTRPDGETLTLP
                     RSDYRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGAA
                     QILTIRNEGYLLSIAPLAAGA"
     gene            350796..353093
                     /locus_tag="PPUBIRD1_RS01500"
                     /old_locus_tag="PPUBIRD1_0300"
     CDS             350796..353093
                     /locus_tag="PPUBIRD1_RS01500"
                     /old_locus_tag="PPUBIRD1_0300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014860377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_041166820.1"
                     /translation="MNPQSITTVFTPFSQSGNCLKPLAFCVAVAISGGAVAANGKPLE
                     LDATQIEDSALLPADDAGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIH
                     TIEQALETAPGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMD
                     LYERIDIVRGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNL
                     PLSEDGRLRSRFVMTQQDANSFRDNQSERSRAALANFAFDLDDATTLGAGYQYEYNKV
                     VGGGWGANIPIWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLK
                     AAQATTEALNHRGLAKVNSAGRGSYGGYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSG
                     PFQLFGRTHQAMVGYNDSRTVGWSPQYTCTMVGGGMTSAPALGCQFRANNGFPVTDWH
                     NGVDDDYDLIASRTGLHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVA
                     GERSSQEENGIVTPYLGAVYDLNDNYSVYASYTDIFTPQTSETSSGSKVEPIRGQSYE
                     TGIKGEWFDGRLNASAAYFRTKQENKAVLDGDLTTPTGGNAYKAGSGQETDGIDLEVA
                     GALTPNWNVYAGYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQT
                     NIRAISSPAGQPTNGVSNGATDVNWSGYAIWNAMAKYQLTDETSVSLNANNLFDKHYY
                     TQYGFYAGAIYGDPRNLSLTVSTAF"
     gene            complement(353258..353464)
                     /locus_tag="PPUBIRD1_RS01505"
                     /old_locus_tag="PPUBIRD1_0301"
     CDS             complement(353258..353464)
                     /locus_tag="PPUBIRD1_RS01505"
                     /old_locus_tag="PPUBIRD1_0301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014860378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589357.1"
                     /translation="MAKRFPTTPRHPERICWGCDLYCPAKALACGNGADRTMHPVELF
                     GEDWDSFEGQLEKPIDPGQAVKPR"
     gene            353645..355255
                     /locus_tag="PPUBIRD1_RS01510"
                     /old_locus_tag="PPUBIRD1_0302"
     CDS             353645..355255
                     /locus_tag="PPUBIRD1_RS01510"
                     /old_locus_tag="PPUBIRD1_0302"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_085983373.1"
                     /translation="MVPHSTGKRGVSYDPPQRRQRRDIPSIVRRVTLGVVVVWLALVA
                     SLGGWIVQRLTAEELDNLAAGAEYEAQITGRVVDRLFTEMASVANMVARQSEVIQLAA
                     RYRHDPPGFAALTREERASKFTRDPLVRSVGDFMDRLASDLHYGRIYMNNLSDDTVTA
                     SNWAESFSIVGQIYTGRAYLIDALRTGSGEMFGIARLNKTPSYFVASRIDDADGKPLG
                     SVTVKFDAPDIALYLTGRHIALIVNRQGRVTTASSELFMLRNVVTLLPPDIRRPLDGD
                     EEPGEPMDIRAVADAGQANQWLIDGHPYLVHRQPLNDAQYQLLTLAKLDHLQPMRQQY
                     YWTGASVAALGLILILLSSRVAGQMLLRRQEERYAANYDALTGLKNRRAILAALHRHF
                     ALAKRTGQGVLVAFIDLDEFKAINDTYGHEVGDKFLIESSRRLQGGLRASDELGRWGG
                     DEFVVIGLTASVHPDEMAKTAAAMRRRLVPLLIGSYEFDDCRFDYAGASFGITSVDPA
                     ATSLQAALKVADQLMYADKEVRRGLRRV"
     gene            complement(355337..355412)
                     /locus_tag="PPUBIRD1_RS01515"
                     /old_locus_tag="PPUBIRD1_t0063"
     tRNA            complement(355337..355412)
                     /locus_tag="PPUBIRD1_RS01515"
                     /old_locus_tag="PPUBIRD1_t0063"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(355377..355379),aa:Thr,seq:tgt)
     gene            complement(355511..355759)
                     /locus_tag="PPUBIRD1_RS01520"
                     /old_locus_tag="PPUBIRD1_0303"
     CDS             complement(355511..355759)
                     /locus_tag="PPUBIRD1_RS01520"
                     /old_locus_tag="PPUBIRD1_0303"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589359.1"
                     /translation="MTRATPLALLTFALALTGCAGGTSPHPNSNLGWNHPGMQLGGDN
                     GLPLRTEAPCRKRGCDNDKLFFNPGKSEPSVTTMHRGW"
     gene            356284..356574
                     /locus_tag="PPUBIRD1_RS01525"
                     /old_locus_tag="PPUBIRD1_0304"
     CDS             356284..356574
                     /locus_tag="PPUBIRD1_RS01525"
                     /old_locus_tag="PPUBIRD1_0304"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589360.1"
                     /translation="MKTIDADPNSPKSITTAGVETFLAAGNPSLNLLRVEPGIPIDAA
                     YEHVSILMGYIKHLVREGDMEDDHKFLGAADYLCDMAKALMNDIEIAKGKAH"
     gene            complement(356855..358060)
                     /locus_tag="PPUBIRD1_RS01530"
                     /old_locus_tag="PPUBIRD1_0305"
     CDS             complement(356855..358060)
                     /locus_tag="PPUBIRD1_RS01530"
                     /old_locus_tag="PPUBIRD1_0305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014589361.1"
                     /translation="MPSPLHSHHLSTRFQALDQFLIEHQQLWKPRPFTTLQLPWETTH
                     PELAAHLRQCSLADAEADSATDRLPAPFPQLAEQARQLATLGSLAQTNLPPAAHRLDV
                     AVPGRKWQQIEAFASHLAFREQPRHWLDWCSGKGHLGRRLLQPGQHLTCLEYDADLVA
                     AGQALSAHHHLQAQHVHQDVMASDSARHLADDKSVVALHACGDLHVRLLQLASQQGCR
                     QLAIAPCCYNRIAAQQYQALSTAAQASSLQLSLDDLGLPLSETVTAGARVRRQRDTSM
                     ARRLGFDLLQRQQRQSDEYLPTPSLPVAWLDKPFEQYCRDLAELKQLPVSGNPDWAML
                     EAAGWQRLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYDVRLGLFCDYPLTPRN
                     LLILAERDG"
     gene            complement(358172..358861)
                     /locus_tag="PPUBIRD1_RS01535"
                     /old_locus_tag="PPUBIRD1_0306"
     CDS             complement(358172..358861)
                     /locus_tag="PPUBIRD1_RS01535"
                     /old_locus_tag="PPUBIRD1_0306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014589362.1"
                     /translation="MNWEVIFKWLPRLAEGAVLTLELVAIAVVAGLILAIPLGIARSS
                     RHWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTM
                     TLHTAAYIAEILRGALQSIPKGEIEAARALGMSRGKALFYIMLPRAARIGLPAYSNEV
                     ILMLKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFMLVQGFKLLE
                     RWLRVDACQGR"
     gene            complement(358861..359553)
                     /locus_tag="PPUBIRD1_RS01540"
                     /old_locus_tag="PPUBIRD1_0307"
     CDS             complement(358861..359553)
                     /locus_tag="PPUBIRD1_RS01540"
                     /old_locus_tag="PPUBIRD1_0307"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016714491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003255749.1"
                     /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSP
                     LKPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIA
                     LGLCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNL
                     FMILMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVLAMTGMHFM
                     EKRAARGFARAE"
     gene            complement(359608..360360)
                     /locus_tag="PPUBIRD1_RS01545"
                     /old_locus_tag="PPUBIRD1_0308"
     CDS             complement(359608..360360)
                     /locus_tag="PPUBIRD1_RS01545"
                     /old_locus_tag="PPUBIRD1_0308"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003187758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_014589363.1"
                     /translation="MHTYKKFLLAAAATLVMTANAMAAEKLRMGIEAAYPPFNNKDAS
                     GNVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAV
                     DFTEPYYSNKLQFIAPKNVDFKTDKASLKGKVIGTQRATLAGTYLEDNYPDVDVKLYD
                     TQENAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDT
                     KLRDDLNKALAEIKADGTYKKINDKYFPFSIE"
     gene            complement(360372..361145)
                     /locus_tag="PPUBIRD1_RS01550"
                     /old_locus_tag="PPUBIRD1_0309"
     CDS             complement(360372..361145)
                     /locus_tag="PPUBIRD1_RS01550"
                     /old_locus_tag="PPUBIRD1_0309"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_003255746.1"
                     /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGS
                     GKSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLIAADNRQINRLRSEIGFVFQN
                     FNLWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQ
                     RAAIARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARH
                     VSSEVVFLHQGLVEEQGSPQQVFENPTSARCKQFMSSHR"
     gene            361596..361787
                     /locus_tag="PPUBIRD1_RS25995"
                     /pseudo
     CDS             361596..361787
                     /locus_tag="PPUBIRD1_RS25995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755062.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            361777..363162
                     /gene="gabP"
                     /locus_tag="PPUBIRD1_RS01555"
                     /old_locus_tag="PPUBIRD1_0311"
     CDS             361777..363162
                     /gene="gabP"
                     /locus_tag="PPUBIRD1_RS01555"
                     /old_locus_tag="PPUBIRD1_0311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020190016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GABA permease"
                     /protein_id="WP_003255745.1"
                     /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGP
                     AVLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWV
                     LVIPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVL
                     AIIGFIAVGCAALFGFVPSSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEI
                     VTIAAAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVL
                     SRIGVPNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPH
                     VAVLLSTAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAVSQLRMRAQREARG
                     EKITFKMWLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRK
                     REAAGRAALDS"
     gene            complement(363401..363844)
                     /locus_tag="PPUBIRD1_RS01560"
                     /old_locus_tag="PPUBIRD1_0312"
     CDS             complement(363401..363844)
                     /locus_tag="PPUBIRD1_RS01560"
                     /old_locus_tag="PPUBIRD1_0312"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016497596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589364.1"
                     /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKASAGDSASVEQVY
                     NKAMESGSYDAMFNKMKEAQEGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFN
                     AYRKWLDGADEETTMAWLESDEFQDAYIAASELVAKQQQQQKQFG"
     gene            364084..364311
                     /locus_tag="PPUBIRD1_RS01565"
     CDS             364084..364311
                     /locus_tag="PPUBIRD1_RS01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166821.1"
                     /translation="MKHFYLVTLYSYTDDGRVYYPTGFAGCDEQRITKADIAAIIEKG
                     KHHGQLQLHSISYMGHMTEDAFKHLRSMSDE"
     gene            complement(364500..364575)
                     /locus_tag="PPUBIRD1_RS01570"
                     /old_locus_tag="PPUBIRD1_t0062"
     tRNA            complement(364500..364575)
                     /locus_tag="PPUBIRD1_RS01570"
                     /old_locus_tag="PPUBIRD1_t0062"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(364540..364542),aa:Phe,seq:gaa)
     gene            complement(364666..364938)
                     /locus_tag="PPUBIRD1_RS01575"
                     /old_locus_tag="PPUBIRD1_0314"
     CDS             complement(364666..364938)
                     /locus_tag="PPUBIRD1_RS01575"
                     /old_locus_tag="PPUBIRD1_0314"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_795074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe(2+)-trafficking protein"
                     /protein_id="WP_014589365.1"
                     /translation="MTRTVMCRKYLEELPGLERPPYPGAKGQYIFEHISQKAWADWQK
                     HQTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
     gene            complement(364935..366002)
                     /locus_tag="PPUBIRD1_RS01580"
                     /old_locus_tag="PPUBIRD1_0315"
     CDS             complement(364935..366002)
                     /locus_tag="PPUBIRD1_RS01580"
                     /old_locus_tag="PPUBIRD1_0315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019471299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="A/G-specific adenine glycosylase"
                     /protein_id="WP_014589366.1"
                     /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQ
                     VSTVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGG
                     EFPRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKV
                     ANQLWATAERFTPQQRANHYTQAMMDMGATLCTRSKPSCLICPLQHGCEAHLHGEETR
                     YPEPKPRKALPQRRTLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAY
                     QHGLRLAGRHAMDGLTHTFSHFQLAIEPWLVHVDPVGEHVAEADWLWYNLATPPRLGL
                     AAPVKKLLERAADELIAGDAR"
     gene            complement(365999..368251)
                     /locus_tag="PPUBIRD1_RS01585"
                     /old_locus_tag="PPUBIRD1_0316"
     CDS             complement(365999..368251)
                     /locus_tag="PPUBIRD1_RS01585"
                     /old_locus_tag="PPUBIRD1_0316"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014860391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsmA family protein"
                     /protein_id="WP_014589367.1"
                     /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLAR
                     DKAHVELTLNGDIGWSLFPWLGLELHEASIATLNKPKEPFADLQMLGLSVRVLPLLRR
                     EVQMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAQNGAGTDAPAQAPAQAEQAPATS
                     DSNDRAIKLDIDSLTVNNARVQYTDAKTGHSYSAESIQLSTGPIHEGANIALKTSAFI
                     SASQPNIKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLLVD
                     LAANVASWNGLKVSANQLRALGELNLRDLDKAPQLSGGLSIAQFNLRTFLESIGHPLP
                     ATHDPAAFAKLELVTRLQGTPSSLALEDLAVKLDDSTFSGRVAVEDFAKQALRLQLKG
                     DTFDADRYLPAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDKLL
                     PVDRLRALDLQADLAFGSLTLDKLPIEGAQLKAVGQGGLLTLQTLRGALYNGTFEAKG
                     TVDVRPAVPQLGVNTNIQRVPVEHFIKAEGKEQTPPVKGLLTLTSDLTATGNSQKALV
                     DTLNGSANFAINDGVLVNANLEQQLCQAIATLNRKTLSSEPRGKDTPFQELRGSLVVR
                     NGVASNPDLKARIPGLTVNGHGDLDLRVLGMDYNIGVVVEGDQRAMPDPACQVNERYV
                     GVEVPLRCRGPLELGAKACRLDQNGLGKVAAKLAGNRLKDKIDEKLDEKLGDKVSPEL
                     KDALKGLFNR"
     gene            368520..370181
                     /locus_tag="PPUBIRD1_RS01590"
                     /old_locus_tag="PPUBIRD1_0317"
     CDS             368520..370181
                     /locus_tag="PPUBIRD1_RS01590"
                     /old_locus_tag="PPUBIRD1_0317"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019439080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589368.1"
                     /translation="MTSTVATGTLASEPGFLSKERIIARPGFNRWLVPPAALAIHLCI
                     GMAYGFSVFWLPLSQALGITAPVACAADMGFMARMFSAECDWPISMLSWIYTLFFVFL
                     GCSAAVLGGWLEHAGPRKAGLVSALCWCGGMLLSAIGVKTHQLWLMWLGSGVIGGIGL
                     GLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQ
                     SFVAMAAIYFVFMTAGALAYRVPPTGWKPEGWAAPLKNASNAMVTDRHVHVSVAWKTP
                     QFALIWLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLSTAQLAQIAAIAA
                     GFTGLLSLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVA
                     AFCIILSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLREYQ
                     LAAGVERAAAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGA
                     DGARSLEWKAAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
     gene            370370..370963
                     /locus_tag="PPUBIRD1_RS01595"
                     /old_locus_tag="PPUBIRD1_0318"
     CDS             370370..370963
                     /locus_tag="PPUBIRD1_RS01595"
                     /old_locus_tag="PPUBIRD1_0318"
                     /EC_number="4.2.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_253830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_003255736.1"
                     /translation="MVERKASVERNTLETQVKCSINLDGSGKARFDIGVPFLEHMLDQ
                     IARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKGIFRYGHAYVPLDE
                     ALSRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHALVTLHIDNLRGHN
                     THHQIETVFKAFGRALRMAITLDERMAGQMPSTKGCL"
     gene            370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_RS01600"
                     /old_locus_tag="PPUBIRD1_0319"
     CDS             370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_RS01600"
                     /old_locus_tag="PPUBIRD1_0319"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020308798.1"
                     /note="Imidazole glycerol phosphate synthase subunit hisH;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="WP_014589369.1"
                     /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDASVIREADRV
                     VFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENTGVDCIGL
                     FPGQVRFFGKDLQEEGEHLKVPHMGWNEVSQTIDHPLWHDIPDRARFYFVHSYYINAG
                     KPGQVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFIAWDGRW"
     gene            371603..371863
                     /locus_tag="PPUBIRD1_RS01605"
                     /old_locus_tag="PPUBIRD1_0320"
     CDS             371603..371863
                     /locus_tag="PPUBIRD1_RS01605"
                     /old_locus_tag="PPUBIRD1_0320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-((5-
                     phosphoribosylamino)methylideneamino)imidazole-4-
                     carboxamide isomerase"
                     /protein_id="WP_003255734.1"
                     /translation="MSRSKTKAPTITLAPEQEREALDTLKRFLEDRFELQLGSFEVAE
                     VLELFSKEIAPHYYNRAIADVQLHLKERFESIESDLWALEKP"
     gene            371891..372628
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_RS01610"
                     /old_locus_tag="PPUBIRD1_0321"
     CDS             371891..372628
                     /gene="hisA"
                     /locus_tag="PPUBIRD1_RS01610"
                     /old_locus_tag="PPUBIRD1_0321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008041005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-((5-
                     phosphoribosylamino)methylideneamino)imidazole-4-
                     carboxamide isomerase"
                     /protein_id="WP_003255731.1"
                     /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGC
                     RRLHLVDLNGAFEGQPVNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVI
                     IGTKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLAKRFEADG
                     VSAIVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGII
                     GAITGRAIYEGTLDVAEAQAFCDNYQG"
     gene            372639..373409
                     /locus_tag="PPUBIRD1_RS01615"
                     /old_locus_tag="PPUBIRD1_0322"
     CDS             372639..373409
                     /locus_tag="PPUBIRD1_RS01615"
                     /old_locus_tag="PPUBIRD1_0322"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011058740.1"
                     /note="Imidazole glycerol phosphate synthase subunit hisF;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase cyclase
                     subunit"
                     /protein_id="WP_014589370.1"
                     /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQG
                     ADEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVS
                     INTAAVFNPEFVGEAAERFGSQCIVVAIDAKKVSGPGEAPRWEIFTHGGRKPTGLDAV
                     EWAKKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLAD
                     GILEGHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
     gene            complement(373584..374762)
                     /gene="choV"
                     /locus_tag="PPUBIRD1_RS01620"
                     /old_locus_tag="PPUBIRD1_0323"
     CDS             complement(373584..374762)
                     /gene="choV"
                     /locus_tag="PPUBIRD1_RS01620"
                     /old_locus_tag="PPUBIRD1_0323"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020796090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline ABC transporter ATP-binding protein"
                     /protein_id="WP_010951660.1"
                     /translation="MSIIRFEDVDVIFSNKPREALALLDQGQTREQILKQTGLVVGVE
                     KANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIANCSAAE
                     LKMMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQW
                     RNKKPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLS
                     KTIVFVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNV
                     LCGRSLMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQKWAPGQD
                     VELLERRPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG
                     "
     gene            complement(374759..375604)
                     /gene="choW"
                     /locus_tag="PPUBIRD1_RS01625"
                     /old_locus_tag="PPUBIRD1_0324"
     CDS             complement(374759..375604)
                     /gene="choW"
                     /locus_tag="PPUBIRD1_RS01625"
                     /old_locus_tag="PPUBIRD1_0324"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline ABC transporter permease subunit"
                     /protein_id="WP_003255725.1"
                     /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTS
                     ALTFFNPFVLIALFAALAHFIQRKWALTAFVALSFLLILNLGYWQETMETLAQVTFAT
                     VVCVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLIST
                     VVFAIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCI
                     MLSLSMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELP
                     VRGEA"
     gene            complement(375689..376636)
                     /locus_tag="PPUBIRD1_RS01630"
                     /old_locus_tag="PPUBIRD1_0325"
     CDS             complement(375689..376636)
                     /locus_tag="PPUBIRD1_RS01630"
                     /old_locus_tag="PPUBIRD1_0325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589371.1"
                     /translation="MKGSPSLLLVALLSAPLLAQAAEPEQCQTVRFSDVGWTDITVTT
                     ATTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTV
                     ETVRANLENAKYTLAVPQALYDKGLKDFSDIPKFKKELNGKIYGIEPGNDGNRTIQSM
                     IDKNAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTG
                     GDEFFGPDFGKATVLTNTRKGYTQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPE
                     AAAKKWIKDNPGKLDAWLAGVTTVDGKPGLEAVKAKLTQ"
     gene            377089..378465
                     /locus_tag="PPUBIRD1_RS01635"
                     /old_locus_tag="PPUBIRD1_0326"
     CDS             377089..378465
                     /locus_tag="PPUBIRD1_RS01635"
                     /old_locus_tag="PPUBIRD1_0326"
                     /EC_number="4.3.1.17"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_254066.1"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine ammonia-lyase"
                     /protein_id="WP_014589372.1"
                     /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVK
                     RIEVRLYGSLSATGIGHGTDNATIMGLMGEWPDAIDPTQIVPRIADLRETNTLQLDSR
                     LPIEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASG
                     VLDADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEEDIRAGLYKLWEAM
                     QECVNNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVN
                     EENAAGGRMVTAPTNGAAGIIPAVLHYYMRFSDEVDESSVVDYFLAAAAVGILCKKNA
                     SISGAEVGCQGEVGSACAMAAAGLAEVLGATPAQVENAAEIALEHNLGLTCDPVGGLV
                     QVPCIERNAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGG
                     LAVSAIEC"
     gene            378959..380065
                     /locus_tag="PPUBIRD1_RS01640"
                     /old_locus_tag="PPUBIRD1_0327"
     CDS             378959..380065
                     /locus_tag="PPUBIRD1_RS01640"
                     /old_locus_tag="PPUBIRD1_0327"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005792167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011953240.1"
                     /translation="MTSYTSGNPTQNRTTPQSIGFLLLDNFTLISLASAVEPLRMANQ
                     LSGRELYRWHTLTIDGGQVWASDGLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREH
                     VTWLQAQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRL
                     FTLDRNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKH
                     MLGTNQPKLQEIVALMEANLEEPIDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLK
                     LRLIRARQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVA
                     MMPIPQAMTLSPHSGPMAALSQARNESTFASVRL"
     gene            complement(380187..380444)
                     /locus_tag="PPUBIRD1_RS01645"
                     /old_locus_tag="PPUBIRD1_0328"
     CDS             complement(380187..380444)
                     /locus_tag="PPUBIRD1_RS01645"
                     /old_locus_tag="PPUBIRD1_0328"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009682891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589374.1"
                     /translation="MMHADLIDQDDLAGHLRSRGFDIPAGASAEQACEAVVRGLTEPN
                     ARALKGMVEQMYTGSATILPAVRQAIDKQLLPALAQFNKRA"
     gene            380833..382479
                     /locus_tag="PPUBIRD1_RS26000"
                     /old_locus_tag="PPUBIRD1_0329"
     CDS             380833..382479
                     /locus_tag="PPUBIRD1_RS26000"
                     /old_locus_tag="PPUBIRD1_0329"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557755.1"
                     /translation="MIIVLGATLIMASCSSSTPQTSTVASVVPQLFTLQPTQNRQMLQ
                     KTAKGHLKTLLADPANEEFTLVNVDASLIGGNTENIAITLPNRKAEKFNRRNFNVLAD
                     GYEGWVGYQPSKWKAGRSGAEAEIDFDPEYYMSIIRLGNQLAGNFLVDGQRYRLVYIG
                     SDTHVLIKVDESKLPSEDALGVDVGFPASPALEESQQVSSAYSIIRLLFVSTVQSRAK
                     NPNYRADLMLGLQDVNQIAKNSKVDITYEFAGFIDSAIDEVGKDFGTLLNEVQYNNPA
                     VNAKRVELRADLVSMYVANSEFCGAGKPSSNKTQGFSAINCITSLAHEIGHNFGMTHN
                     WDGQSDNYIHGYRYAPDGGNLRFRTQMSANCSPTCPRVPFYSNPRLSYQGQPLGTVAH
                     HDVARAINERRASIESFYPPMPGVLKNKGRLDQGSTHPCLQDFAGSSIQFVACSPGPQ
                     QKWTLEPWGEAGTFRIVAPGGKCMVARADNYVLAESCPATVKDGLLWMVSAQPDHTLK
                     IQSYNRNLCLGSQPSLKPGPELLTCDNGRYQSWINLDIPQ"
     gene            complement(382524..382994)
                     /locus_tag="PPUBIRD1_RS01655"
                     /old_locus_tag="PPUBIRD1_0330"
     CDS             complement(382524..382994)
                     /locus_tag="PPUBIRD1_RS01655"
                     /old_locus_tag="PPUBIRD1_0330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA thioesterase"
                     /protein_id="WP_014589376.1"
                     /translation="MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGL
                     DADSRGQSGNSLFTLEAHINYLHEVKLATEVWVQTQIIGFDKKRLHLYHSLHRSGFDE
                     ALAASEQLLLHVDLAGPKAKPFGESSTHRLQSVVDDQRDLPTPAFTGRVIKIPS"
     gene            complement(383005..383970)
                     /locus_tag="PPUBIRD1_RS01660"
                     /old_locus_tag="PPUBIRD1_0331"
     CDS             complement(383005..383970)
                     /locus_tag="PPUBIRD1_RS01660"
                     /old_locus_tag="PPUBIRD1_0331"
                     /EC_number="1.1.1.45"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007907534.1"
                     /note="converts (S)-3-hydroxybutanoyl-CoA to
                     3-acetoacetyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="WP_014589377.1"
                     /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQ
                     ALRKRIANAWPALEKQGLAPGASQDRLKFVATIEECVHDADFIQESAPERLDLKLELH
                     AKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT
                     SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDD
                     AIRFGAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDD
                     VVDGTSEQLGEHSIAALERYRDDTLLAVLEAVKTSKASHGMSFGD"
     gene            complement(384133..385017)
                     /locus_tag="PPUBIRD1_RS01665"
                     /old_locus_tag="PPUBIRD1_0332"
     CDS             complement(384133..385017)
                     /locus_tag="PPUBIRD1_RS01665"
                     /old_locus_tag="PPUBIRD1_0332"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009396916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-5-aminohexanoate cleavage protein"
                     /protein_id="WP_003255710.1"
                     /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGAT
                     VVHCHVRDPQTGRFSRDVNLYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAF
                     GPGTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELG
                     VKAELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANV
                     TWAGFGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMG
                     GRVLSPAEGREKMNLKRR"
     gene            complement(385141..386085)
                     /locus_tag="PPUBIRD1_RS01670"
                     /old_locus_tag="PPUBIRD1_0333"
     CDS             complement(385141..386085)
                     /locus_tag="PPUBIRD1_RS01670"
                     /old_locus_tag="PPUBIRD1_0333"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020193115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589378.1"
                     /translation="MHSLIRRSLLPLALSSIVATPLFAAEPAACKNVRLGVVNWTDVI
                     ATSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDAN
                     QVKVLDKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQI
                     KAMITKNQFDLGKFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLG
                     DSQDALGPDEGRATVWTVTAPDYAERCPNAHRLLANLKFSAEDESRMMQPLLDHKDAL
                     ESARQWLKDHPEDKARWLEGVTTFDGKPAADNLKLTAN"
     gene            386230..387177
                     /locus_tag="PPUBIRD1_RS01675"
                     /old_locus_tag="PPUBIRD1_0334"
     CDS             386230..387177
                     /locus_tag="PPUBIRD1_RS01675"
                     /old_locus_tag="PPUBIRD1_0334"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_019436921.1"
                     /translation="MMETIAFLLVPGFSAMGFISAVEPLRVANRFGGQLYRWQVLSLD
                     GEAVLASNGMSINADAALGEGEPANILLVVAGFEPLANVAPKLLHALRRLNHEAVMLG
                     GIDTGAMVLAEAGLLEGYRATLHWEALEAFKERYPGLQATQELFEIDRSRITCAGGTA
                     SIDLMLHLIAQSHGSELAVKVSEQFVLGRIRQRQDHQRMQIGARYGISNKKLVHAIGE
                     MEKHIEPPLTTLELAAAIKVTRRQLERLFRMHLDATPSGFYLGLRLDKARQLLAQTDM
                     SVTEVSLACGFELPSYFTRRYKLRFGRCPREERRPSGTK"
     gene            complement(387181..387798)
                     /locus_tag="PPUBIRD1_RS01680"
                     /old_locus_tag="PPUBIRD1_0335"
     CDS             complement(387181..387798)
                     /locus_tag="PPUBIRD1_RS01680"
                     /old_locus_tag="PPUBIRD1_0335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589380.1"
                     /translation="MGDTSLDTRIFEERLSIKPAPWLTLDTWEDLQLCLRYSQAVANE
                     KYSMETQPQQWFTVARATLQSLKFTLFEHTHRTIVYEPNLLALSDVYSGYLPPPREKG
                     PWFKSLEENVQAALQSAGTRTFTVMNASSHLSIEMDHEGDHVPVAILFYAYCITDPVE
                     PTRKLNLVFDHLGARFNAAGFAPLREDLQARNREKLRAILERELD"
     gene            complement(387872..388564)
                     /locus_tag="PPUBIRD1_RS01685"
                     /old_locus_tag="PPUBIRD1_0336"
     CDS             complement(387872..388564)
                     /locus_tag="PPUBIRD1_RS01685"
                     /old_locus_tag="PPUBIRD1_0336"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589381.1"
                     /translation="MADIKVEMEKIRKEGQERVAATGQTICIFADNVPANIAEDILAG
                     MRLMTELANKKFDKETQQREWYNFYNDGLIKFGWTMTGAAHAEDAIDEDNLTLAELIT
                     KSVTISVSADPRRAACARRVLQIVVQKPEVKAHLEKHSHSESGKSSNFVVAQCEMTPQ
                     GLPAMHMTSFQASYDSKVEREGALTRKVDKTSTRVYRASQQGTFSVRHFDAARDLVNE
                     KIKGDLGAFLAI"
     gene            complement(388703..389119)
                     /locus_tag="PPUBIRD1_RS01690"
                     /old_locus_tag="PPUBIRD1_0337"
     CDS             complement(388703..389119)
                     /locus_tag="PPUBIRD1_RS01690"
                     /old_locus_tag="PPUBIRD1_0337"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589382.1"
                     /translation="MKSMAWLVLLAIVSGAQAGEEESTPCDNVENDQQTFACAAFNKQ
                     VAERELQSAYDDLVARMRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSN
                     AYQIAWNSCIAQRSDERAEYLRSLGSQNSDEPAPED"
     gene            389405..390382
                     /locus_tag="PPUBIRD1_RS01695"
                     /old_locus_tag="PPUBIRD1_0338"
     CDS             389405..390382
                     /locus_tag="PPUBIRD1_RS01695"
                     /old_locus_tag="PPUBIRD1_0338"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane dipeptidase"
                     /protein_id="WP_003255700.1"
                     /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVW
                     EGFKATVDNIASSQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQI
                     AYVDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHV
                     GSKTSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLA
                     KGIDSTIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFG
                     KIINPLGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
     gene            390458..390988
                     /locus_tag="PPUBIRD1_RS01700"
                     /old_locus_tag="PPUBIRD1_0339"
     CDS             390458..390988
                     /locus_tag="PPUBIRD1_RS01700"
                     /old_locus_tag="PPUBIRD1_0339"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003432482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255698.1"
                     /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHMGIEEV
                     LGADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDID
                     LDKGTCSVKLKHSAFVYVYGKCGRKVDYMFTGWFAGAMDQILAARGSKIRTVAEQVYG
                     GSEEGHEDGLFVTKPL"
     gene            391004..393064
                     /locus_tag="PPUBIRD1_RS01705"
                     /old_locus_tag="PPUBIRD1_0340"
     CDS             391004..393064
                     /locus_tag="PPUBIRD1_RS01705"
                     /old_locus_tag="PPUBIRD1_0340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-methylproline demethylase"
                     /protein_id="WP_003255697.1"
                     /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKY
                     YEEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIM
                     IQITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAK
                     EGGLDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDF
                     CVGMRICGDEFHPDGLSHEDMKQIAAYYDATGMLDFIGVVGSGCDTHNTLANVIPNMS
                     YPPEPFLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLI
                     AKIKMGQIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRK
                     VVVVGAGPAGMEAARVAAERGHDVTLFEKRDQIGGQITIAAKAPQRDQIAGITRWYQL
                     ELARLKVDLRLGTAADVAAIQDLRPDVIVLAVGGHSFLEQNEHWGAAEGLVVSSWDVL
                     DGKVAPGKNVLVYDTICEFTGMSVADFIADKGSQVEIVTDDIKPGVAMGGTTFPTYYR
                     SMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEELY
                     YALKEGSRNKGQIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRL
                     CKDF"
     gene            393243..395195
                     /locus_tag="PPUBIRD1_RS01710"
                     /old_locus_tag="PPUBIRD1_0341"
     CDS             393243..395195
                     /locus_tag="PPUBIRD1_RS01710"
                     /old_locus_tag="PPUBIRD1_0341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008057105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="WP_014589383.1"
                     /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRPSKVNLIGGLLA
                     MPRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAVLAILVHGFGLQSKILGYALLVAT
                     VIMFTGAIFVFKRRLNPPSRLSKGPWMRLPKSLLAFAVSFFIATLPVAGILPANTGGW
                     VMVAVLGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLD
                     LEDPNAPLGVEKPVDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIG
                     LAGGTDAQFAGSPYPGKPIGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIE
                     HVDAIVDMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLQLLSE
                     VKATEVLFWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEA
                     TFQQLAKRNIQTLAKYKFQRIVTCDPHSFHVLKNEYGALGGDYQVQHHSTYIAELIAA
                     KKLNLGQHKGGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGG
                     GGAPITDIPGKQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELV
                     ADVLIEEDASTVPKPQTAKREPAEVH"
     gene            395195..396427
                     /locus_tag="PPUBIRD1_RS01715"
                     /old_locus_tag="PPUBIRD1_0342"
     CDS             395195..396427
                     /locus_tag="PPUBIRD1_RS01715"
                     /old_locus_tag="PPUBIRD1_0342"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017847884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/FixB family protein"
                     /protein_id="WP_014589384.1"
                     /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTSWMGPNGIIRKNP
                     HAIAAGFVGPAGIKRIDRSGAQQGTGAGGRRTAAAEVKLPLHQVAAPAFYIAVVPDMV
                     GGRLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKESNFSTAGVDRLLVIEGEAFEGYA
                     PEQLVQGLRAVDNQFAPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQVKDGQCIG
                     RAGAGQQDLQRAVPRLILAAAECAEPVSETRHEALPVELSTSVVRSLPRIEDLGSVAV
                     DPATIAMAEAEFIVSGGNGVKDWDLYHKATAALGATEGASRVAVDDGFMPRNRQVGAT
                     GTWVTARVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILK
                     ALIEAVDNYRSGGQRDAA"
     gene            396438..397208
                     /locus_tag="PPUBIRD1_RS01720"
                     /old_locus_tag="PPUBIRD1_0343"
     CDS             396438..397208
                     /locus_tag="PPUBIRD1_RS01720"
                     /old_locus_tag="PPUBIRD1_0343"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003177593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="WP_003255694.1"
                     /translation="MSTKVISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVV
                     HAGDPQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGE
                     GSGMLPFLLAEKLGWPLIVGLAEVESIDNGTAQVLQALPRGQRRRLKVRLPLLATVDN
                     AAPKPRQSAFGPARRGVLAARNVAIVEDELLAEAELQPARPRPKRLKVIKAKSGADRM
                     KAATAKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
     gene            397831..398718
                     /locus_tag="PPUBIRD1_RS01725"
     CDS             397831..398718
                     /locus_tag="PPUBIRD1_RS01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014860940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RHS repeat-associated core domain-containing
                     protein"
                     /protein_id="WP_041166823.1"
                     /translation="MHGMLQPVIPTHMGGIPRSYSAYGAYAGARNIAFAGQMVDRLTG
                     CYHLGNGRRTYNPVLMRFHSADSLSPFSDGGLNAYAYCNGDPINRVDPSGAYPVTSAR
                     NRVDVISPAISGISMFSSSVTLGGAVARTARNVVADLQSQHSGAEYTAPSLRSRIGNT
                     SLFYTGVMGVAGTAMSGVEQGWIGNVLTSHGRRLGLGNAIGNISGGLFSNAEAAQAVW
                     RGVGQPGVSGVRVAWETVYEVTGVRMVFEGASYVWGRSMALGARIASAGRAAADAWRR
                     WGTEPSAPPQSPNRDIRRP"
     gene            complement(398762..400054)
                     /locus_tag="PPUBIRD1_RS01730"
                     /old_locus_tag="PPUBIRD1_0344"
     CDS             complement(398762..400054)
                     /locus_tag="PPUBIRD1_RS01730"
                     /old_locus_tag="PPUBIRD1_0344"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic ring-hydroxylating dioxygenase subunit
                     alpha"
                     /protein_id="WP_014589386.1"
                     /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLF
                     QIDMQEIFHKEWLIAGMTCEIPAKGNYITLQIGKNPIIVVRGAEGKVHAFHNVCRHRG
                     SRLCVSEKGKVAKLVCPYHQWTYELDGRLLFAGTEMGADFDMNQYGLKPVNVKVAGGY
                     IFISLAENPPAIDEFLATLDHYMEPYDMENTKVAVQTTLMEKANWKLVLENNRECYHC
                     NGSHPELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRM
                     PLLKGTVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPIS
                     AQETMVTTKWLVHKDAVEGVDYNPENMRKVWDATNDQDRRLAEENQRGINSTAYQPGP
                     YSKTYEFGVVNFIDWYSGRLLNNLGAEPAPYLKEVQAQ"
     gene            complement(400095..400328)
                     /locus_tag="PPUBIRD1_RS26820"
     CDS             complement(400095..400328)
                     /locus_tag="PPUBIRD1_RS26820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014340585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein GbcA"
                     /protein_id="WP_085983374.1"
                     /translation="MALFMAAIMRKLKATHIPACDIDVLIATSPVAQGLARRYSNRPC
                     RPWIRFAASSDAHSTAKELAVLSEAALRHHNND"
     gene            400350..401450
                     /locus_tag="PPUBIRD1_RS01735"
                     /old_locus_tag="PPUBIRD1_0346"
     CDS             400350..401450
                     /locus_tag="PPUBIRD1_RS01735"
                     /old_locus_tag="PPUBIRD1_0346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008089660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hybrid-cluster NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_014589387.1"
                     /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPI
                     MFFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMH
                     EGLELPVHGPVGLFNAIDFPSGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSA
                     RSPKDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYME
                     RVVFCCGPTPYMTAVKRLLEAVGFDMANYHEESFGATPAEAKADAVEHAEQAADAPEL
                     DVSDLNLVEFIGSEKSIRIAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVE
                     MEHNGGITEEDEAEGYILSCCSVPKGDVRIDY"
     gene            complement(401559..403184)
                     /locus_tag="PPUBIRD1_RS01740"
                     /old_locus_tag="PPUBIRD1_0347"
     CDS             complement(401559..403184)
                     /locus_tag="PPUBIRD1_RS01740"
                     /old_locus_tag="PPUBIRD1_0347"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_003255688.1"
                     /translation="MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAI
                     EQVSVPSIKILDELTALNLRMRTLSYRLLLNREPATQRDTLDLLDQRNSQIDRARQAY
                     LPMIVAADEQAAFDQYGQLLNQYRQLESRMRTLSQADRLDELRDLLNRDLLANSEQIN
                     KVMDTLVRINTDQTRATNEKAANQYAGAFALVIGLLVAATVLTFACAFLLTRSIVKPI
                     EEALKCAEQVADGDLTHVIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASA
                     AEELNAVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTG
                     DGRDLVMETVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNA
                     AIEAARAGEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTE
                     RAESTLNIARGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLS
                     VQSATGAHQTSAASAELSRLAVDLNGLVARFRT"
     gene            403451..403681
                     /locus_tag="PPUBIRD1_RS01745"
                     /old_locus_tag="PPUBIRD1_0348"
     CDS             403451..403681
                     /locus_tag="PPUBIRD1_RS01745"
                     /old_locus_tag="PPUBIRD1_0348"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008089655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255686.1"
                     /translation="MLEASLNQIEQLVSDLMQKNAQLIEQNTALGQELAQAKEENETL
                     QLSLMEQEEKNGATAARIQALVERASAGVVGA"
     gene            403678..403980
                     /locus_tag="PPUBIRD1_RS01750"
                     /old_locus_tag="PPUBIRD1_0349"
     CDS             403678..403980
                     /locus_tag="PPUBIRD1_RS01750"
                     /old_locus_tag="PPUBIRD1_0349"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008089653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein ZapA"
                     /protein_id="WP_003255684.1"
                     /translation="MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNKALNET
                     KRQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAEQ"
     gene            404162..406099
                     /locus_tag="PPUBIRD1_RS01755"
                     /old_locus_tag="PPUBIRD1_0350"
     CDS             404162..406099
                     /locus_tag="PPUBIRD1_RS01755"
                     /old_locus_tag="PPUBIRD1_0350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014589388.1"
                     /translation="MRIWRKSIQLQLITSMGAALLASILVVVIIFTVALNRLTDRYLV
                     DTALPASIEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEDPAQVPQFIEYLTAA
                     KQRNHAFTTLFASTETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERFINIDIDGA
                     TGELALFIDYRVEKEGKLVGVAGMGLRMTELSKLIHDFSFGEHGKVFLVRNDGLIQVH
                     PDAAFSGKRQLAEQLGADAAKGVMTGDESLRSSRFSRDGERYLALGLPLRDLNWTLVA
                     EVPESEIYAQMHQAVWLTSLIGGAVALVSLLLVVLLARGLVRPIRRVTAALVQIGGGA
                     GDLSHRLDDTRQDELGDLARGFNRFLDSQRSLIGEVLSTSERLRRAVEQVTQVVDNTA
                     ERSGRQQEMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVQRSIRG
                     IEGMSGDIGKAADAVSQLADEVASVDEVLAVIRSISEQTNLLALNAAIEAARAGEMGR
                     GFAVVADEVRTLARRTQLSTDEVQQMIQRLKLGAGSAVSSMQAGQQATGSGVESSQRT
                     GASLSAITDQVEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVRGCRE
                     ECQALRGLADDLARQMGGFRL"
     gene            complement(406132..407172)
                     /locus_tag="PPUBIRD1_RS01760"
                     /old_locus_tag="PPUBIRD1_0351"
     CDS             complement(406132..407172)
                     /locus_tag="PPUBIRD1_RS01760"
                     /old_locus_tag="PPUBIRD1_0351"
                     /EC_number="4.1.2.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255682.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low specificity L-threonine aldolase"
                     /protein_id="WP_014589389.1"
                     /translation="MTDKSQQFASDNYSGICPEAWAAMEKANRGHDRAYGDDQWTERA
                     SEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFS
                     NGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAI
                     SATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILF
                     FNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVS
                     DLPGVELMFPVEANGVFLQMPEHAIEALRGKGWRFYTFIGSGGARFMCSWDTEEARVR
                     ELAADIRTIIGG"
     gene            407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS01765"
                     /old_locus_tag="PPUBIRD1_0353"
     CDS             407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS01765"
                     /old_locus_tag="PPUBIRD1_0353"
                     /EC_number="2.1.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011269187.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_003255681.1"
                     /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSKRVM
                     QAQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSAN
                     GAVYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGIDTNTGLIDYDEVE
                     RLAVEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPI
                     PFADVVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCF
                     KEALEPGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDAD
                     AALGRAHITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDN
                     LGDADVEADVAKNVAALCADFPVYR"
     gene            408766..410016
                     /locus_tag="PPUBIRD1_RS01770"
                     /old_locus_tag="PPUBIRD1_0354"
     CDS             408766..410016
                     /locus_tag="PPUBIRD1_RS01770"
                     /old_locus_tag="PPUBIRD1_0354"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008365064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit beta"
                     /protein_id="WP_003255680.1"
                     /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHG
                     LATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEG
                     LSQDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNTAQVAAEIPYL
                     DCSKNTRYPILGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGAV
                     IGVETNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIM
                     SNAVHGYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNR
                     QWGGIVDTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLA
                     APFSMDRFYNGALIDEHGAAAVAH"
     gene            410031..410366
                     /locus_tag="PPUBIRD1_RS01775"
                     /old_locus_tag="PPUBIRD1_0355"
     CDS             410031..410366
                     /locus_tag="PPUBIRD1_RS01775"
                     /old_locus_tag="PPUBIRD1_0355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit delta"
                     /protein_id="WP_010951682.1"
                     /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPNACSDEEWGTYM
                     FYRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTASGKATSAAS
                     TVKGQGEKV"
     gene            410363..413377
                     /locus_tag="PPUBIRD1_RS01780"
                     /old_locus_tag="PPUBIRD1_0356"
     CDS             410363..413377
                     /locus_tag="PPUBIRD1_RS01780"
                     /old_locus_tag="PPUBIRD1_0356"
                     /EC_number="1.5.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019822975.1"
                     /note="Sarcosine oxidase subunit alpha; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="WP_014589390.1"
                     /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANG
                     VDIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTN
                     GWPNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQND
                     PDSYDYMNRHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDTRETLDG
                     KPAADWVNAVVKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRH
                     RVHRVRAKRVVLAAGAHERPLVYGNNDVPGNMLAGAVSTYVRRYGVAPGRKLVLSTNN
                     DHAYRAALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVIEAKGSKHVT
                     GARVAAIDVQAHKVTSPGEILECDLIASSGGYSPIVHLASHLGGRPVWRDDILGFVPG
                     DAPQKRECVGGINGVYALGDVIADGFEGGVRAATEAGFKATVGTLPKTVARKEEATVA
                     LFLVPHDKGTKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLG
                     NINGLAIAARSIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHV
                     KNGAEFEDVGQWKRPWYFPKAGEDIHAAVTRECKAVRDSVGLLDASTLGKIDIQGPDA
                     REFLNRIYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARV
                     LQWMELYHQTEWPELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTW
                     KEGNVGGVPARVFRISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHV
                     LRAEKGFIIVGQDTDGSMNPDDLNMSWCVGRNKPFSWIGLRGMNREDCVRENRKQLVG
                     LKPVDPTQWLPEGAQLVFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMG
                     ERVYSPQADGSVIEAEIVSSVFFDPKGERQNV"
     gene            413547..414179
                     /locus_tag="PPUBIRD1_RS01785"
                     /old_locus_tag="PPUBIRD1_0357"
     CDS             413547..414179
                     /locus_tag="PPUBIRD1_RS01785"
                     /old_locus_tag="PPUBIRD1_0357"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404122.1"
                     /note="sarcosine oxidase, gamma subunit family; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit gamma"
                     /protein_id="WP_014589391.1"
                     /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRER
                     KFLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANKDMSLQWVGPDEWLLIVPGG
                     QELAVEQKLRAALEGQHIQVVNVSGGQSLLELRGPNVRDVLMKSTSYDVHPNNFPVGK
                     AVGTVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
     gene            414191..415048
                     /gene="purU"
                     /locus_tag="PPUBIRD1_RS01790"
                     /old_locus_tag="PPUBIRD1_0358"
     CDS             414191..415048
                     /gene="purU"
                     /locus_tag="PPUBIRD1_RS01790"
                     /old_locus_tag="PPUBIRD1_0358"
                     /EC_number="3.5.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_003255675.1"
                     /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDR
                     QSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHC
                     LNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQV
                     IEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMV
                     GATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVF
                     LNANRTVVL"
     gene            415350..416549
                     /gene="fdhA"
                     /locus_tag="PPUBIRD1_RS01795"
                     /old_locus_tag="PPUBIRD1_0359"
     CDS             415350..416549
                     /gene="fdhA"
                     /locus_tag="PPUBIRD1_RS01795"
                     /old_locus_tag="PPUBIRD1_0359"
                     /inference="COORDINATES: similar to AA
                     sequence:SwissProt:P46154.3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formaldehyde dehydrogenase,
                     glutathione-independent"
                     /protein_id="WP_011953256.1"
                     /translation="MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVST
                     NICGSDQHMVRGRTTAQVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCR
                     SCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAME
                     KIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGD
                     LNPARLAHAKSQGFEVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAK
                     HEAPATVLNSLMQVTRVAGNIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSF
                     HTGQTPTMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDP
                     HKMWGAA"
     gene            complement(416797..>417486)
                     /locus_tag="PPUBIRD1_RS26005"
                     /pseudo
     CDS             complement(416797..>417486)
                     /locus_tag="PPUBIRD1_RS26005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017278295.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(417441..417686)
                     /locus_tag="PPUBIRD1_RS01805"
     CDS             complement(417441..417686)
                     /locus_tag="PPUBIRD1_RS01805"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166825.1"
                     /translation="MKQQTPTQFFYNKQNLSTLTTEPHTTTLFRTTDLALGELGPEKK
                     VFLAVNDSSSVLEAGKINETQKTLIQLMATIPPQPQR"
     gene            418185..418760
                     /locus_tag="PPUBIRD1_RS01810"
                     /old_locus_tag="PPUBIRD1_0360"
     CDS             418185..418760
                     /locus_tag="PPUBIRD1_RS01810"
                     /old_locus_tag="PPUBIRD1_0360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589392.1"
                     /translation="MKAFTLATLMTLAASPVFAFNLSDAANAVSAMQNQQQQGQVQAP
                     EAQANLLNTLGSQLNITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGAN
                     ALGGLSGLGDLLGKNSESQSALSNALGNNVENRSDLDNAFKALGMDTGMIGQFAPLIL
                     QYLGQQGIAGSLLQNLGSLWTTPAPLAQPSV"
     gene            complement(418858..420207)
                     /locus_tag="PPUBIRD1_RS01815"
                     /old_locus_tag="PPUBIRD1_0361"
     CDS             complement(418858..420207)
                     /locus_tag="PPUBIRD1_RS01815"
                     /old_locus_tag="PPUBIRD1_0361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_014589393.1"
                     /translation="MANPPSSNPAQLRRVLGLPALVFFGLVYMVPLTIFTTYGIVTEL
                     TGGRTAGAYLVTLVAMLFTAASYSFMVKRFPVAGSAYSYTNMAFGPNVGFLAGWSLLL
                     DYLFLPMINYLLIGLFLNIAFPAVPAWAFVLACIALVTVLNVVGINSVAKTSNLIVGA
                     QIVFIGVFVALSCQTLAGQPLDLLSPLIGDGSKPGFGHLMAGAAVLCLSFLGFDAVST
                     LAEECRDARRDVPRAIILTTLFAGLLFTVLAYVSQLVLPGSSFANADAAANEVMFKAG
                     GQFLTNFFTAAYVAGSLGSALASQAAVSRILFTMGRDNVLPRRSFGYLSPRFGTPVFA
                     IALVSAFSLLALVIDLSTLASLISFGALVAFSAVNLTVVKTHLMDDASQRNFIGLLSY
                     GLVPLVGLGLTLWLWTSLSALTLVIGLCWFALGLAYLAVLTAGFRRPVRLVDFSEAV"
     gene            complement(420447..421334)
                     /locus_tag="PPUBIRD1_RS01820"
                     /old_locus_tag="PPUBIRD1_0362"
     CDS             complement(420447..421334)
                     /locus_tag="PPUBIRD1_RS01820"
                     /old_locus_tag="PPUBIRD1_0362"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_014589394.1"
                     /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYAS
                     WAVMWVAETWSEIDKAIFALCIPTQWDIRGVENLRKDTSYLAVSNHQTWVDIPALIES
                     LNRRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKA
                     ACELFKRQPVTVVNYLEGTRFTEAKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDAL
                     LDVTIVYPGNKAPGFWDLLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWV
                     NQLWVAKDQRIEQLRAEMG"
     gene            421517..422017
                     /locus_tag="PPUBIRD1_RS01825"
                     /old_locus_tag="PPUBIRD1_0363"
     CDS             421517..422017
                     /locus_tag="PPUBIRD1_RS01825"
                     /old_locus_tag="PPUBIRD1_0363"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589395.1"
                     /translation="MKPLLALLSLLALPVMAAEPTLYGRYENIALPELGETLKAKMDT
                     GAFTASLSAKDIELFTRDGDEWVRFRLATKDSDGKVYEHKVSRISKIKGRADEEDEGD
                     APEVSKRPVVDLELCLGDVKRTVEVNLVDRSNFNYPLLVGSKALREFKAAVNPAKKFT
                     AGKPGC"
     gene            422157..422837
                     /locus_tag="PPUBIRD1_RS01830"
                     /old_locus_tag="PPUBIRD1_0364"
     CDS             422157..422837
                     /locus_tag="PPUBIRD1_RS01830"
                     /old_locus_tag="PPUBIRD1_0364"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_041166826.1"
                     /translation="MPHILIVEDEAAIADTLVYALQADGHSTEWVTLGSAALDQQRQR
                     PADLVILDIGLPDISGFETCRQLRRFTEVPVMFLSARDGEIDRVVGLEIGADDYVVKP
                     FSPREVAARVRAILKRMAPRAEAAGGTSLFQLDTLRMQITYRSQPLTLTRHEFRLLQC
                     LLEQPQRVFSREQLLDALGVASDVGYERTIDSHIKSLRAKLRQVAGDAEPIQTHRGLG
                     YSYSPEHA"
     gene            422837..424273
                     /locus_tag="PPUBIRD1_RS01835"
                     /old_locus_tag="PPUBIRD1_0365"
     CDS             422837..424273
                     /locus_tag="PPUBIRD1_RS01835"
                     /old_locus_tag="PPUBIRD1_0365"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system sensor histidine kinase
                     CreC"
                     /protein_id="WP_014589397.1"
                     /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVD
                     TANLLAEILRDDVKAGTLNQGRLPEVLEAYGSRSPGAQIWGLAKNQVSHRIYVTDAKG
                     IVLLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPNDESTSVMHVGAPIIDNGKI
                     IGVVTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRKLAGYAQ
                     AVSEGERAELPHYKGGELANLAQAVERMRTQLEGKAYVERYVHTLTHELKSPLAAIRG
                     ASELLQGEDMPADQRARFAGNIERESERLQQMIERLLNLARVEQMQALEDEQQVALAA
                     LVDELLLAHAARIEGAGLQVRQRVPATLRLLCDPFLMRQALANLLDNALDFTPEGGTL
                     LFDLERAGERVALSVFNQGQAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVM
                     QLHGGALAVDNVDGGVRVRLWLPLRRIS"
     gene            424381..425709
                     /locus_tag="PPUBIRD1_RS01840"
                     /old_locus_tag="PPUBIRD1_0366"
     CDS             424381..425709
                     /locus_tag="PPUBIRD1_RS01840"
                     /old_locus_tag="PPUBIRD1_0366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope integrity protein CreD"
                     /protein_id="WP_014589398.1"
                     /translation="MNKTLGFKLGMIAMLMLLLLIPLLLINGLIDDRQAMRDGVLRDI
                     AQSTSFDQQLSGPLLVVPYRKYQRRWIEKDGARTQETSTITGHLYFLPETFDADLGVD
                     TELRARGIYQARLFHAKGRISGRFKLPAHWGIDKDFDDYRFDKPFLVVGISDIRGIKS
                     ALELSMDEQKVPFEPGTQLDWMRGGVHASLPGLDGLQARAFSYGFDLALQGTGQLHVV
                     PVGRTSSVNMRANWPHPSFVGSYLPNRREIDAQGFSAHWQTSFFATNLEDALRQCAVG
                     GQCADFSERTFGVSFVDPVDQYLKSERAIKYALLFIALTFAGFFLFEVMKNLSVHPVQ
                     YILVGVALAFFYLLLLSLSEHIGFGLAYGLSASACVLLIGFYLSHVLRSRGRGVGFAA
                     GLAALYALLYGLLSAEDYALLMGSLLCFGLLGVFMVMTRRLDWARVGRAA"
     gene            complement(425876..426499)
                     /locus_tag="PPUBIRD1_RS01845"
                     /old_locus_tag="PPUBIRD1_0367"
     CDS             complement(425876..426499)
                     /locus_tag="PPUBIRD1_RS01845"
                     /old_locus_tag="PPUBIRD1_0367"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_019437095.1"
                     /translation="MSTMTLFHSPLSPFVRKVMVVLHETGQLERVQLQPVNISPVSGD
                     PQLNLDNPIGKIPALRLEDGTVLHDSRVICEYLDMQHVGLPLLPREGSARWRRMTLVS
                     QADAIMDAAVSSRYESFLRPEDKRWDGWLQAQGDKIRRSLANLEQEHLPELISGFDLA
                     AIGVACALGYLDLRQPGFGWRERQPGLAAWYAEVVKRPSMVATAPVA"
     gene            complement(426503..427171)
                     /locus_tag="PPUBIRD1_RS01850"
                     /old_locus_tag="PPUBIRD1_0368"
     CDS             complement(426503..427171)
                     /locus_tag="PPUBIRD1_RS01850"
                     /old_locus_tag="PPUBIRD1_0368"
                     /EC_number="1.8.4.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316625.1"
                     /note="Peptide methionine sulfoxide reductase msrA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (S)-S-oxide reductase"
                     /protein_id="WP_014589400.1"
                     /translation="MVLRSEILVNKNVMPTAEQALPGRDTPMSLPEFHYVFKDTPLLG
                     PFFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHT
                     EVVLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDIGTQYRSAIYCTSPEQLEQAKA
                     SRDAYQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPDGYCGIGGTGVCLPPS
                     LQGN"
     gene            complement(427340..430030)
                     /locus_tag="PPUBIRD1_RS01855"
                     /old_locus_tag="PPUBIRD1_0370"
     CDS             complement(427340..430030)
                     /locus_tag="PPUBIRD1_RS01855"
                     /old_locus_tag="PPUBIRD1_0370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016704477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="WP_014589401.1"
                     /translation="MKSQPDAASRVAAEVVTQLPVPSRLGMLRFERLNEASWAMLYLD
                     PACERQFGLQTGELCALIDAPYASLMEPEARYRLHDEIQLQLAQRGYYRVRYTLHTPS
                     TSLRLLEAGEAYKQHNRQLLRGYLSVLDDQQEETGETGASDLESRNNRLQLALQLNQR
                     TQQEQLEHLERVRGQQDLILRLARHRYSADNSLLEAAQLITQSACEIYKVDCASIWHL
                     EDQRLEPIIAWYRDAQEHRQPEAIDASRFPDYLDALHASRAIDAHNAGHDPRTRALAQ
                     SMRPENKAMLDASIRVDGQVIGVLCLEQSGQPRAWQSDEIAFAGELADQFAQVITNHK
                     RRAAASALHLFQRAVEQSASAFLLVNRDGRVEYVNPSFTAITQYSTDEVQGRQLGELP
                     ALENLSELLFDSPSSLAMGNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGI
                     YEDVTQTKLAQQRIERLAYTDNLTNLGNRPAFIRSLDERFARDGESSMCLLLVDIDNF
                     KRINDSLGHQTGDKLLISLARRLRNSLHSGGILARFASNEFAVLLDDTSLEDGQGVAQ
                     QLLCTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLMKNAGLALHKAKANGKHQVQ
                     VFTEVLNAEASYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGLEALLRWNHPER
                     GMIRPDQFISVAEETGLIIPIGKWVVRQACCMSQQLRKAGLGNLHVAINLSPKQFSDP
                     DLVASISTILKEEALPPHLLELELTEGLLLEASEDTHRQLDELKALGLTLAMDDFGTG
                     YSSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMAHNLKLKVVAEGIETPE
                     QLAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA"
     gene            complement(430392..432032)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_RS01860"
                     /old_locus_tag="PPUBIRD1_0371"
     CDS             complement(430392..432032)
                     /gene="aceF"
                     /locus_tag="PPUBIRD1_RS01860"
                     /old_locus_tag="PPUBIRD1_0371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoyllysine-residue acetyltransferase"
                     /protein_id="WP_003255652.1"
                     /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASM
                     EIPAPKAGVIKELKVKLGDRLKEGDELLVLEAEGAAAAAPEAPAAAAAPAAAPAPAAE
                     AAPAAPAAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASM
                     EIPSPAAGVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPAPAAAPAPAKAEAAPAA
                     APAAAAPAAAPAPAATAPAAGSNAKVHAGPAVRQLAREFGVELGAVAATGPHGRILKE
                     DVQVYVKAMMQKAKEAPAAAGATGGAGIPPIPAVDFSKFGEVEEVALTRLMQVGAANL
                     HRSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPD
                     FNSSLAPSGKAIIRKKYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKAR
                     TKKLSADEMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPK
                     LMLPLSLSYDHRVINGAAAARFTKRLGDVLGDIRTMLL"
     gene            complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_RS01865"
                     /old_locus_tag="PPUBIRD1_0372"
     CDS             complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_RS01865"
                     /old_locus_tag="PPUBIRD1_0372"
                     /EC_number="1.2.4.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003171281.1"
                     /note="Pyruvate dehydrogenase E1 component; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase (acetyl-transferring),
                     homodimeric type"
                     /protein_id="WP_014589402.1"
                     /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGS
                     QLPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHI
                     SSFASSATLYDIGFNYFFQAPTDEHGGDLVFFQGHASPGVYARAFMEGRISEDQMNNF
                     RQEVDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQK
                     VWCFMGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGV
                     FRGGGWNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVREHFFN
                     TPELKAMVEDLSDEEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGA
                     GEAKNTAHNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAA
                     LGGFVPQRRAKSFSVPTPPLETLKAILDGSGDREISTTMAFVRILAQLVKDKDIGQRI
                     VPIIPDEARTFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAG
                     AMSSFIAAGTSYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRT
                     TLNGEGLQHEDGHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYIT
                     VMNESYQQPAMPAGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILRE
                     EFNVGADVWSVTSFNELRRDGLAVERANRLKPGQKPQQTYVEQCLNGRKGPVIASTDY
                     MKLFAEQIRQWVPSKEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGE
                     IEPKVVADAIVKFGIDPDKRNPLDC"
     gene            435075..438008
                     /locus_tag="PPUBIRD1_RS01870"
                     /old_locus_tag="PPUBIRD1_0374"
     CDS             435075..438008
                     /locus_tag="PPUBIRD1_RS01870"
                     /old_locus_tag="PPUBIRD1_0374"
                     /EC_number="2.7.7.42"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016972664.1"
                     /note="Glutamate-ammonia-ligase adenylyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional glutamine synthetase
                     adenylyltransferase/deadenyltransferase"
                     /protein_id="WP_014589403.1"
                     /translation="MRLPLPSDLPATLQPLVTRNQQFISDAVAGHPELDLQAWSPLHR
                     QQFDQVAAASEFVLSLAQREPAMLFALLASGELERRYAPGELRGQIAATAQAAQSEDE
                     LARNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFG
                     TPIGNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLDNQEFFT
                     RLGQRLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAM
                     IKARVVAGDQAAGAQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMAENIK
                     LGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYE
                     FLRYTEHAIQAIADRQTQMLPEGETDQARVAYVLGFADWQSFHDQLMYWRGRIDWHFR
                     QVIADPDDEDGEGELVVGGEWSPLWEQAQDEEAAGRQLQEAGFKQPAEALRRLAGLRS
                     SPQLRSMQRIGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTE
                     NPGALRRLLTLCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRI
                     PEDDLEQQMEALRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWR
                     QTVARHGQPKRSDGSLCDPGFIIIGYGKMGGLELGHGSDLDLVFIHDGDPQAETDGAK
                     PIDSAQFFTRLGQRIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNE
                     AWTWEHQALVRARVLVGCKQVGAAFEGVRAKVLGQARDLEKLRAEVSEMRAKMRDNLG
                     TKATAAGTAANAFDAGVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRI
                     LEELEQANLMPASDAVLLREVYKAFRSASHRQALQKEAGVIDAAQFADERREVRRIWG
                     ELGLS"
     gene            438211..439260
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_RS01875"
                     /old_locus_tag="PPUBIRD1_0375"
     CDS             438211..439260
                     /gene="waaF"
                     /locus_tag="PPUBIRD1_RS01875"
                     /old_locus_tag="PPUBIRD1_0375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011536130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase II"
                     /protein_id="WP_010951695.1"
                     /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPI
                     LERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIP
                     KRTGWRGEMRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPNLQIEAQS
                     RDAALAKFGLELDRPVLALCPGAEFGEAKRWPAEHYAAVADAMIRQGWQVWLFGSKND
                     HPVGEQIRDRLIPGLREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRP
                     LVAVYGSTSPGFTPPLAEQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALH
                     SLSGPDLIDTVAEVD"
     gene            439261..440319
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_RS01880"
                     /old_locus_tag="PPUBIRD1_0376"
     CDS             439261..440319
                     /gene="waaC"
                     /locus_tag="PPUBIRD1_RS01880"
                     /old_locus_tag="PPUBIRD1_0376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016714542.1"
                     /note="lipopolysaccharide heptosyltransferase I; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="WP_014589404.1"
                     /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEI
                     PSWHPAVDQVIPVAIRRWRKNLWQTIKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWL
                     TRYVKAPVAGLDRYSAREGWASRFYDRPLSVATGQHAVERVRQLFAMALAYDLPEGIG
                     NYGLDLDRLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPA
                     EKARAERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTISLF
                     GPTNPGLTGAYGRTQIHQASDWPCAPCLQKKCTYKPRADDLARFDLKREWPLCFTRLN
                     PEHVASRLSALLLAEDVR"
     gene            440319..441443
                     /locus_tag="PPUBIRD1_RS01885"
                     /old_locus_tag="PPUBIRD1_0377"
     CDS             440319..441443
                     /locus_tag="PPUBIRD1_RS01885"
                     /old_locus_tag="PPUBIRD1_0377"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484557.1"
                     /note="catalyzes the addition of the first glucose residue
                     to the LPS core; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosyltransferase"
                     /protein_id="WP_003255647.1"
                     /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGD
                     IPPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGC
                     FEDKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVE
                     RFHLLPPGISQDRRAPANAAEIRAEFRKEFNLGDDDLLLVQIGSGFKTKGVDRSLKAL
                     AALPSALRKRTRLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADLLIH
                     PAYNENTGTVLLEALVAGLPVLVSKVCGYAHYIAEADSGLVLDEPFEQDQLNGYLQRM
                     LEDPQARASWSRNGLAFADSADLYSMPQHAADVILGQKTA"
     gene            441440..442246
                     /locus_tag="PPUBIRD1_RS01890"
                     /old_locus_tag="PPUBIRD1_0378"
     CDS             441440..442246
                     /locus_tag="PPUBIRD1_RS01890"
                     /old_locus_tag="PPUBIRD1_0378"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470538.1"
                     /note="lipopolysaccharide kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide core heptose(I) kinase RfaP"
                     /protein_id="WP_014589405.1"
                     /translation="MKLILAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTEVA
                     GEGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWRAIQRLHEVGVPTMTAVAYGERG
                     NNPAAQHSFIITEELAPTISLEDFSIDWVKQPPEPRLKRALIAEVAKMTGGMHRAGVN
                     HRDCYICHFLLHTDRPVTADDFKLSVIDLHRAQTRARISRRWRDKDLAALYFSALDIG
                     LTQRDKLRFLRGYFQRPLRQVLKDEAALLAWLERKAQKLYDRKQRYGDAL"
     gene            442246..442980
                     /locus_tag="PPUBIRD1_RS01895"
                     /old_locus_tag="PPUBIRD1_0379"
     CDS             442246..442980
                     /locus_tag="PPUBIRD1_RS01895"
                     /old_locus_tag="PPUBIRD1_0379"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS kinase"
                     /protein_id="WP_014589406.1"
                     /translation="MASWTLAPGYEHLAADFGSLDAVFALQGERLTRDPLSEVVRIER
                     DGINYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERNGLAF
                     GRGAMITRELPRTEDLSALAEHNDARLADRAWVDHVSRQLARHTRVMHEHRFAHNDLK
                     WRNLLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQ
                     YRGRDRLNVRDKKRIHRVLGFFEGRE"
     gene            442977..443729
                     /locus_tag="PPUBIRD1_RS01900"
                     /old_locus_tag="PPUBIRD1_0380"
     CDS             442977..443729
                     /locus_tag="PPUBIRD1_RS01900"
                     /old_locus_tag="PPUBIRD1_0380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008095935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS kinase"
                     /protein_id="WP_014589407.1"
                     /translation="MTDYLASADLALLKRHGLDNFEALWALQLDAVDEPNTGRGGWSS
                     VFRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLRIPALQAVFYGE
                     RKQGGTHRAILMTRALDEWADLDSLLAQWPRLGEAERTGILQACGQLARTLHSAGQVH
                     GCFYPKHIFLRQRREGWDAQLIDLEKTRPLLFGMRDRLKDLEPLLRRAQAWRVQDVRT
                     LLATYLGQPADGALVDTWLQRLTQRRREKEAR"
     gene            443729..445171
                     /locus_tag="PPUBIRD1_RS01905"
                     /old_locus_tag="PPUBIRD1_0381"
     CDS             443729..445171
                     /locus_tag="PPUBIRD1_RS01905"
                     /old_locus_tag="PPUBIRD1_0381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS kinase"
                     /protein_id="WP_014589408.1"
                     /translation="MRLSELKDAGRSPALPLSITLVDAAGSADLQLLSLLRVLPGQRY
                     VGAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPTLLADGLKEGEGGWL
                     LFEFLDGAQSLADAWAAVENLPVLADEQHLVLGEALTAVAHMHARGLWQEDLHLDNLL
                     RHAGKLYLIDGAGIRAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLAN
                     AEHALPLEALQKQVDKVRNWRQKDYLDKAGRECSLFSVQRTLSGLQAIRRSEVQAMQP
                     VLEQADALIDKGHLYKTGGAASVARIEVNGRQLVIKRYNIKNTAHWFKRFWRPSRAWH
                     SWIEGHRLEFLDIATPRPLAVLEQRVLGLRSRAYLVTEFVDGPDLTACFAPYVESGDA
                     PEEQVDALVHVMQQLIRERISHGDFKGHNLFWHNGQWSLIDLDAMCQHATQLSFAPAY
                     ARDRARLLRNWPNGSALHQRLDRLLPKLVD"
     gene            complement(445190..447976)
                     /locus_tag="PPUBIRD1_RS01910"
                     /old_locus_tag="PPUBIRD1_0382"
     CDS             complement(445190..447976)
                     /locus_tag="PPUBIRD1_RS01910"
                     /old_locus_tag="PPUBIRD1_0382"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589409.1"
                     /translation="MRPLEQLEQIDRQIGDLLDGIPTLALQHPINPDTRTWLHGELAS
                     FWTTADEHGETPRQKLLALRKALMLAEVELRLGDETLGYRSADQLWACLQQPLPSQRR
                     HMPLAKRPQVYRVLLEGLRPNWRSYLPGTLIIVAGTAEGHMLTPQDAAGAALLCSLSQ
                     GIEAFDSLGALHQELCERLEDPLQSRPLLHLYTDTQADRARRSQRLRYDWYADSLLEA
                     QIDSVIETQRQRLSDTSLWSNGSPDQHTRIHKALALWPEVGAKPILQTRYSQLLEKNL
                     PNWLRNTSAQGLSHMMQAMQTLVAIAEQAAAPGVLSLNDFKQRNSLLAWANARLRERL
                     SHDLGYDTDPREIKIVVVRARRTGAIMHPFALSSYVTYAGMRRVGHEMVEMVEEINTL
                     EEIALKNLPWFDTDYWLTARVIHAHGKAMPAGLTPQYVKHMVRELNVGDSYAKYLHTQ
                     LISSRAGKWRLTAHSKVNRARMHAEAVKARYAGHFGEDPFEHGYNWVRAVLDQPHNAL
                     RAPVAGYPVTVRQLNIMGHTLQGVLLLNSLPYKSPACVLYTPDAPDRRAWRRFRTTRE
                     LLRTLRQQPALRAYVAQRLPLLPAATVQRLLDKGRLSTHLTTPEVKDDLFFDYYMAEA
                     RALIAQADADSMTTSEVNAESVMALSWRLLDFISLLLPNRALLVLSIGRMAIDILDGI
                     EAFNQEDVEGVMRHSYQALSHLNDAGTSFLGSRVLRRSLRGIPKQPPLPLPARFQAQP
                     DSSSLRYRIDGIYGEGVYEQSSAFGGLSLYFVKDSNNRYYQVSFDGYRWRAIDPDQPD
                     AYLQQPLKRKADGQWVIDSPVLWYDGLPDLTQLLQDCYLQTPVAGLPVNIEQGLFQAD
                     EQLYLALENGQLPVRRHLLPDHYHLQIAVASNAGVVPWAVLRHENGQWLIRVRQAGRS
                     SDWLTLPDQPPPAH"
     gene            complement(448044..448229)
                     /locus_tag="PPUBIRD1_RS01915"
     CDS             complement(448044..448229)
                     /locus_tag="PPUBIRD1_RS01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011953272.1"
                     /translation="MSHRSQATARLFAWPALIALLGFLGLFAALLGDGGWDVLAWAGL
                     GLPALLSLRGLLWRRGR"
     gene            complement(448226..449338)
                     /locus_tag="PPUBIRD1_RS01920"
                     /old_locus_tag="PPUBIRD1_0384"
     CDS             complement(448226..449338)
                     /locus_tag="PPUBIRD1_RS01920"
                     /old_locus_tag="PPUBIRD1_0384"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PepSY domain-containing protein"
                     /protein_id="WP_014589410.1"
                     /translation="MKSPTIRRWSLIHTWSSLVCTLFLLLLAVTGLPLIFHHELEHLL
                     GDAPELREMPAGTPHLDLQQLVLKAEQHRPGEVMQYFGYDEDEPNGVVAITAATAGTD
                     PNLSHTFMLDARTGEAVAMPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAI
                     VSGTVLYAPFMRRLEFGTVRHKKSRRLRWLDLHNLIGVVTLAWALTVSVTGVISALSD
                     LVIAAWRNDSLAAMVAPYRDAPPLVERAPATRLLDIAEQAAPGMRPDFIAFPGTRFSS
                     EHHYAVFMNGATHLSSHLFTPVLIDARTLAVTAVGNRPWYMDAMGLSQPLHFGDYGGR
                     PMQILWALLDVLTIIVLGSGLYLWWGKQRKPREARA"
     gene            complement(449395..451827)
                     /locus_tag="PPUBIRD1_RS01925"
                     /old_locus_tag="PPUBIRD1_0385"
     CDS             complement(449395..451827)
                     /locus_tag="PPUBIRD1_RS01925"
                     /old_locus_tag="PPUBIRD1_0385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014860430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_014589411.1"
                     /translation="MSRAVDHILRPSLMALAIGLAAPLTSPVLFAAEQSTSRAYNLPS
                     APLATTLNQIASQAGIALAIDPALVSGRTSAPVSGQYDGLGALQAALSGTGLQLQQST
                     AGSYSLVAVPDGTLALPETTVNATSTSEIAWGPVEGYVAKRTAAGTKTDTALVEVPRS
                     ISVATREQMKDRGVHSLDDAVRYMPGIVSASFGSDTRYDWMRVRGFEPTQFLDGLPLP
                     RGVYANPKAETWNLDRLALLRGPASSIYGQTPPGGLLDMVSRRPQAESAHEIELQYGS
                     DNHRQINFASTGKIDDEGRFLYGVSGVIRDSGTQIDHIDNKRYNIAPSLTWNIDEDTT
                     LTFLTQFTRDDTGATSQFRPIQGTKIDMPFGKISHHKNLGDPDYEFYDRTYYALGYAF
                     EHRINDVWQFRQNLRYTKSDLSFQTITPGSYNKSSPPVQDDGTVSRMSTNTDEDISQF
                     AVDNNFQADFATGDIDHTLLIGLDHQRINTNYLSIFDFNVPDSNVNNPVYGLPITRPD
                     RSTAFYDYNQKTRQTGLYVQDQMALGNWRLTLGGREDWVHTGTKFFNQGDATNTQRDK
                     KFSGNAAISYVFDSGFVPYLSYAESFQPSSNASVSASDSFKPTEGKQWELGVKYQPPG
                     SNTLLSAAVYDLTQKNVSVTNTVGGVTITSQTGEVKVRGLELEAVSDVTDNLKVIAAY
                     TLAKSEVQDGDFKGNRLQLMPNQQASIWGDYTWHSGVLDGFGIGLGARYTGNTYGDQG
                     NTYLGKAKAYTVFDGSVHYDLGRLNGSLKGASVAVTATNLLNKDYLSTCDSYYCYYGD
                     ERSVVASATYKF"
     gene            complement(452080..453036)
                     /locus_tag="PPUBIRD1_RS01930"
                     /old_locus_tag="PPUBIRD1_0387"
     CDS             complement(452080..453036)
                     /locus_tag="PPUBIRD1_RS01930"
                     /old_locus_tag="PPUBIRD1_0387"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589412.1"
                     /translation="MSNLPVSSRVLEAAIAWKLSLGDSSGTPDERSEFMRWHAASEEH
                     ARAWRQLGAMDQRVSAAAGPARQALLQSRASLRRRIGKVGGGLAGTFLLGALLAWVGA
                     PSLAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGAQRVIVLHQGEISV
                     ETGHQDPRPLLVRTEDGRLRPLGTRFLVRREAGGTRLEVLQASVAAMPHDSGDEQVLR
                     EGQQVLMNANGLGEVGTVPAGADAWTRGMLVVDNVRLGDLLATLGQYRSGYLGVDAKV
                     ADLRVTGSFPLTNTDLALASLVPALPVKIERHTQWWVNVTSK"
     gene            complement(453033..453551)
                     /locus_tag="PPUBIRD1_RS01935"
                     /old_locus_tag="PPUBIRD1_0388"
     CDS             complement(453033..453551)
                     /locus_tag="PPUBIRD1_RS01935"
                     /old_locus_tag="PPUBIRD1_0388"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_010951704.1"
                     /translation="MSSAQSPHADLVGALYRDHRGWLLAWLQRSMACRQRAEDLSQDT
                     FVRLLGREQLDTPREPRAFLAAVAKGLMFDHFRRAALEQAYLAELALIPEAEQPSPEM
                     QHLILEDLKAIDRLLGKLSSKARAAFLHSRLDGMGHAEIAERLGVSVSRVRQYIAQGM
                     RQCYVALYGEPT"
     gene            complement(453699..454409)
                     /locus_tag="PPUBIRD1_RS01940"
                     /old_locus_tag="PPUBIRD1_0389"
     CDS             complement(453699..454409)
                     /locus_tag="PPUBIRD1_RS01940"
                     /old_locus_tag="PPUBIRD1_0389"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5' exonuclease"
                     /protein_id="WP_014589413.1"
                     /translation="MSLFAWLRPSAPELDHATRQRLARLPKPVPLGVCTLREQRWVVL
                     DLETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPSAL
                     AAGCDPAEALLDLLDFIGNSPVLAFHAPFDQRMLARALKESLGYRLQSPFLDIAELAP
                     MLNPDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQ
                     LEQRLRGWRRRKMQSHGL"
     gene            complement(454406..456343)
                     /locus_tag="PPUBIRD1_RS01945"
                     /old_locus_tag="PPUBIRD1_0390"
     CDS             complement(454406..456343)
                     /locus_tag="PPUBIRD1_RS01945"
                     /old_locus_tag="PPUBIRD1_0390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_014589414.1"
                     /translation="MSKKDAYSQAGKTAVLQNIQGTLQFLQRFPPFNQMEHSHLAFLV
                     EQCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLAKPGVETTFEITSGECFP
                     LAALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQ
                     VRQRAVETLGTQYSLNTPLGELAMRHPVVCSANTPLREAVRLMHEQQVGSIVVVDPQR
                     YPIGIFTLRDLRQVVATIDADLGAAIDRHMTAKPFYLPPQASAFDAAMAMTERHIAHV
                     CLVENRRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAH
                     GASSTQITQIITLLNDHTVCRVIELALAERGDPGVPFSWLCFGSEGRREQTLHTDQDN
                     GILFEAVDSAEADAIRARLLPLAQYINQCLAQCGFTLCMGNVMAGNPELCLSRSEWAR
                     RFAGFVREASPENLLGSSIYFDLRVVWGDEQGCEQLRQGLLAQVADNRIFQRMMADNA
                     LRQRPPVGRLREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGIAACNTLERL
                     RQLVAKGVIEPLDGAAYEEAYHFIQQTRMQQHQRQIRDNLPYSNRLDPDSLNHLDRRI
                     LRESLRQAQRLQSSLALRYQL"
     gene            456460..457005
                     /locus_tag="PPUBIRD1_RS01950"
                     /old_locus_tag="PPUBIRD1_0391"
     CDS             456460..457005
                     /locus_tag="PPUBIRD1_RS01950"
                     /old_locus_tag="PPUBIRD1_0391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_019437059.1"
                     /translation="MSALVKDPTKGETGYASNAVLMLKRNFFDEMSMPEHTDILSDAE
                     REALAVINQNAPVAARPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHY
                     QKRIGLMITDLRMQPESGLDLIRTIRASERAALSIIVVSGDTDVEEAVDVMHLGVVDF
                     LLKPVDLGKLLELVNKELKIG"
     gene            complement(457051..459228)
                     /locus_tag="PPUBIRD1_RS01955"
                     /old_locus_tag="PPUBIRD1_0392"
     CDS             complement(457051..459228)
                     /locus_tag="PPUBIRD1_RS01955"
                     /old_locus_tag="PPUBIRD1_0392"
                     /EC_number="2.3.3.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_249173.1"
                     /note="Malate synthase G; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase G"
                     /protein_id="WP_014589416.1"
                     /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIN
                     DLAPKNKALLAKRDELQAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATT
                     QNVDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGY
                     NKIRGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDAQL
                     IGFHGDAAAPTAVLLKHNGLHFEIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDS
                     VAAVDADDKVIVYRNWLGLMKGDLAESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGR
                     SLLFVRNVGHLMTNPAILDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRSGSVY
                     IVKPKMHGPEEVAFAAEIFSQVEDLLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAER
                     VAFINTGFLDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQ
                     IGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELA
                     SRTPASVDDILAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     NVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDPLYRPMAP
                     NFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
     gene            459678..460196
                     /locus_tag="PPUBIRD1_RS01960"
                     /old_locus_tag="PPUBIRD1_0393"
     CDS             459678..460196
                     /locus_tag="PPUBIRD1_RS01960"
                     /old_locus_tag="PPUBIRD1_0393"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein R"
                     /protein_id="WP_014589417.1"
                     /translation="MDHLVLTVIAPDKAGQVERIAQCIADHSGNWLESRMSRMAGQFA
                     GILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIV
                     RDITRLLAELQVNVERFSTEVRPAPMSSEPLFHADALLALPLTLPLDELQQKLESLAD
                     DLMVELKLRAED"
     gene            complement(460521..461408)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_RS01965"
                     /old_locus_tag="PPUBIRD1_0394"
     CDS             complement(460521..461408)
                     /gene="rarD"
                     /locus_tag="PPUBIRD1_RS01965"
                     /old_locus_tag="PPUBIRD1_0394"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020295406.1"
                     /note="RarD protein, DMT superfamily transporter; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
                     /protein_id="WP_014589418.1"
                     /translation="MHAANPRRGYILGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVL
                     WSALFGSLLLLVWKHPGWWRELRNNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEA
                     SLGYYINPLINVLLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALS
                     FGFYGLIRKQAPVAALPGLVVETWMLVPLAIGWLLLHPAAMSAQGAFYTSSEALWLMA
                     AGPVTLVPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVVLFDEHLSSSTLAAFMFI
                     WAGLAIYSVDAWLNLRKRS"
     gene            complement(461473..462446)
                     /locus_tag="PPUBIRD1_RS01970"
                     /pseudo
     CDS             complement(461473..462446)
                     /locus_tag="PPUBIRD1_RS01970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237762.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="stress response serine/threonine protein kinase
                     YihE"
     gene            complement(462605..463369)
                     /locus_tag="PPUBIRD1_RS01975"
                     /old_locus_tag="PPUBIRD1_0397"
     CDS             complement(462605..463369)
                     /locus_tag="PPUBIRD1_RS01975"
                     /old_locus_tag="PPUBIRD1_0397"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum-dependent transcriptional regulator"
                     /protein_id="WP_014589421.1"
                     /translation="MSLPPVLTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAA
                     WDAIDELNNLASQPLVKRSTGGRGGGGAHLSPEGERVLRLYQRLQALQAQILEAAEES
                     GDLDLLGRLMLRTSARNQLQGQVSGLRPEGRYDRVSLALGGGLEIDALITHDSTARLE
                     LTLGTMVVALLKAGWVRLLAEGEEAEAGSNCLCTKVEEVLAEVDGPSEVRLALGNGQT
                     LCAMADAHWLAAQQVVDGSVVRVQFHPSYVLIGVPA"
     gene            complement(463419..464150)
                     /locus_tag="PPUBIRD1_RS01980"
                     /old_locus_tag="PPUBIRD1_0398"
     CDS             complement(463419..464150)
                     /locus_tag="PPUBIRD1_RS01980"
                     /old_locus_tag="PPUBIRD1_0398"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_014589422.1"
                     /translation="MNCQLHWKRLVYKCSLINQKCLLCDEPAEQHYPLCITCEQALPW
                     LGDQCRHCALPLPMAGLTCAPCGRCLPAFDQVIALWHFGFPVDTLISRFKHNRQWPLG
                     RLMAELLGQGLLYRYAEGLPRPDLLLPVPLARRRLRERGFNQAGMLGRWLSSHVGVTC
                     NERLLVRTRETPAQQHLGAKARQRNLRQAFAVKGELEGKHVAIVDDVLTTGATAQAIA
                     QALRKAGARRVDVYCLARTPKPGYV"
     gene            464240..465298
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_RS01985"
                     /old_locus_tag="PPUBIRD1_0399"
     CDS             464240..465298
                     /gene="bioB"
                     /locus_tag="PPUBIRD1_RS01985"
                     /old_locus_tag="PPUBIRD1_0399"
                     /EC_number="2.8.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009315099.1"
                     /note="Biotin synthase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_014589423.1"
                     /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNL
                     DTSPEFYGSIITTRTYSERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANL
                     PEHPESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIE
                     QALVEQRSSEMFYDAATA"
     gene            465300..466472
                     /gene="bioF"
                     /locus_tag="PPUBIRD1_RS01990"
                     /old_locus_tag="PPUBIRD1_0400"
     CDS             465300..466472
                     /gene="bioF"
                     /locus_tag="PPUBIRD1_RS01990"
                     /old_locus_tag="PPUBIRD1_0400"
                     /EC_number="2.3.1.47"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_004577120.1"
                     /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCS
                     NDYLGLANHPEVIAAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALL
                     FSTGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDPASLASRL
                     DKAVGNTLVVTDGVFSMDGDLADLPALADVARARGAWLMVDDAHGLGTLGAQGGGIVE
                     HFGLGVDDVPVLIGTLGKACGTAGAFVAGSEALIEALVQFARPYIYTTSQPPALACAT
                     LKSLELLRRETWRREHLAALIRQFREGAQQLGLQLMDSPTPIQPIVIGDSAQALRLSR
                     LLRERGLLVTAIRPPTVPAGSARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
     gene            466465..467196
                     /locus_tag="PPUBIRD1_RS01995"
                     /old_locus_tag="PPUBIRD1_0401"
     CDS             466465..467196
                     /locus_tag="PPUBIRD1_RS01995"
                     /old_locus_tag="PPUBIRD1_0401"
                     /EC_number="3.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004577121.1"
                     /note="carboxylesterase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014589424.1"
                     /translation="MRNRLVLLPGWGLGTAALEPLAASLRAQDARLQVELMPLPELAH
                     SDVQAWIDHLDRKLPNNVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPSFLARPD
                     WPHGMAEDTFGTFLDGCRNHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPDTDPLYL
                     ATGLEVLAKLDTREALQAYDGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSS
                     HAFLLEYPQELAAGIKSFLHESGDD"
     gene            467189..468007
                     /gene="bioC"
                     /locus_tag="PPUBIRD1_RS02000"
                     /old_locus_tag="PPUBIRD1_0402"
     CDS             467189..468007
                     /gene="bioC"
                     /locus_tag="PPUBIRD1_RS02000"
                     /old_locus_tag="PPUBIRD1_0402"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-[acyl-carrier protein]
                     O-methyltransferase BioC"
                     /protein_id="WP_014589425.1"
                     /translation="MTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVGLSL
                     LEQLPAGLQPSHWLDLGSGTGHFSRMLAERFAQASGVAVDIAEGMLLHARHVKGGAQY
                     HVVGDAERLPLRDGSIDLVFSSLAVQWCDQFASVLAEAQRVLCPGGVLAFSSLCVGTL
                     DELRASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELERCPHVLHYPDVRSLTHEL
                     KALGAHNLNPGRPSGLTGRARMQGLLQAYEAFRQPAGLPATYQVVYGVLRKPQV"
     gene            468018..468698
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_RS02005"
                     /old_locus_tag="PPUBIRD1_0403"
     CDS             468018..468698
                     /gene="bioD"
                     /locus_tag="PPUBIRD1_RS02005"
                     /old_locus_tag="PPUBIRD1_0403"
                     /EC_number="6.3.3.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="WP_003255605.1"
                     /translation="MSQAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGC
                     TMTPKGLRNSDALALIDESTVKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAA
                     MRNVLQQNADFTLIEGAGGWRVPLSGLENLSDLAVALRLPVILVVGVRLGCISHALLS
                     AEAIERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAE
                     HLQLDLLD"
     gene            468911..469207
                     /locus_tag="PPUBIRD1_RS02010"
                     /old_locus_tag="PPUBIRD1_0404"
     CDS             468911..469207
                     /locus_tag="PPUBIRD1_RS02010"
                     /old_locus_tag="PPUBIRD1_0404"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589426.1"
                     /translation="MEITGSSAYYAGLSAIQTGQNRVDQAASQIANTTAERTATSQSS
                     DFQAERLRAVDRSQQMDLATSVVQQAVGKTEVELGAKVVKASDEMLGRIIDTYA"
     gene            469496..471301
                     /locus_tag="PPUBIRD1_RS02015"
                     /old_locus_tag="PPUBIRD1_0405"
     CDS             469496..471301
                     /locus_tag="PPUBIRD1_RS02015"
                     /old_locus_tag="PPUBIRD1_0405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011336238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_010951720.1"
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILE
                     EGAKFCEQVLSPLNRVGDQEGCTWSESGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGG
                     QGLPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTAEQQHTYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEPQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLP
                     DAPAGTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGY
                     LIGPANKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPD
                     KAADPIIVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAF
                     LTPIAKAFMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARF
                     YFQRILPRTRTHVATMLSGANNLMAMDEEHFGLSY"
     gene            471675..472958
                     /locus_tag="PPUBIRD1_RS02020"
                     /old_locus_tag="PPUBIRD1_0406"
     CDS             471675..472958
                     /locus_tag="PPUBIRD1_RS02020"
                     /old_locus_tag="PPUBIRD1_0406"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_014589427.1"
                     /translation="MFRLNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPT
                     LVLLLGGAYCAVYRRQRELFLMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCL
                     LLPALFGLYGAWQERTHLLQDLVARGAVLFAVGSVAVALQQSYPEALLTWLAEIRWPA
                     LHGHWMSLIQMVYPLFLGVFILLVVQYLRAPRPLHAAQLIGLLGIFWMLPQTFILPFT
                     LNIMCSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDH
                     FKKFNDTHGHDVGDQVLRLVASRLSKVTGGGRAYRYGGEEFALVFAGKTAAECVPHVE
                     AVREVIANYVMHLRDQHNRPQDDTAGRQRRAGSTGGTVSVTISIGVAERQADHRNPEA
                     VLKSADQALYSAKGAGRNCVMVHGRQSLRGAVRTA"
     gene            473083..474861
                     /locus_tag="PPUBIRD1_RS02025"
                     /old_locus_tag="PPUBIRD1_0407"
     CDS             473083..474861
                     /locus_tag="PPUBIRD1_RS02025"
                     /old_locus_tag="PPUBIRD1_0407"
                     /EC_number="1.3.8.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014589428.1"
                     /translation="MADYKAPLRDMRFVLNEVFNVAEQWTQLPGLAEVVDADTAIAVL
                     EEAGKVTARTIAPLSRAADEEGCHWDNGAVRTPAGFIEAYNTYAEGGWVGVGGDPLFG
                     GMGMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKEKYLPNMYAGVW
                     AGSMCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKL
                     PDAPAGPKGISLFLVPKFLVNEDGSLGARNPATCGSIEHKMGIQASATCVMNFDEAVG
                     YIVGEPNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPTGPQAK
                     DKAADPIIVHPDVRRMLLTMKALIEGGRAFSTYVAMQLDSAKYSEDASVRKRSEELVA
                     LLTPVAKAFLTDLGLECAVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQAL
                     DLMGRKVVASGGAYYKLFSDEIRQFINRAGSELDEFTKPLGASLDQLDGLTEWVLQQA
                     KGNPNEIGAASVEYLHAFGYVAYGYMWALMARAAQAGEGDAPFYSGKLGTARFYFARL
                     LPRVDSLVASVKAGSESLYLLDAEQF"
     gene            complement(475200..476123)
                     /locus_tag="PPUBIRD1_RS02030"
                     /old_locus_tag="PPUBIRD1_0408"
     CDS             complement(475200..476123)
                     /locus_tag="PPUBIRD1_RS02030"
                     /old_locus_tag="PPUBIRD1_0408"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_003255599.1"
                     /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLD
                     LSLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVR
                     PSLIPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGNLDIGISYLPPRQPGLHGLLL
                     YEDELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPQVQ
                     AEMNNMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDAQ
                     RQQASVELLRTLLEEETDARLLGASPLDVLA"
     gene            476335..477615
                     /locus_tag="PPUBIRD1_RS02035"
                     /old_locus_tag="PPUBIRD1_0409"
     CDS             476335..477615
                     /locus_tag="PPUBIRD1_RS02035"
                     /old_locus_tag="PPUBIRD1_0409"
                     /EC_number="2.6.1.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019097154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="WP_014589429.1"
                     /translation="MNLFNLRRSAPAAVAEPKCAPVIVPHATELSPERLMPGAERAAQ
                     VFVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNR
                     GLLGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITASQACHG
                     RSLGALSASDPLPCNRCEPGLPGFSKVPFNDLAVLHAEVDSRTVAIMLEPIQGEAGVI
                     PATQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG
                     VPLAALLARGKACCAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLR
                     EGLSRLTGRYGQGEVRGHGLLWALQLKENLARELVAAALHEGLLLNAPQVDVVRFSPA
                     LTVSKGNIDEMLLRLARAFARLHAQQQARREVPA"
     gene            477763..477921
                     /locus_tag="PPUBIRD1_RS26010"
                     /old_locus_tag="PPUBIRD1_0410"
     CDS             477763..477921
                     /locus_tag="PPUBIRD1_RS26010"
                     /old_locus_tag="PPUBIRD1_0410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011063854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YqaE/Pmp3 family membrane protein"
                     /protein_id="WP_003177654.1"
                     /translation="MDFIRIIIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     gene            complement(477984..479807)
                     /locus_tag="PPUBIRD1_RS02045"
                     /old_locus_tag="PPUBIRD1_0411"
     CDS             complement(477984..479807)
                     /locus_tag="PPUBIRD1_RS02045"
                     /old_locus_tag="PPUBIRD1_0411"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S9 family peptidase"
                     /protein_id="WP_014589430.1"
                     /translation="MIETPVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWNEFRPAD
                     GACRIWHWLHYQARCLTPDGFSVRSRVYEYGGGSFCPGGDGLVFVNEKDQQVYTQPLD
                     DLLPRALTQDASCRYGDVQWHDGHVLAVEERHAEHVEHRLVALGDSSREVLAEGADFY
                     ASPTVSADGQRLAWIEWDRPAQPWTVTRLMCSVRDASGHWGPAQCVAAAEESLQQPRF
                     DAEGRLYCLSDRNGFWQPWGEVDGQWQALPAAPADHAAAPWQLGTCTWLALGPQSYLA
                     SWFEDGFGQLGLRGEDGRMERFASAYTRFRSLAMDSEHLYAIAASPISPPAVIAIDRS
                     NHEVRVLAGGAEILPAGQISLPQSIHYGSDGEQAHGFFYPPAQSKSAAPLVVFIHGGP
                     TSACYPVLDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALNQRWGESDVADACAVVE
                     YLAAQGLVDKQKAFIRGGSAGGYTTLCALAFHDVFRAGASLYGVSDPIALGRATHKFE
                     GDYLDWLIGDPQRDTERYRQRTPLLHAQRIKVPVIFFQGELDAVVVPEQTRAMLAALQ
                     ANGIDAEGYFYAQERHGFRKAENLAHALEEEWKFYCRVLAQ"
     gene            complement(479773..480933)
                     /gene="pqqE"
                     /locus_tag="PPUBIRD1_RS02050"
                     /old_locus_tag="PPUBIRD1_0412"
     CDS             complement(479773..480933)
                     /gene="pqqE"
                     /locus_tag="PPUBIRD1_RS02050"
                     /old_locus_tag="PPUBIRD1_0412"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqE"
                     /protein_id="WP_014589431.1"
                     /translation="MPNTGSSSPELPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDF
                     AAQGQELSTEQWFKVMAEAREMGAAQIGFSGGEPLVRQDLAELIGEARRLGYYTNLIT
                     SGIGLTEARIADFKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGY
                     PMVLNFVTHRHNIEKIDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTRAQLER
                     AERITNEYRDKLKAEGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHG
                     ARQLPVQFPNVRDHDLHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFM
                     LTGDASNADPVCAKSTEHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
     gene            complement(480905..481180)
                     /locus_tag="PPUBIRD1_RS02055"
                     /old_locus_tag="PPUBIRD1_0413"
     CDS             complement(480905..481180)
                     /locus_tag="PPUBIRD1_RS02055"
                     /old_locus_tag="PPUBIRD1_0413"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004419445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqD"
                     /protein_id="WP_010951728.1"
                     /translation="MSFDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNDSASLI
                     GGLIDGQRDVAAIISELEQQFPGVPEVADDIEQFMEVARAEHWIVLA"
     gene            complement(481177..481932)
                     /locus_tag="PPUBIRD1_RS02060"
                     /old_locus_tag="PPUBIRD1_0414"
     CDS             complement(481177..481932)
                     /locus_tag="PPUBIRD1_RS02060"
                     /old_locus_tag="PPUBIRD1_0414"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237737.1"
                     /note="Required in the synthesis of PPQ, but its exact
                     function is unknown; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein C"
                     /protein_id="WP_003255592.1"
                     /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQ
                     GWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQ
                     AVGLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDS
                     WPQHYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDIL
                     WSMLDAMSMAYELNRPPYHSVTQERVWHKGITL"
     gene            481957..>482067
                     /locus_tag="PPUBIRD1_RS26015"
                     /pseudo
     CDS             481957..>482067
                     /locus_tag="PPUBIRD1_RS26015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013971732.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
     gene            complement(482095..483006)
                     /locus_tag="PPUBIRD1_RS02065"
                     /old_locus_tag="PPUBIRD1_0415"
     CDS             complement(482095..483006)
                     /locus_tag="PPUBIRD1_RS02065"
                     /old_locus_tag="PPUBIRD1_0415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790360.1"
                     /note="Coenzyme PQQ synthesis protein B; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein B"
                     /protein_id="WP_014589432.1"
                     /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIAL
                     SDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLRE
                     GCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP
                     LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLL
                     VDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPI
                     LDEDSPERAEVLRRGVEVAFDGMSIEL"
     gene            complement(483085..483156)
                     /gene="pqqA"
                     /locus_tag="PPUBIRD1_RS26020"
     CDS             complement(483085..483156)
                     /gene="pqqA"
                     /locus_tag="PPUBIRD1_RS26020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003253598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone precursor peptide PqqA"
                     /protein_id="WP_003243383.1"
                     /translation="MWTKPAYTDLRIGFEVTMYFANR"
     gene            complement(483316..485616)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_RS02070"
                     /old_locus_tag="PPUBIRD1_0416"
     CDS             complement(483316..485616)
                     /gene="pqqF"
                     /locus_tag="PPUBIRD1_RS02070"
                     /old_locus_tag="PPUBIRD1_0416"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576182.1"
                     /note="Coenzyme PQQ synthesis protein F; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ biosynthesis protein PqqF"
                     /protein_id="WP_014589433.1"
                     /translation="MPDAIRQLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPAKW
                     PGLAHFLEHLFFLGTLRFPLEDGLMRYVQALGGQVNASTRERATDFFFEVPPNALGGG
                     LERLCQMLAEPNLGIERQRREREVIHAEFIAWSRNPSAQQQFALLQSVSAKHPLGAFH
                     AGNRYTLALHDAAFQQALAGFHQRFYQGGQICLSLCGPQPLDELERLARQHAELFAAG
                     ERVPQMLPPPLPAIASSLTFTHQGLPSGAEHALELLFAYLEDSRPGTWLGALRERGWL
                     QRFTAERLYAFAGQLLWHLDLKLSADACPDEASALLQGWFKFIRQADREQLNHQFGLL
                     QRSRAHSASALELARRDSTGQPFAKLDTQGLQALGALLESLPGGDHGDWQLLPVDPLL
                     KADLPHAKTQPLPAAMKISDQLPPARQFAALYLRWHVPSPLRQPLERVLEQALAPLQE
                     RCDRASVQLQYSSAGEYWQLRCAGLPAAVLRAVEQALALMLKPPASCWLPCTAQPPAL
                     IPIRALLKQLPDAVRGSVPEVVPACTLTQQQLDSLWLHTEWHGMAAGFEDTALNALGT
                     ALLQCPGQGSRPSPLPSWANHRWQHAHVPGSEHALLLFCPLPAAKEAAGRLLAQLLQG
                     PVYQRLRVDLQLGYAVFSAFRQIEGVGGLLFGVQSPHTAQAQVLDHLLSLLRHGVTLD
                     PAARQALAGQFDEPAMADADVAEWAWQTHLATQADRLDVLRRSILTTRQTDLDHLLSD
                     LLDPGSAWLCLANAAAPDTSWQGENR"
     gene            complement(485757..486551)
                     /locus_tag="PPUBIRD1_RS02075"
                     /old_locus_tag="PPUBIRD1_0417"
     CDS             complement(485757..486551)
                     /locus_tag="PPUBIRD1_RS02075"
                     /old_locus_tag="PPUBIRD1_0417"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="WP_014589434.1"
                     /translation="MRIALYQGAPKPLDVPGNLQRLLHQAQLAAERGAQLLVCPEMFL
                     TGYNIGLAQVERLAEAADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDA
                     HGRSLSNYRKTHLFGELDRSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLAL
                     DGAELILVPTANMTPYDFTCQVTVRARAQENQCYLVYANYCGAEDEIQYCGQSSIIGP
                     DGSLLAMAGRDECQLLAELEHERVVQGRRAFPYLTDLRQELHLRKG"
     gene            complement(486566..488248)
                     /locus_tag="PPUBIRD1_RS02080"
                     /old_locus_tag="PPUBIRD1_0418"
     CDS             complement(486566..488248)
                     /locus_tag="PPUBIRD1_RS02080"
                     /old_locus_tag="PPUBIRD1_0418"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_003255585.1"
                     /translation="MNKKNRHPADGKKPITIFGPDFPFAFDDWLEHPAGLGSIPAERH
                     GEEVAIVGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIVAELGGMR
                     FPVSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKPTDLPQLFHEVA
                     DAWADALESGAQFADIQQAIRDRDVPRLKELWNKLVPLWDDRTFYDFVATSRSFAKLS
                     FQHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHV
                     PERCVHWPEGTSLSTLHGGAPRTGVKRIARAADGRLAVTDNWGDTRHYSAVLATCQTW
                     LLTTQIDCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLLSMTLT
                     DRLTRGTYLFDNGNDKPGVICLSYSWMSDALKMLPHPVEKRVQLALDALKKIYPKTDI
                     AGHIIGDPITVSWEADPYFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGIFIAGD
                     DVSWTPAWVEGAVQTSLNAVWGIMNHFGGHTHPDNPGPGDVFNEIGPIALAD"
     gene            complement(488588..489049)
                     /locus_tag="PPUBIRD1_RS02085"
                     /old_locus_tag="PPUBIRD1_0419"
     CDS             complement(488588..489049)
                     /locus_tag="PPUBIRD1_RS02085"
                     /old_locus_tag="PPUBIRD1_0419"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_003255583.1"
                     /translation="MSDSRSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNS
                     RLERLEKNKVISGYGVRLGQSVIGGGLQAYVGIKVQPRSGKDVVRRLSAMGQVQQLCA
                     VSGEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPL"
     gene            489237..489791
                     /locus_tag="PPUBIRD1_RS02090"
                     /old_locus_tag="PPUBIRD1_0420"
     CDS             489237..489791
                     /locus_tag="PPUBIRD1_RS02090"
                     /old_locus_tag="PPUBIRD1_0420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019439094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="WP_014589435.1"
                     /translation="MNLDHLLECWRLEVSNKKRPGRPISLLFNVLRRARKDNKLRFLF
                     AYRLAQYLDARGGLARRHARRMQQRLNLKYGVDIDIGAQIAPGLRIAHLPGVVITRYV
                     SIGRNFFIRQNCSIGIKTLGLDEYALRIGDNVSMGANSCIVADRIDIGDDVVIGAMSL
                     VTRDIPPGMTFYNPRQVEMRPGGG"
     gene            complement(490356..490432)
                     /locus_tag="PPUBIRD1_RS02095"
                     /old_locus_tag="PPUBIRD1_t0061"
     tRNA            complement(490356..490432)
                     /locus_tag="PPUBIRD1_RS02095"
                     /old_locus_tag="PPUBIRD1_t0061"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(490396..490398),aa:Met,seq:cat)
     gene            complement(490449..494192)
                     /locus_tag="PPUBIRD1_RS02100"
                     /old_locus_tag="PPUBIRD1_0423"
     CDS             complement(490449..494192)
                     /locus_tag="PPUBIRD1_RS02100"
                     /old_locus_tag="PPUBIRD1_0423"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional diguanylate
                     cyclase/phosphodiesterase"
                     /protein_id="WP_014589437.1"
                     /translation="MSLKPAILLLILILWNTTAGALTLTDEENAWLAAHPQLKLGVDA
                     SWPPFEFRDQEGRYQGLAADYIAMIQQRLGVTFKPVEPSSWTEVLVQARESRIDLLPG
                     IMSTPERQGFLAFTRPYLDFPIVILAHKGGAQPRKLADLYGLKIAVVENYAPHELLRT
                     HHPDLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQ
                     LAMAVPRDKSVLVGILDKVMADMSSSEISQIQQHWVGNVVDQRMFWSDLLVYGLPTVL
                     LLMAVLAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTY
                     SYVSPHAEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIR
                     ADGQPLWVRNIVSMIEHGHQPVMRGLMIDISETKRTEDALRLSEQKFASVFQQCPDIL
                     LIARHSDGCLLEVNEAFEEQIGLPPDQVIGRTATDLDLWGVEGSGPLLLERLHQGGIR
                     NLEMSFRRSNGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQQQLQTSEEKFAKA
                     FHASPDGLLLSRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRLVD
                     QLNRDGFVRDFTCHIRRSDGQIRLCELSARPLPITGVDCMLTIARDITERHLMQEKLQ
                     LAATVFENTAEGVLITDIDQRISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFY
                     LAMWHQLTAEGHWQGEIYNKRKNGELYPSWLTISAVRNSDREITHFVAVFADISSIKH
                     AQAKLDYQAHHDPLTGLPNRTLFENRLQGVLTCAQVSNRQGAVLFLDLDRFKHINDSL
                     GHPVGDLLLKGIAQRLKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACF
                     NAPFQAGEHEFFTSASIGISLYPQDGTDVSTLIRNADAAMYRSKAKGRNRVEAYTRDL
                     TAQASERIALEHELRRAVERNEMSLCFQPKLSLKTQSLVGAEALIRWSHPTFGEVPPE
                     HFIHLAEENGTILQLGDWVLEQACRQMQAWKQHYEPFGPLSINLAGAQLRHPHLARRI
                     EQLLKHHQLKAGDLQLEITENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSY
                     LKRLPLDILKIDKSFIRGLPDDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLA
                     AEGCEQIQGYIVSLPLPPEEFAAAFLRIALSDLSDGTGAKPSL"
     gene            complement(494320..496170)
                     /locus_tag="PPUBIRD1_RS02105"
                     /old_locus_tag="PPUBIRD1_0424"
     CDS             complement(494320..496170)
                     /locus_tag="PPUBIRD1_RS02105"
                     /old_locus_tag="PPUBIRD1_0424"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020302171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_003255578.1"
                     /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRL
                     SDVLSGYIDPDDNIAAPTEEVPIPGAKAAAAKEESDDDEEESESGDDEEEAESGPDPV
                     VAAQRFGAVSDQLQATSKVLKKNGRNHKESIEALQALADLFMPIKLVPKQFEVLVERV
                     RDALNRLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALG
                     EKNAAIVACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARRAKKEMVEANLRLVIS
                     IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQA
                     RTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPI
                     SMETPIGDDEDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRF
                     GIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
     gene            complement(496238..498219)
                     /locus_tag="PPUBIRD1_RS02110"
                     /old_locus_tag="PPUBIRD1_0426"
                     /pseudo
     CDS             complement(496238..498219)
                     /locus_tag="PPUBIRD1_RS02110"
                     /old_locus_tag="PPUBIRD1_0426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755126.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
     gene            complement(498525..498740)
                     /locus_tag="PPUBIRD1_RS02115"
                     /old_locus_tag="PPUBIRD1_0427"
     CDS             complement(498525..498740)
                     /locus_tag="PPUBIRD1_RS02115"
                     /old_locus_tag="PPUBIRD1_0427"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_003255575.1"
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRAVRLY"
     gene            498945..499970
                     /gene="tsaD"
                     /locus_tag="PPUBIRD1_RS02120"
                     /old_locus_tag="PPUBIRD1_0428"
     CDS             498945..499970
                     /gene="tsaD"
                     /locus_tag="PPUBIRD1_RS02120"
                     /old_locus_tag="PPUBIRD1_0428"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237706.1"
                     /note="Probable O-sialoglycoprotein endopeptidase; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     transferase subunit TsaD"
                     /protein_id="WP_014589440.1"
                     /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVP
                     ELASRDHVKRMLPLIRQVLDEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAW
                     DIPAIGVHHMEGHLLAPMLEENPPEFPFVALLVSGGHTQLVRVDGIGQYELLGESLDD
                     AAGEAFDKTAKLIGLNYPGGPEIARLAEQGVPGRFVFPRPMTDRPGLEFSFSGLKTFA
                     LNTWQQCRNAGDDSEQTRCDLSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSAN
                     KALRASLEDMLGSIKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQQQDLAISVQARWP
                     MEQLPPL"
     gene            complement(499988..500557)
                     /locus_tag="PPUBIRD1_RS02125"
                     /old_locus_tag="PPUBIRD1_0429"
     CDS             complement(499988..500557)
                     /locus_tag="PPUBIRD1_RS02125"
                     /old_locus_tag="PPUBIRD1_0429"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_014589441.1"
                     /translation="MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNML
                     RLAGRKLAILTLLGDLCKGLLPVLLARAAGLDLHAQAWVGICAVLGHLFPLYFRFKGG
                     KGVATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEAL
                     LPISVLTVMIVWRHRNNLRDLFAGRERHF"
     gene            500632..500988
                     /gene="folB"
                     /locus_tag="PPUBIRD1_RS02130"
                     /old_locus_tag="PPUBIRD1_0430"
     CDS             500632..500988
                     /gene="folB"
                     /locus_tag="PPUBIRD1_RS02130"
                     /old_locus_tag="PPUBIRD1_0430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_004576188.1"
                     /translation="MDRVFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAG
                     DDLNLALDYASVSARIQAFAEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAV
                     PAARGGVGVEIERGCL"
     gene            500979..501488
                     /gene="folK"
                     /locus_tag="PPUBIRD1_RS02135"
                     /old_locus_tag="PPUBIRD1_0431"
     CDS             500979..501488
                     /gene="folK"
                     /locus_tag="PPUBIRD1_RS02135"
                     /old_locus_tag="PPUBIRD1_0431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016715762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_003255569.1"
                     /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQA
                     VGIKSGPFINFVVTGQTALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLH
                     GTFDGLVLPRAEILKNAFVLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFE
                     WRGLQLTPA"
     gene            complement(501736..502842)
                     /locus_tag="PPUBIRD1_RS02140"
                     /old_locus_tag="PPUBIRD1_0432"
     CDS             complement(501736..502842)
                     /locus_tag="PPUBIRD1_RS02140"
                     /old_locus_tag="PPUBIRD1_0432"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576190.1"
                     /note="Multifunctional CCA protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multifunctional CCA tRNA nucleotidyl
                     transferase/2'3'-cyclic
                     phosphodiesterase/2'nucleotidase/phosphatase"
                     /protein_id="WP_014589443.1"
                     /translation="MHIYKVGGAVRDRLLGRPFSDIDWLVVGATVEEMLAKGYRPVGA
                     DFPVFLHPKTGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLIRRDLTINAMAEDE
                     AGTVYDPYQGKNDLDQRLLRHVSPAFAEDPLRVLRVARFAARYAPLGFRVADETLALM
                     RQISASGELQALTAERSWKEIERALMEVQPQVFFKVLSACGALQELLPELDDGSRTLA
                     ALEQAAAHEQPLHVRWACLLRGLPPTSIKAVNQRLKAPRECQELAMLAGECLAQGNQA
                     LELPATALLELLQKFDVYRRPQRFEDFLAVCEMAARGDGKQGYPQADYLRGAAAAARA
                     VDVKPLVQAGLTGQALGEALKGERLKALEAYQRG"
     gene            complement(502898..504466)
                     /locus_tag="PPUBIRD1_RS02145"
                     /old_locus_tag="PPUBIRD1_0433"
     CDS             complement(502898..504466)
                     /locus_tag="PPUBIRD1_RS02145"
                     /old_locus_tag="PPUBIRD1_0433"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016497701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVR family protein"
                     /protein_id="WP_010951740.1"
                     /translation="MTARAQRRQPISTGSEWTFELIQTYDREISRLAERYALDTYPNQ
                     IEVITAEQMMDAYASVGMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIA
                     YLMEENTMCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEER
                     HGIDAVEDLIDSCHALMNYGVDRYKRPYPISAEEERRRQQEREEHLQRQINDLWRTIP
                     KNAEKGNDRDEGRFPAEPQENILYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQ
                     VMNEGWATFWHYTLMNDLYDEGLITEGFMMEFLQSHTSVVFQPGFDSPYYSGINPYAL
                     GFAMYTDIRRMCENPTEEDRHWFPEIAGSDWLSTIKFAMSSFKDESFILQYLSPKVMR
                     DLKLFSILDDDQRDDLLVPAIHDEAGYRVIREQLAAQYNLGNREPNVQIWSVDRRGDR
                     SLTLRHQQHNRKPLGDSTDEVLKHLHRLWGFDIHLETVQGEQVMSTHHMPPRGEHSES
                     ADYGRMDLAVIHHL"
     gene            complement(504463..505734)
                     /locus_tag="PPUBIRD1_RS02150"
                     /old_locus_tag="PPUBIRD1_0434"
     CDS             complement(504463..505734)
                     /locus_tag="PPUBIRD1_RS02150"
                     /old_locus_tag="PPUBIRD1_0434"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019693928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255564.1"
                     /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIM
                     DMEHGEQISIPGRDIDEPVLHHGRGGKQTIVHPGNKEFTAGEHIPRPQGGGGGGGRGK
                     AGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRHLTGADTFKTVRAGIANEGNPS
                     RINIVRTLRSAHARRIALTGSSRALLREAQKELDRLRVEEPDNFTDIQEVEQEIERLK
                     ARINRLPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYL
                     FLKRNYERIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPASD
                     WNIYAAQASDGDNWNDDSPICRDILSKQIMPHVQYYTYVEITPREHQALWYEYERIGD
                     AFPDTFAQQQLVSAGDIYPVFRELFQRRLAT"
     gene            complement(505890..507812)
                     /locus_tag="PPUBIRD1_RS02155"
                     /old_locus_tag="PPUBIRD1_0435"
     CDS             complement(505890..507812)
                     /locus_tag="PPUBIRD1_RS02155"
                     /old_locus_tag="PPUBIRD1_0435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020295462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PrkA family serine protein kinase"
                     /protein_id="WP_003255563.1"
                     /translation="MSIFSHFQQRFESTRQEELSLQEYLELCKEDRSAYASAAERLLL
                     AIGEPELIDTSTNSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEK
                     KQILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNATEDGAILEEE
                     FGIPRRYLNTIMSPWATKRLQEFGGDISKFKVVKLYPSILNQIAIAKTEPGDENNQDI
                     SALVGKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQ
                     EGNYNSTEGLGAIPYTGILLAHSNESEWHTFRNNKNNEAFIDRIYIVKVPYCLRVSDE
                     IKIYDKLLVNSSLSKAHCAPDTLKMLAQFTVLSRLKEPENSNIYSKMRVYDGENLKDT
                     DPKAKSIQEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQI
                     EQEQFPAEVRERYLRYLKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADF
                     WIQDQEYRDPETGEILNRIALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGK
                     NPSWLSYEKLRVVIEKKMFSNTEDLLPVISFNAKASKEDQKKHNDFVTRMVERGYTDK
                     QVRLLSEWYLRVRKSQ"
     gene            complement(508095..508427)
                     /locus_tag="PPUBIRD1_RS02160"
                     /old_locus_tag="PPUBIRD1_0436"
     CDS             complement(508095..508427)
                     /locus_tag="PPUBIRD1_RS02160"
                     /old_locus_tag="PPUBIRD1_0436"
                     /EC_number="2.8.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010221442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase"
                     /protein_id="WP_010951742.1"
                     /translation="MSEFKRIPPEQALELRKKEGAVVVDIRDPQAFAAGHITGARHLD
                     NHSVADFIRNADLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPA
                     ETAQGNAE"
     gene            complement(508442..509308)
                     /locus_tag="PPUBIRD1_RS02165"
                     /old_locus_tag="PPUBIRD1_0437"
     CDS             complement(508442..509308)
                     /locus_tag="PPUBIRD1_RS02165"
                     /old_locus_tag="PPUBIRD1_0437"
                     /EC_number="3.6.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016715768.1"
                     /note="Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase
                     (symmetrical)"
                     /protein_id="WP_014589444.1"
                     /translation="MATYAVGDLQGCLQPLKCLLDRVSFNPAVDRLWLVGDLVNRGPE
                     SLETLRFLYSIRHSLVCVLGNHDLHLLAAWHNVERLKKSDTLREIIEAPDADQLFDWL
                     RQQKLLHYDEPRGIALVHAGIPPQWTLGKALELAAEVEEVLRDDTRLQLYLDGMYGNE
                     PNKWSKNLAGVERLRVITNYFTRMRFCTADGKLDLKSKEGLGSAPKGYKAWYAHKDRR
                     SRHVKIIFGHWAALQGEVTEPDVIALDTGCVWGGAMTLYNVDSGQYHRCDCADDGTLR
                     QPAQPTTLNDHT"
     gene            complement(509308..509688)
                     /locus_tag="PPUBIRD1_RS02170"
                     /old_locus_tag="PPUBIRD1_0438"
     CDS             complement(509308..509688)
                     /locus_tag="PPUBIRD1_RS02170"
                     /old_locus_tag="PPUBIRD1_0438"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019650335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Co2+/Mg2+ efflux protein ApaG"
                     /protein_id="WP_003255559.1"
                     /translation="MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSA
                     KLLSRHWLITNGDGEVEEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQM
                     FAEDGKRFDAEIAPFRLAVPGALH"
     gene            complement(509886..510689)
                     /locus_tag="PPUBIRD1_RS02175"
                     /old_locus_tag="PPUBIRD1_0439"
     CDS             complement(509886..510689)
                     /locus_tag="PPUBIRD1_RS02175"
                     /old_locus_tag="PPUBIRD1_0439"
                     /EC_number="2.1.1.-"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase A"
                     /protein_id="WP_003255558.1"
                     /translation="MNEQYQHRARKRFGQNFLHDAGIIDRILRAINAKAGEHLLEIGP
                     GQGALTEGLLGSGAQLDVVELDKDLVPILQHKFADRSNFRLHQGDALKFDFNQLGVPP
                     RSLKVVGNLPYNISTPLIFHLLSHAGLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIM
                     VQYHCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPFPAKDHLLLERVVREAFNQR
                     RKTLRNTMKGLLDSAAIEAAGVDGSLRPEQLDLAAFVRLADQLADQQQA"
     gene            complement(510686..511675)
                     /gene="pdxA"
                     /locus_tag="PPUBIRD1_RS02180"
                     /old_locus_tag="PPUBIRD1_0440"
     CDS             complement(510686..511675)
                     /gene="pdxA"
                     /locus_tag="PPUBIRD1_RS02180"
                     /old_locus_tag="PPUBIRD1_0440"
                     /EC_number="1.1.1.262"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009685238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_014589445.1"
                     /translation="MKPLRFAVTPGEPAGIGPDLCLLLAADAQPHPLIAITSRDLLAE
                     RATQLGLAVSLLPVAPGQWPDLPAPAGSLYVWDTPLAAPVVPGQLDKANAAFVLETLT
                     RAGQGCLDGHFAGMITAPVHKGVINESGIAFSGHTEFLAELTRTAQVVMMLATRGLRV
                     ALVTTHLPLRDVADAITAERVERVTRILHADMRDKFGIANPRILVCGLNPHAGEGGHL
                     GREEIDIIEPTLARLRTEGMDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYK
                     GFGAAVNVTLGLPIIRTSVDHGTALDLAGTGKIDTGSLRVALETAYQMAENRP"
     gene            complement(511672..512991)
                     /locus_tag="PPUBIRD1_RS02185"
                     /old_locus_tag="PPUBIRD1_0441"
     CDS             complement(511672..512991)
                     /locus_tag="PPUBIRD1_RS02185"
                     /old_locus_tag="PPUBIRD1_0441"
                     /EC_number="5.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009404256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase SurA"
                     /protein_id="WP_014589446.1"
                     /translation="MKTKLIDRLRPVLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQ
                     SQLDQRVHEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELN
                     QAIGTIAQRNGMSLDQFRAALARDGLSFEDAREQVKREMIISRVRQRRVAERIQVSEQ
                     EVKNFLASDLGKMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFG
                     QMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLE
                     EKRGGSENVLRDEVHVRHILIKPSEIRSEAATQQLAERLYDRIKNGEDFGELAKSFSE
                     DPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDS
                     TEQAREQQALGVLRNRKYDEELQTWLRQIRDEAYVEIKLPGADQAAQ"
     gene            complement(512972..515779)
                     /locus_tag="PPUBIRD1_RS02190"
                     /old_locus_tag="PPUBIRD1_0442"
     CDS             complement(512972..515779)
                     /locus_tag="PPUBIRD1_RS02190"
                     /old_locus_tag="PPUBIRD1_0442"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS-assembly protein LptD"
                     /protein_id="WP_014589447.1"
                     /translation="MALKSPAFRRKFPLLVTGGLLALQPLATSYVVAAEQFDCQVSAA
                     GGWDCKPKTPVNNLPPRPVHEGAAVSSGTEAAGEAETADRPMLVTEAKGRGLKSRSED
                     YSHLDWVPREKLTAAQLAETGPYCGGAYIEPTRPGMADTTPKDESPTYINAKVSKYQQ
                     EQQIATLAGDVVMRQGSMQAEADEANLYQAENRGELKGNVKIRDNGSLVVGDEAQIQL
                     DTGEAQVDNAEYVMHKSHIRGSALYAKRGENAIIRLKDGTYTTCEPGSNAWQLKGNNI
                     TLNPATGFGTATNVTLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSTSSDTGFMLVT
                     PYYFNLAPNYDATLYPRYMAKRGLLMEGEFRYLTPSSEGQFGGAYLNDKNDDRKDQTD
                     YKDQRWMVNWQHKGGLDERLMTEVDYTDISDPFYFQDLESDQIGVESRDLLNQQGALT
                     YRGDSYTARLNVHAYEMATISQITPYDRLPQLTLNGTLPFQPGGLNLGYETEAVRFDR
                     DLKDDFVLDEDGNPDASAGVPGRRLDENIFGVARANGTRLNVAPSISLPMEASYGYIT
                     PKLKYMYTHYDLDLDSKGKSDIAGANADTLDVFGDYKSNLNRDIPIFSVDSGLYFDRN
                     TSLFGTNYRQTLEPRMFYLYVPYKDQMDIPLFDTGETLFSYDSLFRDNRFSGTDRIGD
                     ENKLSLGVTTRWIEENGFERQNFSIGQAYYFKDRKVQLPGIDYRTRKDAQSDVSPYAL
                     VYNYYFNRDWRFNSDFNWDPDSRSTRSGSAMFHYQPEDNPNKIVNLGYRYRNDTIAYD
                     STTGTWKVGGGDYGTPGDPNYIKDYYKIQQHDFSVIWPIVPQWNVIARWQHDYNRNRT
                     LEAMGGFEYDNCCWKLRLINRYWIDYDDFSQALPQNEKGDHGVFLQIVLKGLGGVVGN
                     KVESFLDQGIQGYREREDQAY"
     gene            515910..516929
                     /locus_tag="PPUBIRD1_RS02195"
                     /old_locus_tag="PPUBIRD1_0443"
     CDS             515910..516929
                     /locus_tag="PPUBIRD1_RS02195"
                     /old_locus_tag="PPUBIRD1_0443"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_014589448.1"
                     /translation="MPEHDVRLQQLTVWLDEQLNDLFRDNAWGEVPAGSLTAASSDAS
                     FRRYFRWQGAGHSFVIMDAPPPQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLL
                     GDLGTQTYLDIINADNADGLFADAIDALLKFQRLPMDAPLPSYDDALLRREVELFPEW
                     YVGRELGLSLTDAQKATWQRVSQLLIDSALAQPKVLVHRDYMPRNLMQSTPNPGVLDF
                     QDAVYGPVTYDITCLFKDAFVSWPQARVEGWLSDYWQQAQAAGIPVHAEFEAFHRASD
                     LMGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFAYINEVIGRRPELAELGELIAELQ
                     AGARA"
     gene            516926..517597
                     /locus_tag="PPUBIRD1_RS02200"
                     /old_locus_tag="PPUBIRD1_0444"
     CDS             516926..517597
                     /locus_tag="PPUBIRD1_RS02200"
                     /old_locus_tag="PPUBIRD1_0444"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="WP_010951745.1"
                     /translation="MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAA
                     GVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFL
                     LVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF
                     SGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESL
                     IGERA"
     gene            517599..518366
                     /locus_tag="PPUBIRD1_RS02205"
                     /old_locus_tag="PPUBIRD1_0445"
     CDS             517599..518366
                     /locus_tag="PPUBIRD1_RS02205"
                     /old_locus_tag="PPUBIRD1_0445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009685244.1"
                     /note="heat shock protein DnaJ domain protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DjlA"
                     /protein_id="WP_014589449.1"
                     /translation="MWWPGTVIGVGAGFAVANIPGALLGALLGQAIDRRLRLQGWEDM
                     RERLGGRPALRDDELLFVMLGRLAKCDGRVAEQHIQQARQEMVRLDLAEAARLRAINA
                     FNRGKAGKDRLGGHLRRISQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLG
                     MSRRQVQAMSLEYEPRKATGAESVPMTYAAALRLLAVDADTDTDKVKQAYRRLVSRHH
                     PDKLAGTGASEAQVREATARTRELHQAYAMIRKRRGL"
     gene            complement(518393..519391)
                     /locus_tag="PPUBIRD1_RS02210"
                     /old_locus_tag="PPUBIRD1_0446"
     CDS             complement(518393..519391)
                     /locus_tag="PPUBIRD1_RS02210"
                     /old_locus_tag="PPUBIRD1_0446"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589450.1"
                     /translation="MSTLYRTTLAMCCLASVLPLGALAADAEKPPANTMAPAAEAPRP
                     PLLERSQEDALALERLLPKAEQQTLQAGADSFLALWKPANDNDPQGAVIIVPGAGETA
                     DWPNAVGPLRQKFPDIGWHSLSVSLPDLLADSPQARVEATPPAAPAPDKGESAPVKDV
                     PADANANVAQATAADADTADSTDAEQASEQADPADAERIFARLDAAVAFAQQHNTRSI
                     VLIGHGSGAYWAARYLSEKQPPQVQKLVMVAAQTPARVEQDLESLAPTLKVPTADIYY
                     ATRSADRNAAQQRLQASKRQKDSQYRQLSLIAMPANKAAEQEQLFRRVRGWMSPQG"
     gene            519487..521874
                     /locus_tag="PPUBIRD1_RS02215"
                     /old_locus_tag="PPUBIRD1_0447"
     CDS             519487..521874
                     /locus_tag="PPUBIRD1_RS02215"
                     /old_locus_tag="PPUBIRD1_0447"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019439101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_019439101.1"
                     /translation="MKRVRRLLVIGCLWLPLIAWAKPEALPTVVLEPDQQQWLDTHRS
                     LRVGLVLQAPYAQFDRRLQQLYGANVELVNSLAQTLRLDLTWRNFSDQASLEHALQSG
                     EIDFAPGLTQTPASLRLWLFSDPYMRVPQLVVGPRTGAMAVELEKLEAEQRVAVRMPS
                     PLADYLRSNYGNLNLQGVPDDREALQLVVGGQASFAVLDEAQLSRLSRESEFSELAVV
                     GDIGLPQLLRIGSRRDWPLLADVLERGLQALPAKELEQLHQRWLQPKYPRLSESPGFW
                     QNMALLFGLLLLCALATLVWQRRQQRQLERSLLAARESLVERQVREEALRLSQFAIDQ
                     STVGILWVNWDSHVRYANHAAERMLGYSEGALLERPLSDFEPSLNMDRWLELWKGART
                     GAGGVGQFETQCRRADQSLLPVELSLSFLRFRDSEYLVVYLADVTERHRALAALRESE
                     ARLKGIAGNVPGLVFRLERDPAEGDLEFPYISEGSEALVGYAPSEIQHPQMGLRNLVH
                     PEDRADYHRVQDLALASDQDWSWQGRILTRQGEQRWADIKASARHLGNGQVVWDGVVW
                     DITQGKRAELALAKSQEQLRELSAHLESVREEEKARIAREVHDELGQMLTVLKLEVSM
                     CELAYAELDPGLNDRLASMKRLIAQLFQLVRDVATALRPPILDAGIASAIEWQARRFE
                     ARTQIPCLVQVPDNLPALSDAKATGLFRILQEALTNVMRHAQAHSVEIELVREGGQLR
                     MTVSDDGQGFCREQTRPTSFGLVGVRERVLMLGGSMTLESEPGEGTSLSVAIPLE"
     gene            521885..522514
                     /locus_tag="PPUBIRD1_RS02220"
                     /old_locus_tag="PPUBIRD1_0448"
     CDS             521885..522514
                     /locus_tag="PPUBIRD1_RS02220"
                     /old_locus_tag="PPUBIRD1_0448"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_010951749.1"
                     /translation="MIRVLVAEDHTIVREGIKQLIGLAKDMQVAGEAGNGEQLLETLR
                     HTPCEVVLLDISMPGVNGLEAIPRIRALHDAPAILMLSMHDEAQMAARALKAGAAGYA
                     TKDSDPALLLTAIRRVAGGGRYIDPSLADRMVFEVGLTESRPLHTLLSEREFSVFERL
                     AQGANVNDIAQQLALSSKTISTHKARLMQKLKVNSLAELVKYAMEHKLI"
     gene            522810..523934
                     /locus_tag="PPUBIRD1_RS02225"
                     /old_locus_tag="PPUBIRD1_0449"
     CDS             522810..523934
                     /locus_tag="PPUBIRD1_RS02225"
                     /old_locus_tag="PPUBIRD1_0449"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019472252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_003255547.1"
                     /translation="MSEAKSNAATGETLVSFRGVQKSYDGESLIVKDLNLDIRKGEFL
                     TLLGPSGSGKTTSLMMLAGFETPTAGEIQLGGRSINNVPPHKRDIGMVFQNYALFPHM
                     TVAENLAFPLTVRNLSKTDISERVKRVLNMVQLDAFAKRYPGQLSGGQQQRVALARAL
                     VFEPQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAV
                     FHQGEIQQIADPRTLYEEPCNTFVANFIGENNRISGTLLASDGKRCQVQLPRGERVEA
                     LAVNVGQAGEPVTLSIRPERVRLNGHSESCVNRFSGRVAEFIYLGDHVRVRLEVCGKG
                     DFFVKQPIAELDPALAVGDVVPLGWEVEHARALDPIAEAH"
     gene            523975..525009
                     /locus_tag="PPUBIRD1_RS02230"
                     /old_locus_tag="PPUBIRD1_0450"
     CDS             523975..525009
                     /locus_tag="PPUBIRD1_RS02230"
                     /old_locus_tag="PPUBIRD1_0450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016393193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589452.1"
                     /translation="MRKQLKLTALALGLFTAGQAMAADLTVISFGGANKAAQVKAFYE
                     PWEKAGNGKIVAGEYNGEMAKVKAMVDTKSVSWNLVEVESPELARGCDEGMFEELDPA
                     LFGNKDDYVPGAIQPCGVGFFVWSTVMAYNADKLKTAPTSWADFWDTKQFPGKRGLRK
                     GAKYTMEFALMADGVAPKDVYKVLATKEGQDRAFKKLDELKPSIQWWEAGAQPPQFLA
                     SGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKNVEEAKKFIAYSVK
                     PEQQKIYSENIAYGPANSKAVSLLSDEVKKDMPTTPENIANQVQIDVTFWADNSEQLE
                     QRFNAWAAKK"
     gene            525070..526317
                     /locus_tag="PPUBIRD1_RS02235"
                     /old_locus_tag="PPUBIRD1_0451"
     CDS             525070..526317
                     /locus_tag="PPUBIRD1_RS02235"
                     /old_locus_tag="PPUBIRD1_0451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004660143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589453.1"
                     /translation="MAIAVPLNEGAGPSLKQRLKHAERVNRWKAQALIAPLALFLLLV
                     FLVPIAALLYKSVGNPEVVAGLPRTVEVISQWDGKSLPGEDVYKALSQDLAESRKNQT
                     LGDLSKRLNMELAGYRSLLTKTARALPFKAEPASYKEALQAVDERWGDPAYWQAIRRN
                     TSSVTSFYLLASVDHRIDDLGELAKATPDQAIYLDIFVRTLWMGVVITTICLVLAYPL
                     AYLLANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINSALMAMGIIDQPL
                     ELVFNRTGVYISMVHILLPFMILPLYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQ
                     TYAGVGAGCLLVFILAIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLL
                     LLATVLLYLIYSWLVGASRLRLS"
     gene            526328..527155
                     /locus_tag="PPUBIRD1_RS02240"
                     /old_locus_tag="PPUBIRD1_0452"
     CDS             526328..527155
                     /locus_tag="PPUBIRD1_RS02240"
                     /old_locus_tag="PPUBIRD1_0452"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter permease"
                     /protein_id="WP_014589454.1"
                     /translation="MLSPYMSPVERVWFYSLRILCGLILLFLILPVLVIVPLSFNSGS
                     FLVYPLQGFSLQWYQDFFGSAEWMRALKNSIIVAPAATVLAMVFGTLAAIGLTRGDFP
                     GKSLVMALVISPMVVPVVIIGVASYLFFAPLGMGNSFTSLILVHAVLGVPFVIITVSA
                     TLQGFNYNLVRAAASLGASPLLAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLA
                     GPEQATLPRQMFSGIRENLSPTIAAAATLLIAFSVVLLLTLEWLRGRSEKLRTQQPA"
     gene            527307..527981
                     /locus_tag="PPUBIRD1_RS02245"
                     /old_locus_tag="PPUBIRD1_0453"
     CDS             527307..527981
                     /locus_tag="PPUBIRD1_RS02245"
                     /old_locus_tag="PPUBIRD1_0453"
                     /EC_number="5.1.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003210966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_003255539.1"
                     /translation="MQPYAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVP
                     NLTIGPMVCTALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEATQHIDRS
                     LQLIKDGGCKAGLVFNPATSLDALKYVMDKIDMVLLMSVNPGFGGQKFIPGTLDKLRE
                     ARALIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYQEVIAKMRAE
                     LALARP"
     gene            527978..528796
                     /locus_tag="PPUBIRD1_RS02250"
                     /old_locus_tag="PPUBIRD1_0454"
     CDS             527978..528796
                     /locus_tag="PPUBIRD1_RS02250"
                     /old_locus_tag="PPUBIRD1_0454"
                     /EC_number="3.1.3.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_014589455.1"
                     /translation="MSGFEQLFPGTLPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGR
                     PPAGLEAVRHWVGNGAQVLVRRALAGGIDHADVDDALAEQALALFMDAYAESHELTVV
                     YPGVRDTLRWLRKQGVEMALITNKPERFVGPLLDQMKIGNFFRWIIGGDTLPQKKPDP
                     AALLFVMQMAGVTPQQSLFVGDSRSDVQAAKAAGVQCVGLTYGYNHGRPIDDESPSLV
                     IDDLRALLPGCADPATGITLADLQASQDRESTVAVTGKFWMKVIKALARWRWRA"
     gene            528866..530347
                     /locus_tag="PPUBIRD1_RS02255"
                     /old_locus_tag="PPUBIRD1_0455"
     CDS             528866..530347
                     /locus_tag="PPUBIRD1_RS02255"
                     /old_locus_tag="PPUBIRD1_0455"
                     /EC_number="4.1.3.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase component I"
                     /protein_id="WP_014589456.1"
                     /translation="MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSY
                     LLESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILHDGVEVESCEVEDPLAFVETFKD
                     RYKVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVF
                     DNLAGKMHAIVLVDPAEDQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPAFR
                     SSYTREDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMY
                     FFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIA
                     EHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVTGQLREGLTAMDALR
                     AILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVIKDG
                     ELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQTSAR"
     gene            complement(530620..532509)
                     /locus_tag="PPUBIRD1_RS02260"
                     /old_locus_tag="PPUBIRD1_0456"
     CDS             complement(530620..532509)
                     /locus_tag="PPUBIRD1_RS02260"
                     /old_locus_tag="PPUBIRD1_0456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="autotransporter domain-containing esterase"
                     /protein_id="WP_014589457.1"
                     /translation="MRKAPLLRFTLASLALACSQALAGPSPYSTLIVFGDSLADAGQF
                     PDLGGGTPGARFTNRDADGNFAPVSPMILGGRLGVAPGELNPSTSVGIQPDGNNWAVG
                     GYTTQQILDSITTTSETVIPPGNPNAGQVLRERPGYLANGLRADPNALYYLTGGGNDF
                     LQGLVNSPADAVAAGARLAASAQALQQGGARYIMVWLLPDLGQTPNFSGTPQQNPLSL
                     LSAAFNQSLISQLGQIDAQIIPLNIPVLLSEALASPSQFGLASDQNLVGTCYSGDSCV
                     ENPVYGINGTTPDPTKLLFNDSVHPTIAGQQLIADYAYSILAAPWELTLLPEMAHASL
                     RAHQDELRNQWQTPWQAVGQWQAFVASGAHDLDFDGQRSAASGDGRGYNLTVGGSYRL
                     NDAWRLGLAGGAYRQKLEAGEQDSDYKLNSYMASAFAQYRQDRWWADAALTAGHLDYS
                     DLKRTFALGVNDRSEKGDTDGEAWAMSGRLGYNLAADTSNWQLAPFISADYARVKVDG
                     YDEKSGRSTALGFDDQERTSRRLGVGLLGSVQVQPNTRLFAEVAQEHEFEDDEQDVTM
                     HLTSLPANDFTLTGYTPHSDLTRASLGVSHELVAGVHLRGNYNWRKSDELTQQGVSVG
                     VSVDF"
     gene            532877..533470
                     /locus_tag="PPUBIRD1_RS02265"
                     /old_locus_tag="PPUBIRD1_0457"
     CDS             532877..533470
                     /locus_tag="PPUBIRD1_RS02265"
                     /old_locus_tag="PPUBIRD1_0457"
                     /EC_number="4.1.3.27"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019341345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_003255531.1"
                     /translation="MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNP
                     ERIVVSPGPCTPSEAGVSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHG
                     KTSPVYHRDLGVFASLNNPLTVTRYHSLVVKRETLPDCLEVTAWTSHADGSVDEIMGL
                     RHKTLNIEGVQFHPESILTEQGHELFANFLKQTGGRR"
     gene            533480..534529
                     /gene="trpD"
                     /locus_tag="PPUBIRD1_RS02270"
                     /old_locus_tag="PPUBIRD1_0458"
     CDS             533480..534529
                     /gene="trpD"
                     /locus_tag="PPUBIRD1_RS02270"
                     /old_locus_tag="PPUBIRD1_0458"
                     /EC_number="2.4.2.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790440.1"
                     /note="Anthranilate phosphoribosyltransferase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_014589458.1"
                     /translation="MDIKSALSRIVGQLDLTTEEMREVMRQIMTGQCSEAQIGAFLMG
                     MRMKSESIDEIVGAVSVMRELAEKVELQSLDGVVDIVGTGGDGANIFNVSTASSFVLA
                     AAGCPVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSHHSA
                     MKHAAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFAQTLCRPLAEVLQRLGSKHVL
                     VVHSKDGLDEFSLAAPTFVAELKNGEITEYWVEPEDLGMKSQSLHGLAVESPQASLEL
                     IRDALGRRKTENGQKAAEMIVLNAGAALYAADHAMSLKAGVELAHDVLHTGLAWEKLQ
                     ELGAFTAVFKVENEA"
     gene            534526..535359
                     /gene="trpC"
                     /locus_tag="PPUBIRD1_RS02275"
                     /old_locus_tag="PPUBIRD1_0459"
     CDS             534526..535359
                     /gene="trpC"
                     /locus_tag="PPUBIRD1_RS02275"
                     /old_locus_tag="PPUBIRD1_0459"
                     /EC_number="4.1.1.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436725.1"
                     /note="Indole-3-glycerol phosphate synthase; involved in
                     tryptophan biosynthesis; amino acid biosynthesis; converts
                     1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate to
                     C(1)-(3-indolyl)-glycerol 3-phosphate and carbon dioxide
                     and water; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol-phosphate synthase"
                     /protein_id="WP_014589459.1"
                     /translation="MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKAADAPRGFA
                     NALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYF
                     QGSDEYLQQARAAVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAA
                     TAKDVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRD
                     RLAITESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQL
                     D"
     gene            535507..536211
                     /locus_tag="PPUBIRD1_RS02280"
                     /old_locus_tag="PPUBIRD1_0460"
     CDS             535507..536211
                     /locus_tag="PPUBIRD1_RS02280"
                     /old_locus_tag="PPUBIRD1_0460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin/lipoate A/B protein ligase family
                     protein"
                     /protein_id="WP_014589460.1"
                     /translation="MTDQPLALSVEQGLHAEQELLAAVCRGERESGVLFWRPTDHALV
                     MPRRMSRLGNFEVACAELAIAGWPVLLRETGGEPVPQSHSTVNVALVYAAPRSEGDHG
                     RIENAYERLCLPLCDVLREWGGVASVGEIDGAFCDGRYNVNLNGRKLVGTAQRWRQGL
                     GGKRPVVLVHGALLLDNERESMVAAVNRFNECCELEQRCRADAHIALHEVAPAAPWFE
                     RLSQAYAKVLAELPKD"
     gene            complement(536208..536852)
                     /locus_tag="PPUBIRD1_RS02285"
                     /old_locus_tag="PPUBIRD1_0461"
     CDS             complement(536208..536852)
                     /locus_tag="PPUBIRD1_RS02285"
                     /old_locus_tag="PPUBIRD1_0461"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016393183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator Crp"
                     /protein_id="WP_019436724.1"
                     /translation="MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFI
                     IKGSVTILIEDDDGHEMIIAYLNNGDFFGELGLFEPVDGEQQRSAWVRAKTECEVAEI
                     SYEKFRELARQDPEILYALGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPD
                     AMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKDLEERSLVQVKGKTMVVYGTR"
     gene            537044..537466
                     /locus_tag="PPUBIRD1_RS02290"
                     /old_locus_tag="PPUBIRD1_0462"
     CDS             537044..537466
                     /locus_tag="PPUBIRD1_RS02290"
                     /old_locus_tag="PPUBIRD1_0462"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004376171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_004376171.1"
                     /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPEAGGRNLGVRPMEML
                     LLGLGGCSSFDVVSILKKSRQAVESCEAFLEAERASEDPKVFTKIHMNFVVKGRGLKE
                     AQVKRAVELSAEKYCSASIMLERAGVEITHGYEIVELG"
     gene            complement(537543..538583)
                     /locus_tag="PPUBIRD1_RS02295"
                     /old_locus_tag="PPUBIRD1_0463"
     CDS             complement(537543..538583)
                     /locus_tag="PPUBIRD1_RS02295"
                     /old_locus_tag="PPUBIRD1_0463"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2157 domain-containing protein"
                     /protein_id="WP_014589462.1"
                     /translation="MTDRFDAKDLARAVQAGILQPGQDQSLLAFLRQQPAPRGSFQLA
                     HVAFYFGAMLIMAALGWLLTEAWMSLGDSALLIIASLYILLITLFALNLQRRAQPVAA
                     GVLAAVAVSIVPLAVFAIERMFGWWPLDDVQADYHQYYTYVQGGWLAMEAATVLAGLL
                     MLRLIPYPFVVMPMAVALWFMSMDLSEWFFGSPFSWEQRRQVSLWFGLGLLVVFLVID
                     GRTREDYARWGYLAGLAAFWGGLTLLESGSELGKAIYCLINIALMGMAVLLRRPVFMV
                     FGALGVAAYLGYLSYEVFAQSLLFPVVLTMIGLGVIWLGLVYQKRRERLSQALRSSLP
                     QWLRIALPALRN"
     gene            complement(538594..539241)
                     /locus_tag="PPUBIRD1_RS02300"
                     /old_locus_tag="PPUBIRD1_0464"
     CDS             complement(538594..539241)
                     /locus_tag="PPUBIRD1_RS02300"
                     /old_locus_tag="PPUBIRD1_0464"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017476331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
                     hydroxylase"
                     /protein_id="WP_011953317.1"
                     /translation="MATERHYSPLDRLLLQADTAMRTLLPFSGQPARPSPAIVQPDVD
                     LDEQQARHIAGLMRINHTGEVCAQALYQGQALTAKLPEVRKAMEHAAEEEVDHLAWCE
                     QRIRQLNSHPSVLNPLFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQL
                     PHEDEKSRAILEQMRIDEEQHAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI"
     gene            complement(539307..539645)
                     /locus_tag="PPUBIRD1_RS02305"
                     /old_locus_tag="PPUBIRD1_0465"
     CDS             complement(539307..539645)
                     /locus_tag="PPUBIRD1_RS02305"
                     /old_locus_tag="PPUBIRD1_0465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010467214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine triad nucleotide-binding protein"
                     /protein_id="WP_003255518.1"
                     /translation="MDDLFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIPKK
                     HIRTLNDLTEEDKALAGHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVL
                     GQRQMNWPPG"
     gene            complement(539709..540491)
                     /locus_tag="PPUBIRD1_RS02310"
                     /old_locus_tag="PPUBIRD1_0466"
     CDS             complement(539709..540491)
                     /locus_tag="PPUBIRD1_RS02310"
                     /old_locus_tag="PPUBIRD1_0466"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)-dependent oxidoreductase"
                     /protein_id="WP_014589463.1"
                     /translation="MTRYAMITGASSGLGLALAEALARRGRNLILVARQRETLEPVAI
                     ELTQRFGVEVLFRACDLSQPLRLSGFVLELEEGERRIDLLVNCAGLRTYGPFLAHEWA
                     DEQDLLEVNVLALSRLCHAIGNLMAVQGGGQILNVAGLAGVAPGPWMAAYAASKAYVL
                     SFSQALREELKRTGIKVSVLCPGPVRSARRRIARLDGKPRCLSPEEVALYTVRALDKN
                     LALIMPGRRNRWLAFAPRLLPRWLVRKLAGAIHRRYCPSGME"
     gene            complement(540559..541515)
                     /locus_tag="PPUBIRD1_RS02315"
                     /old_locus_tag="PPUBIRD1_0467"
     CDS             complement(540559..541515)
                     /locus_tag="PPUBIRD1_RS02315"
                     /old_locus_tag="PPUBIRD1_0467"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004574932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitronate monooxygenase"
                     /protein_id="WP_014589464.1"
                     /translation="MSLPASLEQRLRLPVVAAPMFLISNPQLVLACCASGVVGSFPAL
                     NQRDSAGFKAWLEEIEAGLAQLQAPAPYAVNLIVHPTNPRLQADLALCVEQRVPIVIT
                     SLGAVKEVVDAVHGYGGLVLHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFA
                     LAAEIRQFFDKTLLLAGCINHGHEILAAQLLGADLAYMGTRFIATTESQAQGTYKQML
                     LDAHAADIIHTPVVSGIPASFLRQSLEQAGYDMNALKGGQVQGKLKPIDDEAKAWKTV
                     WSAGQGVGAIHDLPSASALIERLHGEYRQALEHCQVLRARAL"
     gene            complement(541544..541969)
                     /locus_tag="PPUBIRD1_RS02320"
                     /old_locus_tag="PPUBIRD1_0468"
     CDS             complement(541544..541969)
                     /locus_tag="PPUBIRD1_RS02320"
                     /old_locus_tag="PPUBIRD1_0468"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005792007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopD family protein"
                     /protein_id="WP_014589465.1"
                     /translation="MLYLWIKALHIVSVVCWFAGLFYLPRLFVYHAQSQDSISQERFV
                     TMERKLYRGIMNPAMIATYIFGAWMLYLTPGWLSQGWLHAKLTLVILLTGYHHVCGAQ
                     RKRFANGTNTRSHVYYRWFNEVPVLILLAIVILVVVKPF"
     gene            542112..543146
                     /locus_tag="PPUBIRD1_RS02325"
                     /old_locus_tag="PPUBIRD1_0469"
     CDS             542112..543146
                     /locus_tag="PPUBIRD1_RS02325"
                     /old_locus_tag="PPUBIRD1_0469"
                     /EC_number="1.2.1.38"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017939810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_014589466.1"
                     /translation="MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVAD
                     MYPNLRGHYDGLAFSVPDSKALAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADF
                     RLQDAAEWGKWYGQPHGAPELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFL
                     PLLEAGLADPSRLIADCKSGVSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQG
                     LRLAAGKDIGLTFVPHLTPMIRGIHATLYANVVDTSVDLQALFEKRYADEPFVDVMPA
                     GSHPETRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDER
                     MGLAHAGLLP"
     gene            543293..543643
                     /locus_tag="PPUBIRD1_RS02330"
                     /old_locus_tag="PPUBIRD1_0470"
     CDS             543293..543643
                     /locus_tag="PPUBIRD1_RS02330"
                     /old_locus_tag="PPUBIRD1_0470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009408529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="WP_003255511.1"
                     /translation="MSVETFTPTGLEFTHGAAQKVKNLVNEEGNERLKLRVFVTGGGC
                     SGFQYGFTFDEDVAEDDTIVEREGVSLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNP
                     NAATTCGCGSSFSI"
     gene            complement(543703..544794)
                     /locus_tag="PPUBIRD1_RS02335"
                     /old_locus_tag="PPUBIRD1_0471"
     CDS             complement(543703..544794)
                     /locus_tag="PPUBIRD1_RS02335"
                     /old_locus_tag="PPUBIRD1_0471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="WP_014589467.1"
                     /translation="MALYLGVMSGTSLDGLDIALIEQGEQLELLATHYLPMPDDLRQE
                     LLVLCSSGPDEIARAALAENRWASLAGEGINQLLARQGLKAEAIRAIGSHGQTIRHEP
                     ARGFTVQIGNPALLAELTGISVVADFRRRDVAAGGQGAPLVPAFHETLFNHLGQRLAI
                     LNVGGFSNLSLIEQDKPVHGFDCGPGNVLLDAWIEREHGHAYDADGAWAASGVVQPRL
                     LSVLMADPFFAGSGPKSTGREVFNLPWLDRHLATLPAYRAQDVQATLLELTARSIIDS
                     LGKAQQGTEALLVCGGGARNGALMARLGQLLPAARVASTGAYGVDPDWVEAMAFAWLA
                     HCCLEGIAANRPSVTAAKGLRVLGAIYPA"
     gene            complement(544798..546219)
                     /locus_tag="PPUBIRD1_RS02340"
                     /old_locus_tag="PPUBIRD1_0472"
     CDS             complement(544798..546219)
                     /locus_tag="PPUBIRD1_RS02340"
                     /old_locus_tag="PPUBIRD1_0472"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_019436722.1"
                     /translation="MTNEPPKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKKT
                     TLNLELESPAEQLKDESRAAPLVQSESEQGSPFAQIEEATPETQKADQQAPAAEPVAE
                     AAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHGQVLQFEL
                     DKDGQLASLHSKVSNLETIQLTKTAKGYTFNREISKPVVRTAYAHGVIKSSLSASAQR
                     AGLSHSMTMSLARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKVVGTGNILSARFTNR
                     GKTYTAVRYTNKQGNTAYYTADGNSLRKAFIRTPVDFARISSRFSAGRKHPILNKIRA
                     HKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLYGHMQGFAKGIK
                     TGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKNERQRFL
                     QQSQPLIARMDQEKATMLAANKR"
     gene            546433..547632
                     /locus_tag="PPUBIRD1_RS02345"
                     /old_locus_tag="PPUBIRD1_0473"
     CDS             546433..547632
                     /locus_tag="PPUBIRD1_RS02345"
                     /old_locus_tag="PPUBIRD1_0473"
                     /EC_number="6.1.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004574941.1"
                     /note="Tyrosyl-tRNA synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_014589469.1"
                     /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTA
                     PDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLENAE
                     TYKQQVFKILDPAKTEVAFNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQ
                     PIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRSYGQEAQNIVTMPLL
                     EGLDGVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDTLMWRYFELLSFRSMEEIEQFRA
                     DVANGANPRDIKIKLAEEIVARFHGEEAAANAHRAAGNRMKEGELPEGLPEIEVAAAE
                     DLPIAAVLNRAGLVKNSAQARDLLNSGAVKVDGAVVDKDFMFVLGATHVCQAGKKSFG
                     RVTLKAE"
     gene            548206..549752
                     /locus_tag="PPUBIRD1_RS02350"
                     /old_locus_tag="PPUBIRD1_r0008"
     rRNA            548206..549752
                     /locus_tag="PPUBIRD1_RS02350"
                     /old_locus_tag="PPUBIRD1_r0008"
                     /product="16S ribosomal RNA"
     gene            550028..552941
                     /locus_tag="PPUBIRD1_RS02355"
                     /old_locus_tag="PPUBIRD1_r0009"
     rRNA            550028..552941
                     /locus_tag="PPUBIRD1_RS02355"
                     /old_locus_tag="PPUBIRD1_r0009"
                     /product="23S ribosomal RNA"
     gene            553058..553173
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS02360"
                     /old_locus_tag="PPUBIRD1_r0010"
     rRNA            553058..553173
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS02360"
                     /old_locus_tag="PPUBIRD1_r0010"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            553359..554318
                     /locus_tag="PPUBIRD1_RS02365"
                     /old_locus_tag="PPUBIRD1_0474"
     CDS             553359..554318
                     /locus_tag="PPUBIRD1_RS02365"
                     /old_locus_tag="PPUBIRD1_0474"
                     /EC_number="6.3.4.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255506.1"
                     /note="biotin--protein ligase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional biotin--[acetyl-CoA-carboxylase]
                     synthetase/biotin operon repressor"
                     /protein_id="WP_014589470.1"
                     /translation="MLKLLNLLKDGRFHSGEALGAALGVSRSAVWKQLQHLESELNLT
                     IHKVRGRGYQLAAPLALLETQAIAGFAVGEQWPVFIHETIDSTNAEGLRLASEGQAAP
                     FLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDGGMRQLEGLSLVVGLAVMRTLQ
                     AFGVKDVGLKWPNDVLVRGQKITGILLELVGDPADVCHVVLGIGINVNMQVNEQVDQQ
                     WTSMRREVGVVIDRNHLVALLSQQLQHELARHRRYGFAAFQEEWEQAHLWQGRNVSLV
                     AGNTRIDGVVLGVDGQGGLRLEVDGMEKSFSGGELSLRLRDDS"
     gene            554308..555057
                     /locus_tag="PPUBIRD1_RS02370"
                     /old_locus_tag="PPUBIRD1_0475"
     CDS             554308..555057
                     /locus_tag="PPUBIRD1_RS02370"
                     /old_locus_tag="PPUBIRD1_0475"
                     /EC_number="2.7.1.33"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019473699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="WP_014589471.1"
                     /translation="MILELDCGNSFIKWRVIHVADAVIEGGGIVDSDQALVAEVAALA
                     SVRLTGCRIVSVRSEEETDALCALIAQAFAVQAKVAHPVREMAGVRNGYDDYQRLGMD
                     RWLAALGAFHLAKGACLVIDLGTAAKADFVSADGEHLGGYICPGMPLMRSQLRTHTRR
                     IRYDDASAERALNSLSPGRSTVEAVERGCVLMLQGFAYTQLEQARVLWGEEFTVFLTG
                     GDAPLVRAALPQARVVPDLVFVGLAMACPLD"
     gene            555065..555490
                     /locus_tag="PPUBIRD1_RS02375"
                     /old_locus_tag="PPUBIRD1_0476"
     CDS             555065..555490
                     /locus_tag="PPUBIRD1_RS02375"
                     /old_locus_tag="PPUBIRD1_0476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589472.1"
                     /translation="MRWLFLLLLVLNVFYYVWHQQEAPLKVKEVAPLSLYKGNQQEIR
                     LLRETGVSAPPKRRDECLVVGGVKGQEQLDALRQRLLSLDIATLPVSGQLPGADGRWL
                     KVAPESERLLDQTVLLALSNDFKDLKHKIIFCQGIATDE"
     gene            555643..555726
                     /locus_tag="PPUBIRD1_RS02380"
                     /old_locus_tag="PPUBIRD1_t0001"
     tRNA            555643..555726
                     /locus_tag="PPUBIRD1_RS02380"
                     /old_locus_tag="PPUBIRD1_t0001"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555677..555679,aa:Tyr,seq:gta)
     gene            555751..555824
                     /locus_tag="PPUBIRD1_RS02385"
                     /old_locus_tag="PPUBIRD1_t0002"
     tRNA            555751..555824
                     /locus_tag="PPUBIRD1_RS02385"
                     /old_locus_tag="PPUBIRD1_t0002"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555783..555785,aa:Gly,seq:tcc)
     gene            555854..555929
                     /locus_tag="PPUBIRD1_RS02390"
                     /old_locus_tag="PPUBIRD1_t0003"
     tRNA            555854..555929
                     /locus_tag="PPUBIRD1_RS02390"
                     /old_locus_tag="PPUBIRD1_t0003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555887..555889,aa:Thr,seq:ggt)
     gene            556008..557201
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02395"
                     /old_locus_tag="PPUBIRD1_0477"
     CDS             556008..557201
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02395"
                     /old_locus_tag="PPUBIRD1_0477"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005791980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_003255489.1"
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAI
                     VEFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     gene            557256..557331
                     /locus_tag="PPUBIRD1_RS02400"
                     /old_locus_tag="PPUBIRD1_t0004"
     tRNA            557256..557331
                     /locus_tag="PPUBIRD1_RS02400"
                     /old_locus_tag="PPUBIRD1_t0004"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:557289..557291,aa:Trp,seq:cca)
     gene            557376..557744
                     /locus_tag="PPUBIRD1_RS02405"
                     /old_locus_tag="PPUBIRD1_0478"
     CDS             557376..557744
                     /locus_tag="PPUBIRD1_RS02405"
                     /old_locus_tag="PPUBIRD1_0478"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019693884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_014589473.1"
                     /translation="MTPKTEAQESRFDLFKWLAVVALVVVGVVGNQYYSSSPILYRVL
                     VLLVLAAVAGFVALQTAKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVM
                     ALLLWGLDSLLGWAVSLIVG"
     gene            557754..558287
                     /locus_tag="PPUBIRD1_RS02410"
                     /old_locus_tag="PPUBIRD1_0479"
     CDS             557754..558287
                     /locus_tag="PPUBIRD1_RS02410"
                     /old_locus_tag="PPUBIRD1_0479"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007984405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination
                     protein NusG"
                     /protein_id="WP_003255501.1"
                     /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEE
                     VVEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDK
                     EAEAILRRVADGSDKPKPKTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLI
                     FGRSTPVELEFSQVEKV"
     gene            558407..558838
                     /gene="rplK"
                     /locus_tag="PPUBIRD1_RS02415"
     CDS             558407..558838
                     /gene="rplK"
                     /locus_tag="PPUBIRD1_RS02415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008374187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_003255500.1"
                     /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNA
                     RTQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVT
                     RAQLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
     gene            558838..559533
                     /locus_tag="PPUBIRD1_RS02420"
                     /old_locus_tag="PPUBIRD1_0481"
     CDS             558838..559533
                     /locus_tag="PPUBIRD1_RS02420"
                     /old_locus_tag="PPUBIRD1_0481"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003232403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_003255499.1"
                     /translation="MAKLTKRQKAIAEKIEAGKAYNFEEAATLLASLPAAKFVESYDI
                     AVNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQGPAAEAALAAGADRVGMDDLAA
                     EMKGGDLNYDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VRYRTDKNGIIHTSVGKIGFEADKLKENVEALIADLKRIKPASSKGIYVKRVTLSTTM
                     GPGLVIDQSSLNV"
     gene            559731..560231
                     /locus_tag="PPUBIRD1_RS02425"
                     /old_locus_tag="PPUBIRD1_0482"
     CDS             559731..560231
                     /locus_tag="PPUBIRD1_RS02425"
                     /old_locus_tag="PPUBIRD1_0482"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019693882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_003255497.1"
                     /translation="MAIKLEDKKAIVAEVNEAAKVALSAVVADARGVTVSAMTGLRKE
                     AREAGVYVRVVRNTLLKRAVEGTEFSILNDAFKGPTLIAFSNEHPGAAARLFKEFAKG
                     QDKFEIKAAAFDGNFIAANQIDVLATLPTRDEAIARLMSVIQGATSKLARTLAAIRDQ
                     KEATAA"
     gene            560308..560673
                     /locus_tag="PPUBIRD1_RS02430"
                     /old_locus_tag="PPUBIRD1_0483"
     CDS             560308..560673
                     /locus_tag="PPUBIRD1_RS02430"
                     /old_locus_tag="PPUBIRD1_0483"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019342054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_003255496.1"
                     /translation="MSLTNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPAA
                     AAAVVEEQTEFNVVLVEAGDKKVNVIKAVRELTGLGLKEAKEKVDGAPQVVAEGVSKE
                     AAEDAKKKLEEAGAKVELK"
     gene            560894..564967
                     /gene="rpoB"
                     /locus_tag="PPUBIRD1_RS02435"
                     /old_locus_tag="PPUBIRD1_0484"
     CDS             560894..564967
                     /gene="rpoB"
                     /locus_tag="PPUBIRD1_RS02435"
                     /old_locus_tag="PPUBIRD1_0484"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003232409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_003255495.1"
                     /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGAS
                     KDHFRDVGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRV
                     KVRLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVF
                     FDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALG
                     YSTEEVLNTFYTTNVFHISGEKLSLELVPQRLRGEVAVMDIHDETGKVIVEQGRRITA
                     RHINQLEKAGVKQLDVPMEYVLGRTTAKAIVHPATGEILAECNTEMTTELLIKVAKAQ
                     VVRIETLYTNDIDCGPFISDTLKIDTTSNQLEALVEIYRMMRPGEPPTKDAAETLFNN
                     LFFSAERYDLSAVGRMKFNRRIGRTEIEGSGVLSKEDIVEVLKTLVDIRNGKGIVDDI
                     DHLGNRRVRCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVK
                     EFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPI
                     ETPEGPNIGLINSLAAYARTNQYGFLESPYRVVKEGVVSDDIVFLSAIEEADHVIAQA
                     SAAMNDKKQLIDELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDAN
                     RALMGSNMQRQAVPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVR
                     VADDEVETGEAGVDIYNLTKYTRSNQNTCINQRPLVSKGDKVQRGDIMADGPSTDMGE
                     LALGQNMRIAFMAWNGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEIT
                     ADIPNVGEAALNKLDEAGIVYVGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEK
                     ASDVKDTSLRVPTGTKGTVIDVQVFTRDGVERDSRALAIEKMQLDEIRKDLNEEFRIV
                     EGATFERLRSALNGQVVDGGAGLKKGTVITDEVLDGLEHGQWFKLRMAEDALNEQLEK
                     AQQYIVDRRRLLDDKFEDKKRKLQQGDDLAPGVLKIVKVYLAIRRRIQPGDKMAGRHG
                     NKGVVSVIMPVEDMPHDANGTPVDVVLNPLGVPSRMNVGQILETHLGLAAKGLGEKID
                     RMLEEQRKAAELRVFLTEVYNEIGGRQENLDEFTDEEILALANNLKKGVPMATPVFDG
                     AKEREIKAMLKLADLPESGQMVLFDGRTGNKFERPVTVGYMYMLKLNHLVDDKMHARS
                     TGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMY
                     KNIVDGDHRMEPGMPESFNVLIKEIRSLGIDIDLETE"
     gene            565032..569231
                     /gene="rpoC"
                     /locus_tag="PPUBIRD1_RS02440"
                     /old_locus_tag="PPUBIRD1_0485"
     CDS             565032..569231
                     /gene="rpoC"
                     /locus_tag="PPUBIRD1_RS02440"
                     /old_locus_tag="PPUBIRD1_0485"
                     /EC_number="2.7.7.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004666357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_014589475.1"
                     /translation="MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERM
                     AHIELASPVAHIWFLKSLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLL
                     NDEQYFEALEEFGDDFDARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLS
                     KRLKLMEAFQGSGNLPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLSAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLAT
                     TIKAAKKMVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTREAINAKGEGRVFADLQEVDRVFRAGEAALHAKIKVRINETVKERDGSVVKN
                     TRIVDTTVGRALLFQVVPAGLPYDVVNQPMKKKAISKLINQCYRVVGLKETVIFADQL
                     MYTGFAYSTISGVSIGVNDFVIPDEKARIIGNATDEVKEIESQYASGLVTQGEKYNKV
                     IDLWSKANDEVSKAMMANLSKEKVIDREGKEVEQESFNSMYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLSVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEIDCGTDQGLVMTPHIEGGDVVEPLGERVLGRVIARDVFKPGTEDV
                     IVPAGTLVDEQWVEFIELNSIDEVIVRSPINCETRYGICAKCYGRDLARGHQVNIGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKNGGMVRLHNLKQVERADGN
                     LVAVSRSGELAIADEFGRERERYKLPYGAVISVKEGEKVEAGAIVAKWDPHTHPIVTE
                     LKGTVTFVGMEENITIKRQTDELTGLTNIEVLDVKDRPAAGKEIRPAIKMVDAAGKDL
                     YLPGTDVPAQYFLPANALVGVADGAQIGVGDVIARIPQETSKTRDITGGLPRVADLFE
                     ARRPKEASILAEVSGTIAFGKETKGKRRLVITPTDGSDPYEELIPKWRHLNVFEGEQV
                     NRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLR
                     KVEISESGDSSFIKGDQMELTQVLVENERLASEDKFISKFTRVLLGITKASLSTESFI
                     SAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKRRRDADKP
                     LRVSASEVEAALTEALNSSGN"
     gene            569443..569814
                     /locus_tag="PPUBIRD1_RS02445"
                     /old_locus_tag="PPUBIRD1_0486"
     CDS             569443..569814
                     /locus_tag="PPUBIRD1_RS02445"
                     /old_locus_tag="PPUBIRD1_0486"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003093744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_003255492.1"
                     /translation="MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSL
                     DTSGVKGRNQGRSKYGTKRPK"
     gene            569921..570391
                     /locus_tag="PPUBIRD1_RS02450"
                     /old_locus_tag="PPUBIRD1_0487"
     CDS             569921..570391
                     /locus_tag="PPUBIRD1_RS02450"
                     /old_locus_tag="PPUBIRD1_0487"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003369032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_003246741.1"
                     /translation="MPRRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVY
                     GALDTVKARKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMR
                     WLVDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
     gene            570422..572569
                     /gene="fusA"
                     /locus_tag="PPUBIRD1_RS02455"
                     /old_locus_tag="PPUBIRD1_0488"
     CDS             570422..572569
                     /gene="fusA"
                     /locus_tag="PPUBIRD1_RS02455"
                     /old_locus_tag="PPUBIRD1_0488"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013789755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_003255490.1"
                     /translation="MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVH
                     DGAATTDWMVQEQERGITITSAAVTTFWKGSRGQYDNYRVNVIDTPGHVDFTIEVERS
                     LRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKN
                     RLGHTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMVELANEW
                     RNNMVEAAAEATEELMNKYLEEGELSVEEIKAGLRARTLASEIVPAVCGSSFKNKGVP
                     LVLDAVIDFLPAPTEIPAIKGIHPDLIDVPKDEVKPEQFDERHADDDEPFSALAFKIA
                     TDPFVGTLTFVRVYSGFLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIA
                     ALIGMKDVTTGDTLCNADKPIILERMDFPEPVISLSVEPKTKQDQEKMGIALGKLAQE
                     DPSFRVKTDEETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNV
                     EIEGKFVRQSGGRGQFGHCWVRFSEPDVDDKGNITEGLVFSNEVVGGVIPKEYIPAIQ
                     KGIEEQMKNGVVAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGGVV
                     LEPIMKVEVVTPEDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDV
                     RSMSQGRASYSMEFSKYAEAPSNIVEALVKKQG"
     gene            572597..573790
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02460"
                     /old_locus_tag="PPUBIRD1_0489"
     CDS             572597..573790
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02460"
                     /old_locus_tag="PPUBIRD1_0489"
                     /EC_number="3.6.5.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005791980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_010951775.1"
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAV
                     VEFDKIDSAPEEKARGITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDAYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     gene            573932..574243
                     /locus_tag="PPUBIRD1_RS02465"
                     /old_locus_tag="PPUBIRD1_0490"
     CDS             573932..574243
                     /locus_tag="PPUBIRD1_RS02465"
                     /old_locus_tag="PPUBIRD1_0490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009834626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_003186070.1"
                     /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPT
                     RKERFTVLVSPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL
                     G"
     gene            574324..574959
                     /locus_tag="PPUBIRD1_RS02470"
                     /old_locus_tag="PPUBIRD1_0491"
     CDS             574324..574959
                     /locus_tag="PPUBIRD1_RS02470"
                     /old_locus_tag="PPUBIRD1_0491"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003103877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_003255486.1"
                     /translation="MTIGVIGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKTEETD
                     GYRAVQVTVGERRASRVTAAQAGHFAKANVAAGRGVWEFRLEEGDFQAGDLIKAELFT
                     AGQLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKK
                     MSGHMGAERVTVQSLEVVRVDAERNLLLIKGAVPGATGGDVVVRPAVKARG"
     gene            574972..575574
                     /locus_tag="PPUBIRD1_RS02475"
                     /old_locus_tag="PPUBIRD1_0492"
     CDS             574972..575574
                     /locus_tag="PPUBIRD1_RS02475"
                     /old_locus_tag="PPUBIRD1_0492"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017135963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_003255485.1"
                     /translation="MQLNVNDAQAIEVSELTFGGEFNETLVHQAVVAYMAGGRQGTKQ
                     QKTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTFAARPQDHSQKLNKKMYRA
                     ALRSILAELVRSDRLVVVQDFAVEAPKTKDLLNKLNGMGLSDVLIVSDAVDQNLYLAA
                     RNLPHVDVRDVQGSDPVSLIAYEKVLITVSAVKKFEELLG"
     gene            575571..575870
                     /locus_tag="PPUBIRD1_RS02480"
                     /old_locus_tag="PPUBIRD1_0493"
     CDS             575571..575870
                     /locus_tag="PPUBIRD1_RS02480"
                     /old_locus_tag="PPUBIRD1_0493"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011169628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_003255484.1"
                     /translation="MNQERVFKVLLGPHVSEKATVLAEKKGQFVFKVATDATKLEIKK
                     AVEGLFNVKVENVSTVNVLGKTKRTARGLGKRNDWKKAIVSLQPGQDLDFSSSAE"
     gene            575885..576709
                     /locus_tag="PPUBIRD1_RS02485"
                     /old_locus_tag="PPUBIRD1_0494"
     CDS             575885..576709
                     /locus_tag="PPUBIRD1_RS02485"
                     /old_locus_tag="PPUBIRD1_0494"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_003255483.1"
                     /translation="MAIVKCKPTSPGRRFVVKVVNKELHKGAPHAPLIEKKSKSGGRN
                     NNGRITTRHVGGGHKQHYRLVDFRRNDKDGIPATVERIEYDPNRTAHIALLCYADGER
                     RYIIAPKGVSAGDQLIAGALAPIKAGNSLQLRNIPVGSTIHGIELKPGKGAQIARSAG
                     ASAQLIAREGVYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVR
                     PTVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRGNKRTDNMIVRRRK"
     gene            576726..577001
                     /locus_tag="PPUBIRD1_RS02490"
                     /old_locus_tag="PPUBIRD1_0495"
     CDS             576726..577001
                     /locus_tag="PPUBIRD1_RS02490"
                     /old_locus_tag="PPUBIRD1_0495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013789761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_003255482.1"
                     /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQM
                     VGLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHVADKKAKR"
     gene            577013..577345
                     /locus_tag="PPUBIRD1_RS02495"
     CDS             577013..577345
                     /locus_tag="PPUBIRD1_RS02495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003304070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_003103908.1"
                     /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAA
                     EIMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCH
                     ITVKVADK"
     gene            577359..578045
                     /locus_tag="PPUBIRD1_RS02500"
                     /old_locus_tag="PPUBIRD1_0497"
     CDS             577359..578045
                     /locus_tag="PPUBIRD1_RS02500"
                     /old_locus_tag="PPUBIRD1_0497"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003176422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_003255481.1"
                     /translation="MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQ
                     DKLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHIN
                     IEEIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQ
                     APAPRKKAAK"
     gene            578058..578471
                     /locus_tag="PPUBIRD1_RS02505"
                     /old_locus_tag="PPUBIRD1_0498"
     CDS             578058..578471
                     /locus_tag="PPUBIRD1_RS02505"
                     /old_locus_tag="PPUBIRD1_0498"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003448731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_003255479.1"
                     /translation="MLQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTA
                     RQIESARRALTRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGKV
                     LYEIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
     gene            578471..578662
                     /locus_tag="PPUBIRD1_RS02510"
                     /old_locus_tag="PPUBIRD1_0499"
     CDS             578471..578662
                     /locus_tag="PPUBIRD1_RS02510"
                     /old_locus_tag="PPUBIRD1_0499"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_002555481.1"
                     /translation="MKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLS
                     QVKRDIARVKTVLNQQAGK"
     gene            578665..578931
                     /locus_tag="PPUBIRD1_RS02515"
                     /old_locus_tag="PPUBIRD1_0500"
     CDS             578665..578931
                     /locus_tag="PPUBIRD1_RS02515"
                     /old_locus_tag="PPUBIRD1_0500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020290702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_003255478.1"
                     /translation="MAEAEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRS
                     TKLHAHDEANQCKIGDKVSIRETRPLAKTKSWALVEVLERAVEV"
     gene            578955..579323
                     /locus_tag="PPUBIRD1_RS02520"
                     /old_locus_tag="PPUBIRD1_0501"
     CDS             578955..579323
                     /locus_tag="PPUBIRD1_RS02520"
                     /old_locus_tag="PPUBIRD1_0501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004145357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_002555479.1"
                     /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVK
                     EAIPRGKVKKGQVMTAVVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPV
                     TRELRTEKFMKIVSLAPEVL"
     gene            579335..579649
                     /locus_tag="PPUBIRD1_RS02525"
                     /old_locus_tag="PPUBIRD1_0502"
     CDS             579335..579649
                     /locus_tag="PPUBIRD1_RS02525"
                     /old_locus_tag="PPUBIRD1_0502"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010486994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_003255476.1"
                     /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVIGGVNLVKRH
                     TKPNPMAGVQGGIVEKEAPLHASNVAIFNGETNKADRVGFKVEDGKKIRVFKSTQKAV
                     DA"
     gene            579670..580209
                     /locus_tag="PPUBIRD1_RS02530"
                     /old_locus_tag="PPUBIRD1_0503"
     CDS             579670..580209
                     /locus_tag="PPUBIRD1_RS02530"
                     /old_locus_tag="PPUBIRD1_0503"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007924186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_003255474.1"
                     /translation="MARLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAI
                     GDKKVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFLDR
                     LLAISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
                     RSDDEGRALLRAFKFPFRN"
     gene            580223..580528
                     /locus_tag="PPUBIRD1_RS02535"
                     /old_locus_tag="PPUBIRD1_0504"
     CDS             580223..580528
                     /locus_tag="PPUBIRD1_RS02535"
                     /old_locus_tag="PPUBIRD1_0504"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003400428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_003255472.1"
                     /translation="MAKKSMKNRELKRQLTVAKFAKKRAELKATIVNLNASPEERFAA
                     VVALQKQPRDASASRLRNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW"
     gene            580737..581129
                     /gene="rpsH"
                     /locus_tag="PPUBIRD1_RS02540"
                     /old_locus_tag="PPUBIRD1_0505"
     CDS             580737..581129
                     /gene="rpsH"
                     /locus_tag="PPUBIRD1_RS02540"
                     /old_locus_tag="PPUBIRD1_0505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002555475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_003255471.1"
                     /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSTLKVAVAKVLKDEG
                     YIAGYQVTGEAKPSLSIELKYFEGRPVIEELKRSSRPGLRQYKAVTDLPKVRGGLGVS
                     IVSTNKGVMTDRAARAAGVGGEVLCTVF"
     gene            581142..581675
                     /locus_tag="PPUBIRD1_RS02545"
                     /old_locus_tag="PPUBIRD1_0506"
     CDS             581142..581675
                     /locus_tag="PPUBIRD1_RS02545"
                     /old_locus_tag="PPUBIRD1_0506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003293037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_003255469.1"
                     /translation="MSRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVT
                     EESGELRFVARNGDQQARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTV
                     LNLALGFSHPVDYELPAGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGK
                     GVRYADEVVRRKEAKKK"
     gene            581686..582036
                     /locus_tag="PPUBIRD1_RS02550"
                     /old_locus_tag="PPUBIRD1_0507"
     CDS             581686..582036
                     /locus_tag="PPUBIRD1_RS02550"
                     /old_locus_tag="PPUBIRD1_0507"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003463284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_003255467.1"
                     /translation="MTDKKVIRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISAD
                     GSKVLASASTLDKDLRDGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRV
                     KALADAAREGGLEF"
     gene            582040..582540
                     /locus_tag="PPUBIRD1_RS02555"
                     /old_locus_tag="PPUBIRD1_0508"
     CDS             582040..582540
                     /locus_tag="PPUBIRD1_RS02555"
                     /old_locus_tag="PPUBIRD1_0508"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003176409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_003255465.1"
                     /translation="MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGK
                     GRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASE
                     GTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGK
                     SVEEIF"
     gene            582543..582719
                     /locus_tag="PPUBIRD1_RS02560"
                     /old_locus_tag="PPUBIRD1_0509"
     CDS             582543..582719
                     /locus_tag="PPUBIRD1_RS02560"
                     /old_locus_tag="PPUBIRD1_0509"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016490545.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_003255463.1"
                     /translation="MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENR
                     GMINKAYYMLKVEG"
     gene            582723..583157
                     /locus_tag="PPUBIRD1_RS02565"
                     /old_locus_tag="PPUBIRD1_0510"
     CDS             582723..583157
                     /locus_tag="PPUBIRD1_RS02565"
                     /old_locus_tag="PPUBIRD1_0510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_003255461.1"
                     /translation="MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGG
                     SIAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRLSELAKVEGDVISVQSLKDANVIN
                     QHIQRVKIMLSGEVTRAVTIKGIAATKGARAAIEAAGGKFEE"
     gene            583158..584489
                     /locus_tag="PPUBIRD1_RS02570"
                     /old_locus_tag="PPUBIRD1_0511"
     CDS             583158..584489
                     /locus_tag="PPUBIRD1_RS02570"
                     /old_locus_tag="PPUBIRD1_0511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003304058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_003257108.1"
                     /translation="MAKQGALSSLGKGGMSELWARLRFLFMAIIVYRIGAHIPVPGIN
                     PDRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLE
                     QLKKEGEAGRRKISQYTRYGTVILALVQAIGMSIGLANQGVAFSVGLGFHVVAVSTFV
                     AGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARTGDINIFALVAI
                     GLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFAS
                     SILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNP
                     KDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMMAVCLLPQFLVVAANV
                     PFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGGSGLLR"
     gene            584518..584634
                     /locus_tag="PPUBIRD1_RS02575"
                     /old_locus_tag="PPUBIRD1_0512"
     CDS             584518..584634
                     /locus_tag="PPUBIRD1_RS02575"
                     /old_locus_tag="PPUBIRD1_0512"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020322760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_002555468.1"
                     /translation="MKVRASVKKLCRNCKIIRREGVVRVICSAEPRHKQRQG"
     gene            584766..585122
                     /locus_tag="PPUBIRD1_RS02580"
                     /old_locus_tag="PPUBIRD1_0513"
     CDS             584766..585122
                     /locus_tag="PPUBIRD1_RS02580"
                     /old_locus_tag="PPUBIRD1_0513"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017939147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_003255457.1"
                     /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICADAGVNPAAK
                     IKDLSDEQIETLRGEVAKFTTEGDLRRDINMKIKRLMDLGCYRGLRHRKGLPVRGQRT
                     KTNARTRKGPRKPIRK"
     gene            585141..585530
                     /locus_tag="PPUBIRD1_RS02585"
                     /old_locus_tag="PPUBIRD1_0514"
     CDS             585141..585530
                     /locus_tag="PPUBIRD1_RS02585"
                     /old_locus_tag="PPUBIRD1_0514"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017939146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_003255454.1"
                     /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNS
                     CGYKIASITDVTPIPHNGCRPPKKRRV"
     gene            585546..586166
                     /locus_tag="PPUBIRD1_RS02590"
                     /old_locus_tag="PPUBIRD1_0515"
     CDS             585546..586166
                     /locus_tag="PPUBIRD1_RS02590"
                     /old_locus_tag="PPUBIRD1_0515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005781973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_003255453.1"
                     /translation="MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEAAPGIHGQR
                     RGRQSDYGTQLREKQKVRRIYGVLERQFRGYYQAAASKKGATGENLLQLLECRLDNVV
                     YRMGFGSTRSESRQLVSHKAISVNGKTVNIPSYQVRPGDVVAVREKSLGQLRIVQALE
                     LCAQRGRVEWVDVDAAKKSGVFKNVPARSDLSADINENLIVELYSK"
     gene            586189..587190
                     /locus_tag="PPUBIRD1_RS02595"
                     /old_locus_tag="PPUBIRD1_0516"
     CDS             586189..587190
                     /locus_tag="PPUBIRD1_RS02595"
                     /old_locus_tag="PPUBIRD1_0516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017901544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_003255452.1"
                     /translation="MQISVNEFLTPRHIDVQVVSPTRAKITLEPLERGFGHTLGNALR
                     RILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTL
                     SKKGSGVVTAADIQLDHDVEIVNPDHVIANLASNGALNMKLTVARGRGYEPADSRQTD
                     EDESRSIGRLQLDASFSPVRRIAYVVENARVEQRTNLDKLVIDLETNGTLDPEEAIRR
                     AATILQQQLAAFVDLKGDSEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYY
                     IGDLIQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
     gene            587233..587619
                     /locus_tag="PPUBIRD1_RS02600"
                     /old_locus_tag="PPUBIRD1_0517"
     CDS             587233..587619
                     /locus_tag="PPUBIRD1_RS02600"
                     /old_locus_tag="PPUBIRD1_0517"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017278734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_003255451.1"
                     /translation="MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEHELIKTTLPKAKEL
                     RRVAEPLITLAKEDSVANRRLAFDRTRSKSAVGKLFNDLGKRYATRQGGYLRILKCGF
                     RAGDNAPMAYVELVDRPVGGAVEAAE"
     gene            587792..589231
                     /locus_tag="PPUBIRD1_RS02605"
                     /old_locus_tag="PPUBIRD1_0518"
     CDS             587792..589231
                     /locus_tag="PPUBIRD1_RS02605"
                     /old_locus_tag="PPUBIRD1_0518"
                     /EC_number="1.11.1.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589477.1"
                     /note="Catalase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_014589477.1"
                     /translation="MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNR
                     ENIPERRVHAKGSGAYGTFTVTHDITGYTSAKLFEEVGKQTETFLRFSTVGGERGSAD
                     TERDPRGFAVKFYTEEGNWDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMM
                     WDFWSHSPEALHQVTILFSDRGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQ
                     GIKNLTPADAARLAGTDPDYAQRDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFD
                     VTKTWSQKDYPLIEVGVLELNRNPLNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVF
                     AYADAHRYRVGTNHQQLPVNAPRCPVNSYQRDGSMATGSYGSAPNYEPNSYSDAPKQS
                     PRHVEPALAMNGSADRYDHREDTDYFSHAGALFRLMNDEQKALLISNIAGTMAGVSED
                     VIQRQLQYFFKADPAYGEGIAKALGINLA"
     gene            589395..589859
                     /gene="bfr"
                     /locus_tag="PPUBIRD1_RS02610"
                     /old_locus_tag="PPUBIRD1_0519"
     CDS             589395..589859
                     /gene="bfr"
                     /locus_tag="PPUBIRD1_RS02610"
                     /old_locus_tag="PPUBIRD1_0519"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016715322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_003255449.1"
                     /translation="MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLSKLYERI
                     NHEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCK
                     GIELCELHKDYVSRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM"
     gene            complement(589932..592814)
                     /locus_tag="PPUBIRD1_RS02615"
                     /old_locus_tag="PPUBIRD1_0520"
     CDS             complement(589932..592814)
                     /locus_tag="PPUBIRD1_RS02615"
                     /old_locus_tag="PPUBIRD1_0520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit A"
                     /protein_id="WP_085983380.1"
                     /translation="MARRILPCLCPPSEAAVDKILIRGARTHNLKNIDLTLPRDKLIV
                     ITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIE
                     QKSTSHNPRSTVGTITEIYDYLRLLYARVGTPRCPDHDIPLEAQTISQMVDLVLERPE
                     GSKLMLLAPVVRERKGEHLAVFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDV
                     VVDRFKVRADLQQRLAESFETALKLADGIALVAPMDDEQGEETIFSARFACPVCGHAI
                     SELEPKLFSFNNPAGACPTCDGLGVKQFFDTKRLVNTELTLAEGAIRGWDRRNVYYFQ
                     MLGSLAAHYGFSLEEPFGELSAEHQKVILQGSGKQSVDFKYLNDRGDIVKRSHPFEGI
                     VPNLERRYRETESATVREELAKFLGTQPCPDCRGTRLRREARHVWVGEKTLPAVTNMP
                     IGEASNYFGQLTLTGRRGEIAAKILKEICERLQFLVNVGLDYLTLDRSADTLSGGEAQ
                     RIRLASQIGAGLVGVMYILDEPSIGLHQRDNDRLLATLNHLRDLGNTVIVVEHDEDAI
                     RLADYVVDIGPGAGVHGGQIVAEGSPQEVMDHPDSLTGKYLSGRKKIVVPAKRTPRNK
                     KLQLKLKGARGNNLQNVDLEVPIGLLTCVTGVSGSGKSTLINNTLYPLAATALNGASS
                     LEAAPHSSMDGLQHLDKVVDIDQSPIGRTPRSNPATYTGIFTPIRELFSGVPESRSRG
                     YGPGRFSFNVKGGRCEACQGDGLIKVEMHFLPDIYVPCDVCKSKRYNRETLEIKYKGK
                     NIHEVLEMTIEDAREFFDAVPALARKLQTLMDVGLSYIKLGQSATTLSGGEAQRVKLS
                     RELSKRDTGKTLYILDEPTTGLHFADIQQLLDVLHRLRDHGNTVVVIEHNLDVIKTAD
                     WLVDLGPEGGSKGGQIIACGTPEELSEMKQSYTGHYLKPLLERDRA"
     gene            592896..594290
                     /locus_tag="PPUBIRD1_RS02620"
                     /old_locus_tag="PPUBIRD1_0521"
     CDS             592896..594290
                     /locus_tag="PPUBIRD1_RS02620"
                     /old_locus_tag="PPUBIRD1_0521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589479.1"
                     /translation="MHDTHNERMSSGETRAAGGLALVFAFRMLGMFMVLPVLATYGMD
                     LAGATPALIGLAIGAYGLTQAVLQIPFGMISDRIGRRPVIYLGLVIFALGSVLAAQAD
                     SIWGVIAGRILQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPL
                     LTSAFGLSGLFLVTAGLALVGMLLIAFVVPNTHSILQHRESGVARQAIGPTLRHPDLL
                     RLDVSIFILHAVLMASFVALPLAFVERGGLPKEQHWWVYLTALFISFFAMVPFIIYGE
                     KKRKMKRVLAGAVSVLLLTEIYFWEWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKV
                     SPAGGKGTAMGVYSTSQFLGAALGGILGGWLFQHGGLNTVFLGSAVLCAIWLIVALRM
                     NEPPYVTSLRMPLAPEAVREAGLTERLMAVPGVTDAVVVEEEAAIYIKLDTKILDRAT
                     LERLVNPASSACEA"
     gene            594300..594845
                     /locus_tag="PPUBIRD1_RS02625"
                     /old_locus_tag="PPUBIRD1_0522"
     CDS             594300..594845
                     /locus_tag="PPUBIRD1_RS02625"
                     /old_locus_tag="PPUBIRD1_0522"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016779190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_003255446.1"
                     /translation="MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQ
                     SGQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIEGKLQTREWEKDGIKRYTTEIIV
                     DINGTMQLLGGRPQGQQQGGDPYNQGGGNYGGGQQQQYNQAPPRQQAQRPQQAPQRPA
                     PQQPAPQPAADFDSFDDDIPF"
     gene            complement(594934..596316)
                     /locus_tag="PPUBIRD1_RS02630"
                     /old_locus_tag="PPUBIRD1_0523"
     CDS             complement(594934..596316)
                     /locus_tag="PPUBIRD1_RS02630"
                     /old_locus_tag="PPUBIRD1_0523"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PLP-dependent aminotransferase family protein"
                     /protein_id="WP_014589480.1"
                     /translation="MWIPQYSHQTQPVYLMIADALEQDIESGRLAEGDRLPTLKDLAE
                     ALNVTPGTVGRAYDEAAKRGLVAGEVGRGTFVRQLRQPLPAPSVPTSVAGESNQIDLS
                     IIKPNDAHMSEWLGTAISELASSSNLGQVLDYVTEGGHTSHKQAGATWIQRWLPDARW
                     QQVVLTAGAQHGLLVAISSLSKSDDVVLCESLCYPGIISLAHSLGRRLRGVAMDEHGL
                     IPEALRAACLEHRPSLLVCVTTHQNPTNSIMPPARRQAIAEIAREFDLFIVDDDIYGF
                     LEPSPDYKPLAAYAPERSVYLTSLSKSVLPALRIGYLYAPPQTLSRLSSMVRSSVWMP
                     SPLMAQLASNLINSGKADQLVRMQQQEAAARQHMAREILGQYKIRSQPHSFHIWLELP
                     EPWTSDEFANLARDNGVTVVSGSQFLPERSHATSGVRIALMAPSRQALGFALTKLASL
                     LDSPEPRLFY"
     gene            596517..597302
                     /locus_tag="PPUBIRD1_RS02635"
                     /old_locus_tag="PPUBIRD1_0525"
     CDS             596517..597302
                     /locus_tag="PPUBIRD1_RS02635"
                     /old_locus_tag="PPUBIRD1_0525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589481.1"
                     /translation="MEMLGSYWAEHWLLAVLILGAIAFVAGFVDSIAGGGGLFLVPGF
                     LLVGMPPQVALGQEKLVSTLGTLAAIRNFLANSRMVWQVALVGVPFSLLGAYLGAHLI
                     VSISQETVGKIILALIPLGILIFLTPKDRPVEERKLSSRMLYTVVPLTCLAIGFYDGF
                     FGPGTGSMFIIAFHYLLRMDLVSSSANSKTFNFASNIGALVAFVSAGKVVYLLALPLV
                     AYNILGNHLGSSLALRKGNDVVRKALVFSMLCLFTSLGVKYLT"
     gene            597324..598085
                     /locus_tag="PPUBIRD1_RS02640"
                     /old_locus_tag="PPUBIRD1_0526"
     CDS             597324..598085
                     /locus_tag="PPUBIRD1_RS02640"
                     /old_locus_tag="PPUBIRD1_0526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576896.1"
                     /note="NADP(+)-dependent; catalyzes the formation of
                     3-hydroxypropionate from the toxic malonic semialdehyde,
                     catalyzes the formation of 2-aminomalonate-semialdehyde
                     from L-serine; can also use 3-hydroxybutyrate,
                     3-hydroxy-isobutyrate, D-threonine,
                     L-allo-threonine,D-serine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent 3-hydroxy acid dehydrogenase"
                     /protein_id="WP_014589482.1"
                     /translation="MKTAFVTGASSGFGRAICCTLIGKGYRVIGGARRMDKLKALEAE
                     LGVNFIPLALDVTDSVSLEKAVEQMREASLQIDLLVNNAGLALGVDRAQTSSAANWQQ
                     MIDTNITGLAMVTHKILPQMVAADSGMIINIGSIAGTYPYPGGNVYGASKAFVRQFSL
                     NLRADLAGTRVRVSNIEPGLCSGTDFSVVRLNGDMDAVQALYRDVEALLPEDIAATVA
                     WVAEQPAHVNINTIEIMPVAQSSAALNVVRNLPRA"
     gene            598233..598823
                     /locus_tag="PPUBIRD1_RS02645"
                     /old_locus_tag="PPUBIRD1_0527"
     CDS             598233..598823
                     /locus_tag="PPUBIRD1_RS02645"
                     /old_locus_tag="PPUBIRD1_0527"
                     /EC_number="1.2.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007970083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589483.1"
                     /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHT
                     KETRNTCPYCSVGCGLILYSQGDAGKNVKQNIIHIEGDADHPVNRGTLCPKGAGLLDF
                     IHSPSRLQYPEVRKPGSKEWVRVSWDEALDRVADLMKQDRDANFIEKNAQGQTVNRWL
                     STGFLAASAASSEAGYLTHKVIRATGMLGFDNQARV"
     gene            598836..601301
                     /gene="fdnG"
                     /locus_tag="PPUBIRD1_RS02650"
                     /old_locus_tag="PPUBIRD1_0528"
     CDS             598836..601301
                     /gene="fdnG"
                     /locus_tag="PPUBIRD1_RS02650"
                     /old_locus_tag="PPUBIRD1_0528"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-N subunit alpha"
                     /protein_id="WP_023390164.1"
                     /translation="MASLAPTYGRGAMTNHWSDIANANLVLVMGGNAAEAHPCGFKWV
                     TEAKAHNKARLIVVDPRFTRTASVADYYAPIRTGTDIAFMGGLINYLLSNDKIQHEYV
                     RNYTDVSFIVKENYGFEDGLFSGYDEAKRVYADKSGWGYELGEDGYAKVDPTLQHPRC
                     VFQLMKQHYSRYTPELASMTCGMPQDAMLKVWEEIASCSVPGKTMTILYALGWTQHSI
                     GAQIIRSAAMVQLLLGNVGMPGGGVNALRGHSNIQGLTDLGLLSNSLPGYLTLAGDAE
                     QDYAAYIDKRASKPLRPGQLSYWQNYGKFHVSLMKAWYGANATAENNWGYDWLPKLDV
                     PAYDVLRMFEMMGQGKVNGYMCQGFNPIAALPDKNRVTAALGKLKWLVVMDPLATETS
                     EFWRNAGPFNDVDTASIQTEVIRLPTTCFAEEDGSLVNSSRWLQWHWKGADGPGETRT
                     DVQIMSELFLRLRQRYQAEGGAYPDAIMNISWPYKIPEEPSPEELAKEMNGWAVADVT
                     DPTGAVIKAGQQLAGFGQLKDDGSTASGCWIFAGSWTEQGNQMARRDNSDPYGMHQVQ
                     NWAWAWPANRRILYNRASSDPQGKPWDPEKKRLVWWNGKAWTGTDVPDFKVDSPPEAG
                     MNPFIMNPEGVARFFAIDKMAEGPFPEHYEPFETPIGINPLHPQNKKATSNPAGRIFD
                     SVWDTLGTHDEFPYAATTYRLTEHFHFWSKHCRLNAIAQPEQFVEIGEVLANEKGIKA
                     GDRVRVSSKRGHIDAVAVVTKRIRPLQVNNQTVHQIGIPLHWGFTGATRHGYLTNTLV
                     PFLGDGNTQTPESKSFLVKVEKL"
     gene            601301..602251
                     /gene="fdxH"
                     /locus_tag="PPUBIRD1_RS02655"
                     /old_locus_tag="PPUBIRD1_0529"
     CDS             601301..602251
                     /gene="fdxH"
                     /locus_tag="PPUBIRD1_RS02655"
                     /old_locus_tag="PPUBIRD1_0529"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017906824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit beta"
                     /protein_id="WP_003255436.1"
                     /translation="MASQDIIARSATTTVPPSVRQQEEVAKLIDTTKCIGCKACQVAC
                     SEWNELRDEVGHNHGTYDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADP
                     GCLKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCS
                     DRVSVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGT
                     HVMYVLHHADTPKLYAGLPDQPVISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRIG
                     PQRVEEDEHPTPPDESVHQVDPSVHVYDPKQPGGQGEQRP"
     gene            602248..602904
                     /locus_tag="PPUBIRD1_RS02660"
                     /old_locus_tag="PPUBIRD1_0530"
     CDS             602248..602904
                     /locus_tag="PPUBIRD1_RS02660"
                     /old_locus_tag="PPUBIRD1_0530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit gamma"
                     /protein_id="WP_011953329.1"
                     /translation="MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLS
                     NLFGGGPWTRILHPFIGVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEG
                     VPPIGKYNAGQKLLFWTLLVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAF
                     VLILSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG
                     "
     gene            602909..603835
                     /gene="fdhE"
                     /locus_tag="PPUBIRD1_RS02665"
                     /old_locus_tag="PPUBIRD1_0531"
     CDS             602909..603835
                     /gene="fdhE"
                     /locus_tag="PPUBIRD1_RS02665"
                     /old_locus_tag="PPUBIRD1_0531"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="WP_014589485.1"
                     /translation="MSTLLEPGQIEASAVTPPFLHLPAANLFELRAARLEYLAEGNAL
                     GDYLRLIARLCRIQQQLVDNPPSGLPVAEERQRLCMDHGLPPLAADSLVREGPWLVWL
                     QALLEHLSGERSGPLGEALQVLRGSDDNQRKGWGIALLAGQYNGVPAALVPFLGAALQ
                     AAWSSWLLALPAHQLEPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWH
                     VVRVKCVYCESSKDLRYTSLEDDRHAPGKAPLRAECCPGCDSYLKQNYLENDAAAEPL
                     ADDLATLALDIRLDGEGFHRLAPNLMLAPGSG"
     gene            603975..605402
                     /locus_tag="PPUBIRD1_RS02670"
                     /old_locus_tag="PPUBIRD1_0532"
     CDS             603975..605402
                     /locus_tag="PPUBIRD1_RS02670"
                     /old_locus_tag="PPUBIRD1_0532"
                     /EC_number="2.9.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951785.1"
                     /note="L-seryl-tRNA(Sec) selenium transferase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-selenocysteinyl-tRNA(Sec) synthase"
                     /protein_id="WP_014589486.1"
                     /translation="MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLL
                     DDLREPARNGELGSAELAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALL
                     PDEAIEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVL
                     LALNSLGARKEGIISRGELIEIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIG
                     PRTGLLMRVHCSNYSIQGFTTQVPTAKLARIAHQHELPLLEDLGSGSLLDLTRWGLPA
                     EPTVRQALADGADIVTFSGDKLLGGPQAGIIVGHKDLITRIKKNPLKRALRVDKIILA
                     ALEAVLALYRNPDRLAERLPSLRLLTRSQAEIQAQAERLAPELQARLGEQWAIRVEPA
                     LGMIGSGSQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRDLPVPVLGRIDDDALW
                     LDLRQLDDEAQWLAQLPALQLGPVQ"
     gene            605399..607321
                     /gene="selB"
                     /locus_tag="PPUBIRD1_RS02675"
                     /old_locus_tag="PPUBIRD1_0533"
     CDS             605399..607321
                     /gene="selB"
                     /locus_tag="PPUBIRD1_RS02675"
                     /old_locus_tag="PPUBIRD1_0533"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016393408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine-specific translation elongation
                     factor"
                     /protein_id="WP_014589487.1"
                     /translation="MIVGTAGHIDHGKTALLLALTGQAGDQRQEERARGMTIDLGYRY
                     VALSEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMPQTREHLAIIEL
                     LGIPQALVAISKCDRVEPSRLAEVQMQVSELLAPGPYAGARQFPLSSISGEGVEALRQ
                     ALLEAEAGTRQRSVHGGFRLAVDRAFAVTGAGVVVTGTALAGRVSAGDTLLLGKAGKV
                     VRVRGLHAQNQAALVAEAGQRVALNIAAERLAVEQVHRGDWLVPEWLHAPSVRVDIEL
                     NLLPDEKRAFEHFSAVHVHLGTQDVTARVALLEGESLAAGQRMFAQLLLNAPLQAVHG
                     DRLVLRDQRAQRTLGGGKVLDPFAPSRQRRSDTRLQQLQVLRDAADLEQALPALLASA
                     PGGISPQRLERQFNRLRETWQLPDDVRVVATRQGQLLFANAQWQALKQQVLEQLARFH
                     EQEPDQLGPDRDRLRRFVALPLERPAFVSLLDELLDDSAIASSGPWLHLPDHKVQLSE
                     ADSALWARLQPKLIAGQFDPPWVRALASEENRAEADVRLLLRKLARLGLVHQVVRDLF
                     YPEATLQRMAALMLGQASETTIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQ
                     RHIRADSALAQQHARH"
     gene            607328..607423
                     /locus_tag="PPUBIRD1_RS02680"
     tRNA            607328..607423
                     /locus_tag="PPUBIRD1_RS02680"
                     /product="tRNA-Sec"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:607362..607364,aa:Sec,seq:tca)
     gene            complement(607515..608513)
                     /locus_tag="PPUBIRD1_RS02685"
                     /old_locus_tag="PPUBIRD1_0534"
     CDS             complement(607515..608513)
                     /locus_tag="PPUBIRD1_RS02685"
                     /old_locus_tag="PPUBIRD1_0534"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase 1"
                     /protein_id="WP_080557756.1"
                     /translation="MLSMRAVKNLLVLYTGGTIGMLETPEGLAPAGGFDARMREHFAQ
                     MANAPQVQWTLHELNPLLDSANMQQHNWLAMRDAIVAAVDVAGHDGVLVLHGTDSMAY
                     SAAALSFLLLGLPAPVVLTGSMLPAGAPDSDAWDNLCGALRQFEHGLEDGVQLYFHGQ
                     LLHGCRASKLRSEAFDAFAELPRHRDAERADTIPAELGYKQPRKPVNLAVVPVFPGLQ
                     AGHLQALIDSGVQGLLLECYGSGTGPSDDQALLNVLSTARQRGVMLAAISQCPEGSVV
                     FDTYAAGNRLRGAGLVSGGGMTREAALGKMMALLGAGLDADAADRWFVLDLCGERA"
     gene            complement(608577..610019)
                     /locus_tag="PPUBIRD1_RS02690"
                     /old_locus_tag="PPUBIRD1_0535"
     CDS             complement(608577..610019)
                     /locus_tag="PPUBIRD1_RS02690"
                     /old_locus_tag="PPUBIRD1_0535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine:cation symporter family protein"
                     /protein_id="WP_014589489.1"
                     /translation="MLEVINDFLSGKLLIVLIVGLGSYFTIRSRFVQFRHFTHMFSVF
                     KESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSS
                     SFFECTLAQVYKRADGDGLYRGGPAYYIQHGLKRKSMAIVFSILLLVTYGFAFIGLQS
                     YTVTHSLQNAFAFDPSHTGIVLAVLLAITFIGGIKRIAAVSDLLVPVKTLAYIGVTLY
                     VIGTQIEHVPAMLETIFKSAFGLDPAFAGLLGSAIVMGVKRGVFANEAGLGSAPNVAA
                     VAAVKHPGAQGVVQAFSVFLDTFLICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAV
                     VGDWGRVFVSVALSLFVFTCILYNYYLGENSLQFLSRNRVVLMVFRGLVLALVVWGSM
                     QDLSTVFAFADITMTCLAFVNLVALALLFKVGLRVMRDYDEQRKAGVKQPVFDSSKFA
                     DLDLDRNAWPANPQVETATDKAVGQVQTQR"
     gene            610198..611007
                     /locus_tag="PPUBIRD1_RS02695"
                     /old_locus_tag="PPUBIRD1_0537"
     CDS             610198..611007
                     /locus_tag="PPUBIRD1_RS02695"
                     /old_locus_tag="PPUBIRD1_0537"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015477372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589490.1"
                     /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPT
                     AFNLKRIGDFFGVEDYELNLPAEQFARLIGARVSPQAQQPSDPISELFRPLHEHGGNL
                     SRYCGYYFEYSNCMSVPGTILVSLVHLWEERGRFLFERQERQERSSATDQHAEVRCRY
                     LGAAFQLQDRMFLIDYESLTFNEMSQTILIPSFKSRITRLNGLKAGVSSGDRRNPACT
                     RVVWEYLGEEINRINAYRQVKLYRPDDPRIDDDVRERLSVAPLRNGLFEIE"
     gene            complement(611019..611864)
                     /locus_tag="PPUBIRD1_RS02700"
                     /old_locus_tag="PPUBIRD1_0538"
     CDS             complement(611019..611864)
                     /locus_tag="PPUBIRD1_RS02700"
                     /old_locus_tag="PPUBIRD1_0538"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_014589491.1"
                     /translation="MHIQKASPQRVKWQFDEPAPGKELFINEVFGNYQQQARLLVPDI
                     ERAAPAFVLGGARSDFTRLNPLLYRLQAAGIGSLTGNLSGHSLASEPGAMAPSLATNL
                     DEAQRFHAHIAPQCRTLIGHSLGAAITLKLAAQLPQVDSIVLICPAVYPDHAHQAPFG
                     PAFTAAINKPFGFLESDSYTFLNQFRGRVLMVIGEYDGLNSQRFGKGPGTSAGNLWLA
                     GTERYSPIPEEVNLALMRAVPASRLQCLFLTDCDHGIAAHLRSTPAIADQVADTVATF
                     ILDNA"
     gene            complement(611873..612664)
                     /locus_tag="PPUBIRD1_RS02705"
                     /old_locus_tag="PPUBIRD1_0539"
     CDS             complement(611873..612664)
                     /locus_tag="PPUBIRD1_RS02705"
                     /old_locus_tag="PPUBIRD1_0539"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589492.1"
                     /translation="MIEIDLTFVLLLALVALMAGFFDAIAGGGGLITLPVLFIAGVEP
                     LAAIATNKFQAASATVSATCAFARKGMIDWRRGSPMAVMAFIGGALGALSITYVPKSV
                     LQACVPPLLILIAAYFAFSPKPNEQARKAKVSTSLFCVTAAPIIGFYDGIFGPGVGSF
                     FMLACVVLLGQHLIQAVCTSKLLNAACNLGALSVFSLSGAIIWPLALAMALAAFMGAQ
                     LGARCAVRFGSRLIKPLLVSVCCIMALKLLLDTGNPLGEWLNQFF"
     gene            complement(612682..613722)
                     /locus_tag="PPUBIRD1_RS02710"
                     /old_locus_tag="PPUBIRD1_0540"
     CDS             complement(612682..613722)
                     /locus_tag="PPUBIRD1_RS02710"
                     /old_locus_tag="PPUBIRD1_0540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589493.1"
                     /translation="MPHSEAAYLDFYPEQSQAITFASQTLADLGGPEAKGVALQARIF
                     ADQLEKALSEEQRALLLRFSEGHLSALMYRQMHCANEPIPEYLPDITAPAQSPRCQYL
                     ASRNQLLLELVRHRSFAFDIDNDGKQVRLVGNFKGGGRVPRPDEDPCLEVETSSHAGL
                     RLGPHTEAPYNCSTNASNAHSPAPSALILTARWNPANEPTNVFPLREIIERLSSLDTL
                     ALTSKSFDFTRSDCFAQGQGSAGKAVSVLQFEPNGGFSVRYNSYRFSLNERACSAAAR
                     AFNAFQKALSTAQPLTFALQPDSALLINNSRALHGRDKVQDNRRLLIRQFGYSPFAVP
                     LVLAEDPLLVRG"
     gene            613981..614865
                     /locus_tag="PPUBIRD1_RS02715"
                     /old_locus_tag="PPUBIRD1_0541"
     CDS             613981..614865
                     /locus_tag="PPUBIRD1_RS02715"
                     /old_locus_tag="PPUBIRD1_0541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003185968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="WP_019439170.1"
                     /translation="MRMRLMLLGGGNALGQALIRLGAEEDIAFLAPRPPENGWAPSSL
                     TQLLDDHRPDALVNLAYYFDWFQAESVSEQRLAQQERAVERLAELCQHHQITLVQPSS
                     YRVFDGSRATAYSEKDEPVPLGMRGQALWRIEQSVRAACPQHVLLRFGWLLDESIDGA
                     LGRFLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCNAPLWGTYHYAGNEA
                     TTPLALGQAILAEAGQYRQLAVQAPTPQAHAARPDASEEPQHAVLACKKILHTFGIKP
                     RAWRAGLPPLLDRFYRHG"
     gene            614858..615790
                     /locus_tag="PPUBIRD1_RS02720"
                     /old_locus_tag="PPUBIRD1_0542"
     CDS             614858..615790
                     /locus_tag="PPUBIRD1_RS02720"
                     /old_locus_tag="PPUBIRD1_0542"
                     /EC_number="5.1.3.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_014589495.1"
                     /translation="MADAPILITGGAGFIGSHLCDALLDKGYAVRILDDFSTGRRSNL
                     QVDHPRLELIEGDVADAGLVTQAAAGCRAVVHLAAVASVQASVEDPVRTHQSNFIGTL
                     NVCEAMRVHGLRRVLFASSAAVYGNNGEGESISEDTPKAPLTPYAVDKLASEQYLDFY
                     RRQHGLEPVVFRFFNIFGPRQDPSSPYSGVISIFCERAVQGLPITVFGDGEQTRDFLY
                     VGDLVQVMVQALEQPQVEEGAVNIGLNQATSLNQLLAALGKVVGSLPAISYAAARSGD
                     IRHSRADNQRLLARFEFVQVTPMVEGLAKLLGKG"
     gene            complement(615821..616264)
                     /locus_tag="PPUBIRD1_RS02725"
                     /old_locus_tag="PPUBIRD1_0543"
     CDS             complement(615821..616264)
                     /locus_tag="PPUBIRD1_RS02725"
                     /old_locus_tag="PPUBIRD1_0543"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589496.1"
                     /translation="MLDEKNAQCPVARALEVLGDRWALMILRDAFDGLRRFSEFQKNL
                     GLAKNILTSRLKLLVESGLLMTQPASDGSAYKEYVLTDKGRSVFPVVVGLRQWGERFL
                     FEAGEARSELVDGVTGQALEILQVRGQDGRVLHPEDCQRRRVRHG"
     gene            616368..617573
                     /locus_tag="PPUBIRD1_RS02730"
                     /old_locus_tag="PPUBIRD1_0544"
     CDS             616368..617573
                     /locus_tag="PPUBIRD1_RS02730"
                     /old_locus_tag="PPUBIRD1_0544"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589497.1"
                     /translation="MTPSLTRWITLLLATTSAMAVATVYFAQPLLESMAAELGVAQQQ
                     IGWVVGATQAGYALGLLLIVPLGDLVDRKRLLLGQLLFAALALVGVGMAPNWAILLLA
                     LAITGLMAVMVQVMVAHAASLASPGQQGQAVGTVTSGVVLGILLARLASGGLADLAGW
                     RSVYLVAAGLLMLLALVLWRSLPGGQPMGSRPGYRALIVAQFSLYRHDRLLRQRGVFG
                     VLIFAAFSVLWSAMVMPLSAAPLTLSHTEIGLFGLAGVAGTLAASHAGRLADLGRGER
                     TTGVSLALLTLSWLPTAFVEHSLLAFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASR
                     LIGAYMCCYSLGSGLGAVLASWVFAHWGWVAVCGLGMGISAAALCYWLWLQRARAAEA
                     ALQCSGQNL"
     gene            complement(617561..618244)
                     /locus_tag="PPUBIRD1_RS02735"
                     /old_locus_tag="PPUBIRD1_0545"
     CDS             complement(617561..618244)
                     /locus_tag="PPUBIRD1_RS02735"
                     /old_locus_tag="PPUBIRD1_0545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_237541.1"
                     /note="OmpW family protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein W"
                     /protein_id="WP_014589498.1"
                     /translation="MNKSLLGASLVALALAAPAAHAYQAGDMILRAGAITTAPNESSG
                     DLKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHIGLELLAATPFKHTVGVKGLGGGLD
                     GKLADIKQLPPTLSLQYYPMEPNSRFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKL
                     QDSVGIAGQLGMDYMLTDNLLVNASVWYVDIDTKASVNGPTALGYSKTKVDVDVDPWV
                     YMVGLGYKF"
     gene            complement(618354..618866)
                     /locus_tag="PPUBIRD1_RS02740"
                     /old_locus_tag="PPUBIRD1_0546"
     CDS             complement(618354..618866)
                     /locus_tag="PPUBIRD1_RS02740"
                     /old_locus_tag="PPUBIRD1_0546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3299 domain-containing protein"
                     /protein_id="WP_014589499.1"
                     /translation="MHMLLALLLLVAMPLWAAEPKELDWPALIPEGAPVIPPQLTPLH
                     DMSQLSNALSAESAPPARQQAPDAPVVKSLDGQQVKLPGYIVPLEVSEEGRTTEFLLV
                     PYYGACIHVPPPPPNQIVHIFSEMGVRIEDLYQPYWIEGKMQVRASSSELADAGYQME
                     AEKIYAYELR"
     gene            complement(618993..620258)
                     /locus_tag="PPUBIRD1_RS02745"
                     /old_locus_tag="PPUBIRD1_0547"
     CDS             complement(618993..620258)
                     /locus_tag="PPUBIRD1_RS02745"
                     /old_locus_tag="PPUBIRD1_0547"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003185960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014589500.1"
                     /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARA
                     SFASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFQHYAQDPRVKWAIPIS
                     LGDSHRGYRVMGTTTDYFSHYQYGRRQPLQLSQGREFANDPFEVVLGAEVAEALHYKL
                     GDKLVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHISLGGMEAIHIDWHNGV
                     PARGAGRISAEQARTMDLQPAAITAFMLGLNSKIATFSLQREINEYRSEPLLAILPGV
                     ALQELWSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWH
                     IAGLLVLEALSLASVGIVAGLGLLYAGIALAQGYVQANYGLYLPLAMPSPHEWTLLAI
                     ILGAALLMGSVPAWRAYRQSLADGLSIHL"
     gene            complement(620258..620968)
                     /locus_tag="PPUBIRD1_RS02750"
                     /old_locus_tag="PPUBIRD1_0548"
     CDS             complement(620258..620968)
                     /locus_tag="PPUBIRD1_RS02750"
                     /old_locus_tag="PPUBIRD1_0548"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014589501.1"
                     /translation="MNQPLIDLHDLVFAWPGHPPLLDIPALRLDAGEALFLKGPSGSG
                     KTTLLGLLGGVNVPVQGRIQLLGQDLGSLSQGARDRFRVDHTGYIFQQFNLLPFLSVR
                     ENVELPCRFSRSRKARAEQRHGSVGQAASTLLTHLGLGDPAMLARRADSLSIGQQQRV
                     AAARALIGQPELVIADEPTSALDADTREAFIRLLFDECRAAGASLLFVSHDQSLAPLF
                     DRHLSLAELNRAAKPREA"
     gene            complement(620969..621550)
                     /locus_tag="PPUBIRD1_RS02755"
                     /old_locus_tag="PPUBIRD1_0549"
     CDS             complement(620969..621550)
                     /locus_tag="PPUBIRD1_RS02755"
                     /old_locus_tag="PPUBIRD1_0549"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019096674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589502.1"
                     /translation="MRRLLLALPFALLPLAVAHAHDDHDHDHDHDHAHGSLGAHEHGV
                     AKLNAVLDGNTLELELDSPAMNLVGFEHAASSDADNAKVAAVRQQLEQPLKLFGLSAA
                     AGCKEDQQALESPLFGDASKADDEGDEHGHQHSDIGAHYQLTCANPDKLTELDLAPLF
                     KAFPATQKINVQLIGPNGQKGVETTPAKAAVAF"
     gene            621681..622025
                     /locus_tag="PPUBIRD1_RS02760"
                     /old_locus_tag="PPUBIRD1_0550"
     CDS             621681..622025
                     /locus_tag="PPUBIRD1_RS02760"
                     /old_locus_tag="PPUBIRD1_0550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255407.1"
                     /translation="MRIRGQIGDWPVDLTIELTPEEWAQLGRQTEVPMVAQAAATAAV
                     VAPRQDDGQWAAARDVLRLAGQMSGPELLDRLEGLAGSTAAGKRLLVRLRHSSEVKVE
                     SGVDAPMYHWVG"
     gene            622022..622162
                     /locus_tag="PPUBIRD1_RS26025"
     CDS             622022..622162
                     /locus_tag="PPUBIRD1_RS26025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013971732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_080557757.1"
                     /translation="MSAVFAVGAKPARSPVGAVLPANTGRAGALHRVASFAGMPAPTG
                     PA"
     gene            complement(622343..623215)
                     /gene="trxA"
                     /locus_tag="PPUBIRD1_RS02765"
                     /old_locus_tag="PPUBIRD1_0551"
     CDS             complement(622343..623215)
                     /gene="trxA"
                     /locus_tag="PPUBIRD1_RS02765"
                     /old_locus_tag="PPUBIRD1_0551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019472336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone YbbN"
                     /protein_id="WP_014589503.1"
                     /translation="MTQDTPYIFDATDTNFQQLVIENSFHKPVLVDFWAEWCAPCKAL
                     MPLLAKIAEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPE
                     SAIRAMLEPHVQMPAAPTAAPLEQAKALFAESRFAETEALLQALLGEDNSNVEALILY
                     ARCLAERGELGEAQVVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQN
                     PQDDEAAYQLSIQQLARQQYEAALEGLLKLFQRNRGYENGLPQKALLQVFELLGGDHP
                     LVGVYRRKLSAAMF"
     gene            complement(623247..623903)
                     /locus_tag="PPUBIRD1_RS02770"
                     /old_locus_tag="PPUBIRD1_0552"
     CDS             complement(623247..623903)
                     /locus_tag="PPUBIRD1_RS02770"
                     /old_locus_tag="PPUBIRD1_0552"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014589504.1"
                     /translation="MPLALQQALSGLIGEARLIVSELPDCDLKLWLIDDQNMDRAFSS
                     EETRRILEEPPYWSFCWASGLAMARYLAERPEWVAGKRVLDFGAGSGIAGIAAARAGA
                     REVVACDLDPLALDACRANAALNGVTLSYSSDFFAEEDRFDLILVADVLYDRANLPLL
                     DAFLSRGRQALVADSRVRDFRHPLYQQLGVLEALTLPDLAEPHEFRRVSLYHASRDTL
                     "
     gene            complement(623907..624353)
                     /locus_tag="PPUBIRD1_RS02775"
                     /old_locus_tag="PPUBIRD1_0553"
     CDS             complement(623907..624353)
                     /locus_tag="PPUBIRD1_RS02775"
                     /old_locus_tag="PPUBIRD1_0553"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589505.1"
                     /translation="MHYRALVVLCCAALLAACGSNRPKTDNPVPAPAPSAKAEVLGPL
                     PAYQRELSGTLLEIPAGAEVELALLVIDERDRPQRLLASSNLTGTGQALPYHLRFNPE
                     AFPPGARVELRGRASNSGQLIMHLPPVRITQAQTQATGPLRFEKAP"
     gene            624445..624924
                     /gene="nrdR"
                     /locus_tag="PPUBIRD1_RS02780"
                     /old_locus_tag="PPUBIRD1_0554"
     CDS             624445..624924
                     /gene="nrdR"
                     /locus_tag="PPUBIRD1_RS02780"
                     /old_locus_tag="PPUBIRD1_0554"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator NrdR"
                     /protein_id="WP_014589506.1"
                     /translation="MLPATMHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFT
                     TFETAELVLPRLIKQDGTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRA
                     TGEREVKSLVVGEMVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE"
     gene            624927..626057
                     /gene="ribD"
                     /locus_tag="PPUBIRD1_RS02785"
                     /old_locus_tag="PPUBIRD1_0555"
     CDS             624927..626057
                     /gene="ribD"
                     /locus_tag="PPUBIRD1_RS02785"
                     /old_locus_tag="PPUBIRD1_0555"
                     /EC_number="3.5.4.26"
                     /EC_number="1.1.1.193"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012312507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin biosynthesis protein RibD"
                     /protein_id="WP_014589507.1"
                     /translation="MPSQAAILDAHYMARALELARKGLYTTHPNPRVGCVIVRDGEVV
                     GEGWHVRAGEPHAEVHALRQAGELARGACAYVTLEPCSHHGRTPPCAEALVKAGVARV
                     VAAMQDPNPQVAGQGLRRLAEAGIEVASGVLEAEARALNPGFLKRMEHGLPFVRAKLA
                     MSLDGRTAMASGESQWITGPAARSAVQRLRARSSVVLTSAASVLADNARMTVRGAELG
                     LDAETTALALSRTPLRVLVDGRLRLSLASPFFQAGPALVVTAVADDPRYAAAGHELLS
                     LPGDNGQVDLGALLHALAARGVNEILLEAGAGLVGAFARQGLVDEYQLFVAGTFLGSQ
                     ARPLLDWPMDKMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
     gene            626100..626765
                     /locus_tag="PPUBIRD1_RS02790"
                     /old_locus_tag="PPUBIRD1_0556"
     CDS             626100..626765
                     /locus_tag="PPUBIRD1_RS02790"
                     /old_locus_tag="PPUBIRD1_0556"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase"
                     /protein_id="WP_012312508.1"
                     /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAV
                     NGVCLTAVELPGDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGH
                     VDGVGEIISRSDSARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTI
                     VPHTLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGF
                     LKS"
     gene            626784..627875
                     /gene="ribB"
                     /locus_tag="PPUBIRD1_RS02795"
                     /old_locus_tag="PPUBIRD1_0557"
     CDS             626784..627875
                     /gene="ribB"
                     /locus_tag="PPUBIRD1_RS02795"
                     /old_locus_tag="PPUBIRD1_0557"
                     /EC_number="4.1.99.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019581380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP
                     cyclohydrolase II"
                     /protein_id="WP_003255398.1"
                     /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCQPEH
                     INFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAA
                     DRARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSG
                     VICEVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQSVESEL
                     GEFNLVTYRDAVEGDVHMALTLGKICAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAA
                     MAAVAEAGSGVVLLLGHPLDGDVLLAHIRESAGDAPAKAPTTYSTVGAGSQILRDLGV
                     RKMRLMSSPMKFNAISGFDLEVVEYVPSE"
     gene            627967..628443
                     /locus_tag="PPUBIRD1_RS02800"
                     /old_locus_tag="PPUBIRD1_0558"
     CDS             627967..628443
                     /locus_tag="PPUBIRD1_RS02800"
                     /old_locus_tag="PPUBIRD1_0558"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017902308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="WP_003255395.1"
                     /translation="MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHG
                     VSESDITIIRAPGAFEIPLVAQKVAQQGAYDAIIALGAVIRGGTPHFEYVAGECTKGL
                     AQVSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK"
     gene            628440..628940
                     /locus_tag="PPUBIRD1_RS02805"
                     /old_locus_tag="PPUBIRD1_0559"
     CDS             628440..628940
                     /locus_tag="PPUBIRD1_RS02805"
                     /old_locus_tag="PPUBIRD1_0559"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010222843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N utilization substance protein B"
                     /protein_id="WP_003255393.1"
                     /translation="MISDESDRFNPRDPKPADAGKPSKSAKRREARKLATQALYQWHM
                     AQHSLNEIEAQFRVDNDFTDVDGAYFREILHGVPAIKGEIDKALVPCMTIALEELDPV
                     ELAVLRLSTWELIKRVDVPYRVVINEGVELAKVFGATDGHKFVNGVLDKLAPALREAE
                     VKANKR"
     gene            628959..629927
                     /gene="thiL"
                     /locus_tag="PPUBIRD1_RS02810"
                     /old_locus_tag="PPUBIRD1_0560"
     CDS             628959..629927
                     /gene="thiL"
                     /locus_tag="PPUBIRD1_RS02810"
                     /old_locus_tag="PPUBIRD1_0560"
                     /EC_number="2.7.4.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011953348.1"
                     /note="thiamine monophosphate kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-monophosphate kinase"
                     /protein_id="WP_014589508.1"
                     /translation="MGEFELINHYFAAAPCAQGGEGVALGIGDDCALLDLPPGEQLAV
                     STDTLVAGVHFPAVCDPLLLGQRSLAVAASDLAAMGATAIGFTLALTLPDVGSDWLAA
                     YADGLGRMAHRCRMSLIGGDTTRGPLSITVTVFGRVPAGQALRRSGARPGDLLCVGGS
                     LGKAAGALPLVLGEREAPAAQAEPLLAHYWSPMPQLTLGALLRGKATAALDISDGLLA
                     DCGHIAKASGVALEVNLAQVPVSPALEAFLGREAALQAALTGGDDYVLAFTLPPEALA
                     PLAGLGCIEVHIIGRVLEGQGVTLRDSQGQDITPVQRGYQHFRERP"
     gene            629924..630427
                     /locus_tag="PPUBIRD1_RS02815"
                     /old_locus_tag="PPUBIRD1_0561"
     CDS             629924..630427
                     /locus_tag="PPUBIRD1_RS02815"
                     /old_locus_tag="PPUBIRD1_0561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009685716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="WP_010951803.1"
                     /translation="MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSL
                     VAIPFIPLWQLLPDWGYWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWIT
                     LWLVPEGWQWLLAGFLMFRFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQ
                     VLVWAVA"
     gene            630444..631187
                     /locus_tag="PPUBIRD1_RS02820"
                     /old_locus_tag="PPUBIRD1_0562"
     CDS             630444..631187
                     /locus_tag="PPUBIRD1_RS02820"
                     /old_locus_tag="PPUBIRD1_0562"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014589509.1"
                     /translation="MTIRTVLLAMLLSIAPWVTAAEGIPKQIHLVSEEWLDYTNADGT
                     GVAWDVLRKVFEPAGVEVITQSAPYSRAVGLVKRGEADAWVGSYKEENDDNLYPRWHF
                     DMDHIYALGLASKPVPTLETIGKYRLAWVRGYDYGSYLPNVREFREIQRREGILPMLE
                     HDRVDYYIDALTEVDYVLGQTSQPERFRRTHVAELPLYLAFARNDQAKALCELFDKRM
                     KELIRSGELKPIFEHWTQPYPFSTDSHPH"
     gene            631368..631985
                     /gene="ribA"
                     /locus_tag="PPUBIRD1_RS02825"
                     /old_locus_tag="PPUBIRD1_0563"
     CDS             631368..631985
                     /gene="ribA"
                     /locus_tag="PPUBIRD1_RS02825"
                     /old_locus_tag="PPUBIRD1_0563"
                     /EC_number="3.5.4.25"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017849574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="WP_003255389.1"
                     /translation="MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQ
                     PVLGRLHSECLTGDALFSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKI
                     RAYELQDGGADTVEANERLGFAADQRDYAICLPMLEHLGVKSLRLMTNNPRKVKALTD
                     MNIVVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQGEVPQA"
     gene            631982..632401
                     /locus_tag="PPUBIRD1_RS02830"
                     /old_locus_tag="PPUBIRD1_0564"
     CDS             631982..632401
                     /locus_tag="PPUBIRD1_RS02830"
                     /old_locus_tag="PPUBIRD1_0564"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589510.1"
                     /translation="MTRAEVKRRLALAWWQYLAVGLVPLPVMAWAFGGGDALIPVLAM
                     PLFIAGAATMFLSLPRFGAYKRALIATSKVLGTGEEATAWIELARVRRMAMLYACFPA
                     WVAALSVLVGLEAVPQILLALSTVVVLYLYRIPRQLG"
     gene            632401..633213
                     /locus_tag="PPUBIRD1_RS02835"
                     /old_locus_tag="PPUBIRD1_0565"
     CDS             632401..633213
                     /locus_tag="PPUBIRD1_RS02835"
                     /old_locus_tag="PPUBIRD1_0565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin-binding protein"
                     /protein_id="WP_041166827.1"
                     /translation="MRLLPGLLALLACTVLAAEPLRVVSLAPSMSEIMLELQADDLLV
                     GVLDGGERPAALRHLPSVGRQGQLDMERLLSLRPDLLLLWPGSVPPAQRDQLKRLGIA
                     TFSAEPHDISQLIEQIEAIAERVGRAEQGHSYARALRERLQQLRQQYRRDEPLQVFYQ
                     VWDRPLYTLGGRQVVTDALAVCGARNVFADLGQPAPQVNVESVLLRNPQVILAADEAQ
                     LANWKAWPQIRAVADGRLLVVPDKGLERPSGQMIEATARLCALLDAKAPVSR"
     gene            complement(633191..635062)
                     /locus_tag="PPUBIRD1_RS02840"
                     /old_locus_tag="PPUBIRD1_0566"
     CDS             complement(633191..635062)
                     /locus_tag="PPUBIRD1_RS02840"
                     /old_locus_tag="PPUBIRD1_0566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_041166828.1"
                     /translation="MKKLACTTILCAPTFLLAAERDDALKLPDVLISASRQVESRTAT
                     SAANTVFTRTDIDRLQPSSVTDLLSRVPGLQVAPTGGRGSLPGIFIRGTKAAQSLVLV
                     DGVRIANATSGDSGLQFLDIDQIERIEVLRGSRSAVYGSDAIGGVIQIFTRRSSGPGL
                     QPRLRMAAGSNQTFQRSLGLSGGNDSTRFNLGASLDETAGIDSTGPSFASDGDHDAYR
                     NKALNLSLSHTFGERFEAGLNLLDSRGRSEYDNPFGGFDPVTFESFGQQPYTDFSVSS
                     LGSYVDVQVTETWHSRLELAHSENRDDKRDKLSAERFVFNTYRDQATWQNDLALGERN
                     TVLIGGDWYEDRVHGTTDFTDDSRWNRAVFAQHRYRGEQFSTELGVRHDRNQQFGGQT
                     TWSGSLTVPLNANNDVLLSYSEGFRAPTFNDLYYPQFSNPNLDPEHSRSYELQWRSQL
                     TAESRLETSLYRTDLRDAIIFGQDSIPRNVASARINGVEMALAQQWGAWHSQLGLALI
                     DPRDRDTGHTLARRARRTLSLDLDREFGRFSVGASWQAVSNSYDDEANRNRIGGYGLL
                     GLRGSWAASDELKLEAKLDNLLDRSYSRALYSYEGAYHPYREEGRTVLLSITWTPAL"
     gene            635362..635559
                     /locus_tag="PPUBIRD1_RS26030"
     CDS             635362..635559
                     /locus_tag="PPUBIRD1_RS26030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010952326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557758.1"
                     /translation="MSPLPYSRVNPLLQWAHIGDRAQPAVGAGSPAKGPGLLANFHPP
                     FTVAAAIVFAGKTAPTVGTHR"
     gene            complement(635605..637500)
                     /locus_tag="PPUBIRD1_RS02845"
                     /old_locus_tag="PPUBIRD1_0567"
     CDS             complement(635605..637500)
                     /locus_tag="PPUBIRD1_RS02845"
                     /old_locus_tag="PPUBIRD1_0567"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012312519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_014589513.1"
                     /translation="MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQ
                     ELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRM
                     LSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDG
                     ALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREG
                     SKKVLSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNM
                     RDLKGPQFLHVVTKKGKGFAPAEIDPIGYHAITKLEPADKPAAPKKASGPKYSAVFGQ
                     WLCDMAAADNRLVGITPAMKEGSDLVDFSERYPERYFDVAIAEQHAVTLAAGMACEGS
                     KPVVAIYSTFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSYDLSYLRCI
                     PGMLVMTPSDENELRKMLSTGHLYNGPAAVRYPRGTGPNAPISGDLQPLEIGKGVVRR
                     QGEKVALLVFGVQLAEAMQVAEQINATVVDMRFVKPLDEALVLELAGNHELLVTIEEN
                     AIMGGAGAAVGEFLASQAVLKPLLHLGLPDIYVEHAKPAQMLAECGLDAAGIEASVKA
                     RMVKLGL"
     gene            complement(637678..638565)
                     /locus_tag="PPUBIRD1_RS02850"
                     /old_locus_tag="PPUBIRD1_0568"
     CDS             complement(637678..638565)
                     /locus_tag="PPUBIRD1_RS02850"
                     /old_locus_tag="PPUBIRD1_0568"
                     /EC_number="2.5.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790546.1"
                     /note="polyprenyl synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2E,6E)-farnesyl diphosphate synthase"
                     /protein_id="WP_014589514.1"
                     /translation="MIGTYQAGCQARVDAALEPLFIAPSKELERLYAAMRYSVMNGGK
                     RVRPLLAYAACEALGAPAEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHK
                     AFDEACAILAGDGLQSLAFSALLDPCLSPQIDSIRLAMVQVLAKAAGPAGMVGGQAID
                     LGSVGQKLDQQALEFMHRHKTGALIEASVRLGALASARAEPAQLDALQTYAQAIGLAF
                     QVQDDILDVESDTATLGKRQGADIARDKPTYPALLGLEAAKVYAIELRDQALAALQGF
                     GETAEPLRALARYIVERRN"
     gene            complement(638562..638804)
                     /locus_tag="PPUBIRD1_RS02855"
                     /old_locus_tag="PPUBIRD1_0569"
     CDS             complement(638562..638804)
                     /locus_tag="PPUBIRD1_RS02855"
                     /old_locus_tag="PPUBIRD1_0569"
                     /EC_number="3.1.11.6"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011531978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease 7 small subunit"
                     /protein_id="WP_003255380.1"
                     /translation="MARKKASLDFEQSLADLQALVERLENGELSLEESLAAFEQGIAL
                     TRDCQGALAQAEQKVQILLERDGELAAQPFDAEPEA"
     gene            complement(638966..639616)
                     /gene="ribB"
                     /locus_tag="PPUBIRD1_RS02860"
                     /old_locus_tag="PPUBIRD1_0570"
     CDS             complement(638966..639616)
                     /gene="ribB"
                     /locus_tag="PPUBIRD1_RS02860"
                     /old_locus_tag="PPUBIRD1_0570"
                     /EC_number="4.1.99.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589515.1"
                     /note="3,4-dihydroxy-2-butanone 4-phosphate synthase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /protein_id="WP_014589515.1"
                     /translation="MFTQHHAQFPNVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAE
                     NISLQTMAMMIRDCSGIVCLCLDEATVDELQLAPMVQNNQARHGTGFTVTIEAAEGIT
                     TGVSAQDRITTIAAALSSSAEQRHIVSPGHVFPLRARNGGVLTRRGHTEGSVDLARLA
                     GLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYREAMLEREAEPA"
     regulatory      complement(639697..639838)
                     /regulatory_class="riboswitch"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00050"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="FMN riboswitch; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
                     /bound_moiety="flavin mononucleotide"
                     /db_xref="RFAM:RF00050"
     gene            639988..640968
                     /locus_tag="PPUBIRD1_RS02865"
                     /old_locus_tag="PPUBIRD1_0571"
     CDS             639988..640968
                     /locus_tag="PPUBIRD1_RS02865"
                     /old_locus_tag="PPUBIRD1_0571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zeta toxin family protein"
                     /protein_id="WP_014589516.1"
                     /translation="MSFLYPFTDTDLHLAFRKVADTLFDKKRDYVDGVLKPKMLIIAG
                     AQGSGKTYLLEKTLLKSGRYDNYVRLYETHFRELHPHYRAMEDKGVLHVYEHTESFIW
                     RLGAMVCTYAMENKYNIIMETALDSPHFADFPPEAARQGYQSEVHLVACQKEFSHWST
                     LDRVVNSVANHEIERVVSLTQIEEAQINGRSIIDAFENACIEVPGSEIVIYRRGLETE
                     KNSLPVCHSTCPEKGLLVPQQTYQGRAFFRGADLKINFKVQRSPQADFPCSYIQYAQV
                     VHAGLLGSEHRRAMAELNCKTLGQAQRLMSQLPVDVYRELCLYVLKYAQR"
     gene            complement(640990..641883)
                     /locus_tag="PPUBIRD1_RS02870"
                     /old_locus_tag="PPUBIRD1_0572"
     CDS             complement(640990..641883)
                     /locus_tag="PPUBIRD1_RS02870"
                     /old_locus_tag="PPUBIRD1_0572"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014589517.1"
                     /translation="MSKKTLMLALALALAAPLVLAQPEHDQKMDTSVLQRQDLAYHFS
                     QLDLDSADGLRHYRLWVGKPNRPAPASGYPVLWMLDGNAALGTLDQQQLDRLAAGQAP
                     LLVAVGYPTELRIDRAGRTLDYTPALPEQAQQRDPLTGQPSGGVDAFLKLLTGRMRTM
                     VSAVAPIDPQRQTLWGHSYGGLAVLHALFTRPGAFSLYAAASPSLWWRDGVIVREAQG
                     LPSRLGEARPHLLLMRGGQEPASPHGSPHENDELPARQLAADLAAIKGLDVRFERFEG
                     LGHGPMLGASLRRVIEGMSGQ"
     gene            complement(641984..643312)
                     /locus_tag="PPUBIRD1_RS02875"
                     /old_locus_tag="PPUBIRD1_0573"
     CDS             complement(641984..643312)
                     /locus_tag="PPUBIRD1_RS02875"
                     /old_locus_tag="PPUBIRD1_0573"
                     /EC_number="2.7.13.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_251377.1"
                     /note="sensor protein PfeS; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_014589518.1"
                     /translation="MRRHPLLWKLALLQVSFCLLLIWLIWTWGLSVERSTYFLSPADQ
                     DYLARYAQQAEQALEQDGAVGIEAWRKQVERAEDTWVAVIGPYLQSLGTTPLSAEEAS
                     HLTFMRKLDWPMSRRLQDELPYVSIEFPQHPEHGRLVLQLPERLLPTGLTPWTHVVTH
                     GVAPALLALLLGLALYRHLVVPLNRLRDRADALRADDLDSPALPLQERRDELGELAQA
                     FEHMAGRLRQSLEQQRLLLRTLSHELRTPLARLRIAHDSDLPPPQLRERLDREVGDMQ
                     KLLENTLDLAWMDTEQPSLATEPVLVLSVWEALCEDVCFESGWDRARLPCSLGTDCLV
                     QAHLDSLAQALENLLRNAIRHSPTEGRISLDGWRSGACWHLRLSDQGPGVPDTDLERI
                     FKPYQRLADSGAGFGLGLAIARRAIELQGGRLWASNGHPGLCLHMTLPAA"
     gene            complement(643312..644004)
                     /locus_tag="PPUBIRD1_RS02880"
                     /old_locus_tag="PPUBIRD1_0574"
     CDS             complement(643312..644004)
                     /locus_tag="PPUBIRD1_RS02880"
                     /old_locus_tag="PPUBIRD1_0574"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_014589519.1"
                     /translation="MPTSLLLAEDDPRLLQDLERHFRNRGFQVHACASGTQALNAIQQ
                     SQFELVLLDIMLPGIDGLSLLDALRRQQAVPVMLMSALGAEQDRISGFTRGADDYLPK
                     PFSLAELDARVDALLRRVAFDRGTALRADVGEVMLDHDRQDVIHNGNAAGLTASEFRL
                     LVTLLAHPDEALSKPFLYQTVLHRAYTRLDRGLDVHVCNLRRKLADISAQHLQIQAVR
                     GQGYILVDTEQA"
     gene            644186..646363
                     /locus_tag="PPUBIRD1_RS02885"
                     /old_locus_tag="PPUBIRD1_0575"
     CDS             644186..646363
                     /locus_tag="PPUBIRD1_RS02885"
                     /old_locus_tag="PPUBIRD1_0575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent siderophore receptor"
                     /protein_id="WP_014589520.1"
                     /translation="MTGFKSVGSLQRVRGWLALGLLAPFSLSAVAETVATQAAAEDTS
                     LDLPALTIEGNRLYDMLPSEETGGYSVDAATVGTKTPAALKDIPQSITVYTQDYVKDR
                     QFVHLDDLAKYTAGLRTLTNDSGRSSIYARGYEYSEFNIDGLPAPMASIFGTVPSLAA
                     FDRVEIMRGPAGLFSSTSELGGIVNMVRKRPTAEFQGHIEGSYGTWDTNHEEIDLSGP
                     LDAGGRVRGRFIASRDDTNGEVDYNANTSNSYYGALDIDLDEATTLSFGLMHEVKNIT
                     PHNGYPATLSGEVPDFSHSRFLGADWNYFDGKTTDLVAELTHRFDNGGYGRVAARGSH
                     RDTNYLYAFTATNANTGANSERASARDFTQDTYSLDASYSQPFETFGQVSEFVVGSDY
                     KNYDTEYLNGTTNLGAINVNTYSPKQFAKPSPNYSTETGMQEEEYGLYSKVTFRPIER
                     LALIAGGRFSWYRGDFYTTTLSSGATTNDSKRVDGHFTPYGGLVYDLTENHALYASYS
                     QVFKPQSDTDSNGRVLKPREGEQYEFGLKSSYFGGDLNTRFSVFRLTDKNRATTVYDA
                     DGVATTDSVASGKTRVKGAEVEVSGKLTPNWELLAGYTWMETETVKGDAETTFFIMPR
                     NQASLWSKYTISQGPLTGLAIGGGISAMSNFYSENGGVRIDAPGYATVDAMLSYPVTS
                     KLTATLNVNNLFDRDYLSRVGSTSTFNFYGPSRSMMVGARYDF"
     gene            complement(646540..647004)
                     /locus_tag="PPUBIRD1_RS02890"
                     /old_locus_tag="PPUBIRD1_0576"
     CDS             complement(646540..647004)
                     /locus_tag="PPUBIRD1_RS02890"
                     /old_locus_tag="PPUBIRD1_0576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-binding protein"
                     /protein_id="WP_014589521.1"
                     /translation="MNALLKELHAYHHEVAAKITQIKELLERIRHGSSGADDCKLLFK
                     QLEALHGDAERHHHENEELIRLVLLTTDAPIHQRVMAIEQDHKAFTRIAGQLKMLEQS
                     TQEARVIADTIEDFIKKYYDHMDAEENIFFPLADKWLSDTQWQEIKHQWHPS"
     gene            647560..648729
                     /locus_tag="PPUBIRD1_RS02895"
                     /old_locus_tag="PPUBIRD1_0577"
     CDS             647560..648729
                     /locus_tag="PPUBIRD1_RS02895"
                     /old_locus_tag="PPUBIRD1_0577"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017940122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_080557759.1"
                     /translation="MYFRITPAGGGGWIFRYRSGGKLRDMGLGSFPDVSLQSARVKAA
                     DARKQIAHGMDPLHERELEREAERDARLANAAKSVTFEKLVADYIKAHGGGWSEKWRK
                     GWLSKMERYAFPSIGSLPASQIAVEQVLGVLKPIWSSKPRTADEVRGQIEQLLDAAKA
                     RGLREGENPARWRGHLDNLLSRDAKKVARKRTHFAAMQWQALPALMAELQMVDTLPSY
                     AAQLLILTGARARMVGFARWDEFDLGARTWLLSAERMKMRKEFVIPLAVPVVELLSKI
                     PRVEDSPYLFPGRGKSGVMHANAVRNLLHGLNHDDITRHGFRSTFRDWAAERTSYPRE
                     ICEMALAHDERDQTEGAYSRTNFLEKRRDLMADWASYALSSPSDNVIQGEFCRQP"
     gene            648748..649380
                     /locus_tag="PPUBIRD1_RS02900"
     CDS             648748..649380
                     /locus_tag="PPUBIRD1_RS02900"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166829.1"
                     /translation="MRRDHQLLQWLSIDQALGNLCSITREPISEEDLFSLCEEGKCSA
                     YYQAGGIRGNTQVASLEEKPQEVFGAGYQKILNASDLRGALGTGAVQLSLVGPVFSTD
                     PDDYEESRCVWEAVVADSRRKIRFKTTDIQALADTITGPSKNEALDVRERRSLLALIA
                     VLAQMDSIDLTEPYKAAGIIETGASRLGLWVPGEDTIVKYLKLAVSAKQP"
     gene            649491..649736
                     /locus_tag="PPUBIRD1_RS26035"
     CDS             649491..649736
                     /locus_tag="PPUBIRD1_RS26035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016783473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166830.1"
                     /translation="MERNLIDSHTQRRILRRPEVEMRTGFKRAHIYSLMSRGLFPKAV
                     PIGSRAVGWDSLEVERWIADRLAGTLTRLSVSVGGAV"
     gene            649733..650110
                     /locus_tag="PPUBIRD1_RS02910"
     CDS             649733..650110
                     /locus_tag="PPUBIRD1_RS02910"
                     /inference="COORDINATES: protein motif:HMM:PF00239.19"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557760.1"
                     /translation="MTIFAYVRVTATHPSGDAQRNEIAMAHRVERWFKDEELGESTSI
                     LELPGFSELFKLARKGDTVIVYANECLGSSVRAFLQALEALQKKGVQVMSVQGGDLSA
                     FGRQVFRTLNSIARLRDTVRGAS"
     gene            650277..650858
                     /locus_tag="PPUBIRD1_RS02915"
     CDS             650277..650858
                     /locus_tag="PPUBIRD1_RS02915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005888939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_041166831.1"
                     /translation="MTILAYVRVSTEDQSTDAQRHSILQLHNVEHWYADEATSGAIKA
                     LQRPGFAELFKFARKGDTLIVSAIDRLGRDTIDVLETVEALKSKGVAVVSMREGFDLS
                     SPIGKAMLTMLAAAAELERSNIKARQMAGIERARALGQKLGAPKKVDDLAVSAWRAAN
                     SATIQETAAQFGISIASVKRACASKPSVTVKGE"
     gene            650855..651508
                     /locus_tag="PPUBIRD1_RS02920"
     CDS             650855..651508
                     /locus_tag="PPUBIRD1_RS02920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589524.1"
                     /translation="MKMAGKQSTPDQAAQAVILREAGWTVSAIAQRLCISISTTQRLL
                     KKHNAVAGAGTQALIEKAREELLTAAFSLDAVQQTAASLVVEELALNQQIRTKLANAL
                     EILDPAHPIAFRGLAAASTTLKLTQDVTRRALPLEKLNQALDFEELPELKIHIMTDRD
                     VTEMRAQQRLEEAESDGNLEGVEDELETLRWLDSRRMAQLEQQDDLVCEGFDSNLPG"
     gene            651903..652484
                     /locus_tag="PPUBIRD1_RS25855"
                     /old_locus_tag="PPUBIRD1_0580"
     CDS             651903..652484
                     /locus_tag="PPUBIRD1_RS25855"
                     /old_locus_tag="PPUBIRD1_0580"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049870060.1"
                     /translation="MQSYQGTGELPDWAKFVSPEMKQYFRLHLLCTKPDAKTVTIRLD
                     HNSAEAALATPRGPANHLAEIIKRTMKKLGIETELAFNLEFNHTGSTENHPLHIHGAF
                     CIPDERVEEVSEALRKALALGYRQRYKNLAVHIEKPWNVHWWAAYCIKEYGITASRLE
                     AEQGRKSRPEYVTQTLTQAAKAFYEDISAWLNT"
     gene            complement(652658..655072)
                     /locus_tag="PPUBIRD1_RS02930"
                     /old_locus_tag="PPUBIRD1_0581"
     CDS             complement(652658..655072)
                     /locus_tag="PPUBIRD1_RS02930"
                     /old_locus_tag="PPUBIRD1_0581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589526.1"
                     /translation="MSNSELRLAALSKLVDIKSEAVDQRLSDEFNRIEASLQQSSDYD
                     ELAGSLKVLAVLVPRFHMVTLPLLQAFVRSVPNRTLTQDGSPISGSRIRYRSTESLTR
                     EAIEVAEKVRYLHTEQVVDFLLEMSQVADKETNAKADRALESLATFDLDVFYGDSPLG
                     AEPQARMVAHLDGLRNDALMANANVILRVLAIVLSPTMEGTSWSYQSVTIRRGSIASY
                     GGVADMRLAAICLTQRIFGLDTSVEHRKQALLTLNSATRREGPVDHAETSAMFERDAI
                     MVLEFMLSLVGTEALPLVQKIEHLAYWDYYHGASQAIKNKALEIRDAIAEHAEYQVYK
                     QLIGFEGIFGDWEELKRSEQAWDYSDNKRRAAARQYLSEINEASYTMWRDRILEFSKT
                     RSNDLAMFPVYYDFLESIGKERSDLAMELLIDHEEVMAPFLIALMRGLWASTTPNHLE
                     AVVKRWIEAGKHLTSIAKSLYKVGAPRLEVLTEVAGRAAALDDKGAMIQVMGVAASLY
                     AEGEMGAKSIFMHTLRELVKRDDASWASEIWFSRDFKALLSTMEQSERAEVLASLTAL
                     PELDYQAEDILYEIGKHDLQALIDFLIGRLKHARMLAKRKRETNDSSQDRFEAIPFQL
                     TKLNELLAQAPAALLNAIRADFDSEDRYMFSYRGARTVKSAFPELRTTLEELMLGYVK
                     TGNDNDIEFVIGILRIYEGSPAILNVCREIIKAVPEHSRVWNEVAAAIESTGVVGGEY
                     GMVEAYNRRLEQVSCWTNDENERVRSFAIWLTEGLQSVIEQERQRVDRSIELRKYQYG
                     SDPKED"
     gene            complement(655069..655998)
                     /locus_tag="PPUBIRD1_RS02935"
                     /old_locus_tag="PPUBIRD1_0582"
     CDS             complement(655069..655998)
                     /locus_tag="PPUBIRD1_RS02935"
                     /old_locus_tag="PPUBIRD1_0582"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589527.1"
                     /translation="MDVFHLIIDTSMLRRLHFQHPDFNRLLQQSQMGKLKIYIPRIVL
                     EEERTAQLEKHLQMIEEIRTRYAKLQRGMQGLLVQGLAEAHIELWSAVDVEQNSRATF
                     SHFVVLNKIEVIEISKDQAANAWDRYFKVEPPFNPKEEREARRKDIPDSWILEAGIEV
                     KARNGQHCALVGDNKLTNAFEKEGLRVYQDVQTLLDDIEQATAIAPIQRPIVEEAPVP
                     LDQLRSLEFKDLDVIILGLIETLDIPHKEALFSALEAAGFKRDIAEHEARTLVLSGRL
                     KDADTHFIPTSRALARQAAATDTVTNVLLRIMG"
     gene            complement(656269..656673)
                     /locus_tag="PPUBIRD1_RS02940"
                     /old_locus_tag="PPUBIRD1_0583"
     CDS             complement(656269..656673)
                     /locus_tag="PPUBIRD1_RS02940"
                     /old_locus_tag="PPUBIRD1_0583"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589528.1"
                     /translation="MNKIAALAVSSMLLASVALAEVKEDCSAQLNGAVRCEFTNTGKK
                     KDSACVVVEMVRLYNADVYSRSSLGGKGAVLSSDKICSGLVEPQDVRERASSVSWAVN
                     GLPMTPYQFCDSNNPWFKAPENCLMKTTTVPD"
     gene            656773..657003
                     /locus_tag="PPUBIRD1_RS02945"
     CDS             656773..657003
                     /locus_tag="PPUBIRD1_RS02945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016782980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041166832.1"
                     /translation="MPTKPSQCPLVAVFAANVRRIRLELKLSQEELAERAGVHRTYVG
                     MLERGEKNTTIYNIEKVAEALGVEPFVLLQKQ"
     gene            complement(657134..659215)
                     /locus_tag="PPUBIRD1_RS02950"
                     /old_locus_tag="PPUBIRD1_0585"
     CDS             complement(657134..659215)
                     /locus_tag="PPUBIRD1_RS02950"
                     /old_locus_tag="PPUBIRD1_0585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589529.1"
                     /translation="MDLTTFRQIVDRSPPAIMACQENLQHLYDYVGLEHGSSYTRSAV
                     SNALYARIRDCFTSGHAEVWRACQSLRTDLIREHTLLNAPLDPYFEVLEHLRDAVRTD
                     DNSRTTIEGDWDTAVRTAFDHVQIQSWGSENRRMTYAREFMVAEAARALRDAGYSILF
                     EPGKLGFGPESETALVANIEQLVSSMGGVNVARRIFADISKDFDPEQQRYHIVRRISA
                     TGEGQPQVPWGYLLQLAAKHIQGRKPYITTDAHWHKLRAFAQAYAAVINVQPYAPTFY
                     GTMDAVDLVPYLQEMALYDTLFRIPQMRPSDVVKIARGMLGWFDLSEPTKGGWSVNQV
                     LEVIGYLLSPSLDARGPIFITETEIRRGCPDIPPNVVAKILDDVLSHPCTGANKNFSL
                     PTDAPTSAQKSSGQDFFLRPLIRSSGRQFILLDRSVCAPACLEALLTQLRADMKDLDE
                     KIGSSIEDFLKSEFASHGICSKGGDYDSGGKHGECDLALETDETIIFAEIKKKPLTRK
                     AKAGSDAHILLDLAGSLLAAQAQAGWHEVRLRKDGHLHLESKGAISCIDLNEREVERV
                     AVTLLDFGSFQDRILLKQFLEGTLNATFTPSDANLKKGFQRINEALAEIREQLIELRS
                     AGSDVRQPFFHCWFLSVPQLLVLLDNVTDSAGFRQALWSCRHVATGSSDLYFDLSYMK
                     RLRRETTASIN"
     gene            complement(659623..660324)
                     /locus_tag="PPUBIRD1_RS02955"
                     /old_locus_tag="PPUBIRD1_0586"
     CDS             complement(659623..660324)
                     /locus_tag="PPUBIRD1_RS02955"
                     /old_locus_tag="PPUBIRD1_0586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589530.1"
                     /translation="MNTSGDRLRALLQECGLTPSDFAAQRSVTAQHVNNWFKRGVPLA
                     RLDELADLFCVHRRWLRTGEGPKHPNPLLRNGLPRPAPANPLTPLTEHRGRVLKVPYY
                     EVRNGLLSPVGSKHLRLPAKALKGLGVQAGNAICLAMPTSNMLPLIPLQATLAIDLGM
                     TQVVEGETYALLQNGMLRVNNLSLGPHDTLYLHSHDRRNYTVERYTAAQRQAQGLEIL
                     GWVFHWSHFRQQRPS"
     gene            complement(660511..661038)
                     /locus_tag="PPUBIRD1_RS02960"
                     /old_locus_tag="PPUBIRD1_0587"
     CDS             complement(660511..661038)
                     /locus_tag="PPUBIRD1_RS02960"
                     /old_locus_tag="PPUBIRD1_0587"
                     /EC_number="3.6.1.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003444254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_003255365.1"
                     /translation="MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDTLFVDR
                     FMATPMFYPANYGFIPNTLADDGDPLDVLVVTPYPVAPGSVIRARPVGVLNMTDDGGG
                     DAKVIAVPHDKLSQLYVDVKEYTDLPALLIQQIEHFFANYKDLEKGKWVKIEGWEGAD
                     AARAAITKSVAAYKG"
     gene            complement(661131..661946)
                     /locus_tag="PPUBIRD1_RS02965"
                     /old_locus_tag="PPUBIRD1_0588"
     CDS             complement(661131..661946)
                     /locus_tag="PPUBIRD1_RS02965"
                     /old_locus_tag="PPUBIRD1_0588"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589531.1"
                     /translation="MWSFSAWRRKRTLARYPITPQQWQTVRERLPMLDGISDAEDRWL
                     REACVLFLLDKHLTCLPGVELDDEQRLMLAAQAQLPLLHLGELNWYQGFHEIILYPDD
                     FKSPQRHRDASGVEHVWDGEHSGEAWQQGPIILAWNGVQASGGWEAYNLVIHELAHKL
                     DMLNGDANGLPPLHSSMPVDEWATAMQQAYDDLNQQLDANPDAETAIDPYAAENPAEF
                     FAVTSEYFFSAPDLLHQAYPQVYHQLSLFYRQDPLARLCRLQAEHPEYRESHA"
     gene            complement(661967..662614)
                     /locus_tag="PPUBIRD1_RS02970"
                     /old_locus_tag="PPUBIRD1_0589"
     CDS             complement(661967..662614)
                     /locus_tag="PPUBIRD1_RS02970"
                     /old_locus_tag="PPUBIRD1_0589"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016393447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589532.1"
                     /translation="MDFNPLDLILHLDAYLDLLVTNYGPWIYAILFTVIFCETGLVVM
                     PFLPGDSLLFIAGAVAAGGGMDPVLLAGLLMAAAILGDSTNYVIGRTAGERLFNNPNS
                     KIFRRDYLQRTHDFYERHGGKTVTMARFLPILRTFAPFVAGIAHMHYPRFLGFSIAGS
                     LLWVGGLVTLGYFFGNVPFIKQHLSLMVVGIIILSLVPMILGLLRGRLGRTAKAH"
     gene            complement(662849..663307)
                     /locus_tag="PPUBIRD1_RS02975"
                     /old_locus_tag="PPUBIRD1_0590"
     CDS             complement(662849..663307)
                     /locus_tag="PPUBIRD1_RS02975"
                     /old_locus_tag="PPUBIRD1_0590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="WP_014589533.1"
                     /translation="MRIIKATLEHLDLLTPLFVKYREFYGQLPYPDSSRSFLEKRLKR
                     DESVIYLALPDDDDGKLLGFCQLYPSYSSLSLKRVWILNDIYVAEDSRRMLVADHLIR
                     EAKKMAKETNAVRMRVSTSANNEVAHKTYESIGFREDTEFKSYILHISQD"
     gene            complement(663415..664233)
                     /locus_tag="PPUBIRD1_RS02980"
                     /old_locus_tag="PPUBIRD1_0591"
     CDS             complement(663415..664233)
                     /locus_tag="PPUBIRD1_RS02980"
                     /old_locus_tag="PPUBIRD1_0591"
                     /EC_number="4.3.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011532003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia-lyase small subunit"
                     /protein_id="WP_014589534.1"
                     /translation="MDHRTPTPDNPWLALRNLTPARIALGRTGTSLPTGAQLDFQFAH
                     AQARDAVHLAFDHAGLASQLSDRGRESLVLHSAASDRHQYLQRPDLGRRLNEDSIATL
                     RQHAQANPGGVDLAIVVADGLSALAVHRHTLPFLTRFDEQAAADGWTSAPVVLVQQGR
                     VAVADEVGELLGARMTVMLIGERPGLSSPDSLGLYFTYAPKVGLTDAYRNCISNIRLE
                     GLSYGMAAHRLLYLMREACRRQLSGVNLKDEAEVHSLENEDSANQKGNFLLGKG"
     gene            complement(664242..665636)
                     /locus_tag="PPUBIRD1_RS02985"
                     /old_locus_tag="PPUBIRD1_0592"
     CDS             complement(664242..665636)
                     /locus_tag="PPUBIRD1_RS02985"
                     /old_locus_tag="PPUBIRD1_0592"
                     /EC_number="4.3.1.7"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_252713.1"
                     /note="with EutC catalyzes the formation of acetaldehyde
                     and ammonia from ethanolamine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia lyase large subunit"
                     /protein_id="WP_014589535.1"
                     /translation="MASFVHTVGHLVYRFDSLKEVMAKASPARSGDCLAGVAASNDGE
                     RVAAQMALANIPLTHFLNEALIPYEADEVTRLIIDTHDAQAFAPVSHLTVGGLRDWLL
                     SEEADESSLRALAPGLTPEMAAAVSKIMRVQDLVLVAQKIRVVTRFRGTMGLRGRLST
                     RLQPNHPTDEPAGIAASILDGLLYGNGDAMIGINPATDSIASICALLEMLDAIIQRYD
                     IPTQSCVLTHVTTSIEAINRGVPLDLVFQSIAGTEAANAGFGINLNVLQEGYEAGLSL
                     KRGTLGQNLMYFETGQGSALSANAHHGVDQQTCETRAYAVARHFKPFLVNTVVGFIGP
                     EYLYNGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGVAGINF
                     IMGIPGSDDIMLNYQTTSFHDALYARQTLGLKPGPEFEAWLARTGIFTQADGRVRFGD
                     NLPPAFRQALAQLA"
     gene            complement(665683..667131)
                     /gene="eat"
                     /locus_tag="PPUBIRD1_RS02990"
                     /old_locus_tag="PPUBIRD1_0593"
     CDS             complement(665683..667131)
                     /gene="eat"
                     /locus_tag="PPUBIRD1_RS02990"
                     /old_locus_tag="PPUBIRD1_0593"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015268800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine permease"
                     /protein_id="WP_014589536.1"
                     /translation="MPSEHSAGSPAGSSVDFEKVGSDYFQQRELKKGAAGWVLLVGLG
                     VAYVISGDYAGWNFGLAQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGF
                     ARSAFGPWGGFLTGTAILIEYAIAPAAIAVFIGAYCQSLFGIGGWMIYLAFYIVFIGI
                     HIFGVGEALKLMFIITAIAAIALAVFLIGMVPHFDAANLFDIAKTDAVGASSFLPFGY
                     VGVWAAIPYAIWFFLAVEGVPLAAEETKNPKRDLPRGLIGAMLVLLAFALLILVVGPG
                     GAGSEALKASGNPLVEALSKAYGGSTWMGGFVNLVGLAGLIASFFSIIYAYSRQIFAL
                     SRAGYLPRKLSETNKSKAPVMALVIPGIIGFALSLTGQGDLLILVAVFGATLSYVLMM
                     AAHITLRIRRPKMERPYRTPGGIFTSGLALVLACIAVVAGFLVDPRVVIGAAVIYAVL
                     IAYFAFYSRHHLVAGTPEEEFAAIQKAEEALH"
     gene            complement(667358..668878)
                     /locus_tag="PPUBIRD1_RS02995"
                     /old_locus_tag="PPUBIRD1_0594"
     CDS             complement(667358..668878)
                     /locus_tag="PPUBIRD1_RS02995"
                     /old_locus_tag="PPUBIRD1_0594"
                     /EC_number="1.2.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003176316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_014589537.1"
                     /translation="MRYAHPGTEGAKVSFKSRYGNYIGGEFVTPVKGQYFENTSPVNG
                     KLIAEFPRSTAEDIEKALDAAHAAADAWGRTSVQDRSNVLLKIADRIEQNLELLAITE
                     TWDNGKPIRETLNADIPLAVDHFRYFAGCIRAQEGGAAEINEGTVAYHIHEPLGVVGQ
                     IIPWNFPILMAAWKLAPALAAGNCVVLKPAEQTPLGITVLLEVIGDLLPPGVLNVVQG
                     YGREAGEALATSKRIAKIAFTGSTPVGSHIMKCAAENIIPSTVELGGKSPNVYFEDIM
                     QAEPSFIEKAAEGMVLAFFNQGEVCTCPSRALVQESIYPQFMEVVMKKVLQIKRGDPL
                     DTDTMVGAQASQQQFEKILSYLQIAQEEGAELLTGGKVEKLEGALATGYYIQPTLLKG
                     NNKMRVFQEEIFGPVVSVTTFKDEAEALAIANDTEFGLGAGVWTRDINRAYRMGRGIK
                     AGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNLLVSYDINPLGFF"
     gene            669133..671145
                     /locus_tag="PPUBIRD1_RS03000"
                     /old_locus_tag="PPUBIRD1_0595"
     CDS             669133..671145
                     /locus_tag="PPUBIRD1_RS03000"
                     /old_locus_tag="PPUBIRD1_0595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004577013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_014589538.1"
                     /translation="MQSNHFTRHARQVHSVAHGGAGEGGSDPSIARSWLRCLEDYHLD
                     PTVIEAPVVLEHGRLLESRERLHQVLQIADHEMNSLHQQLSGAGHAVLLTDARGVILN
                     CVSAPAERRSFERAGLWLGADWSEAREGTNGIGTCLVERQALTIHQNEHFRGRHTGLT
                     CSASPVFDPHGDLLAVLDVSSARPDVSRQSQFHTMALVNLSAKMIESCYFLRHFEQQW
                     LLRFHLQAESVGLFSEGLLAFDGDGRICAANQSALNLLGTVRGGVLGKPLECFFACSH
                     DEMFSRATPGGSAVWPLRTLDGRQVFASLRGQARAPVWSVPAAHPRPAGEVEPLVCLL
                     DPALQNDFRRSVRVFERNVPLLLRGETGCGKEAFAQVVHQASERRGKPFVAINCASIP
                     ESLIESELFGYRGGSFTGARKEGMRGKLLQADGGTLLLDEIGDMPLALQTRLLRVLEE
                     RQVVPIGGEPQAVDVRIVSATHRDLLERVEQGSFREDLYYRLNGLEVALPAVRERSDK
                     AQLLDFLLRQETQGQWIDIEPRARQALLAFNWPGNVRQMRNVLRTLVALCEDARITFA
                     DLPAVIRTSPPPVGAGEPTMSDQAIEGEGVALVRGQARSHRSGGAAEIEGESVGTEVL
                     LDAERQALKEVLEAKHWHLTRVAEHLGISRNTLYRKLRKHGITRGD"
     gene            671212..672561
                     /gene="mpl"
                     /locus_tag="PPUBIRD1_RS03005"
                     /old_locus_tag="PPUBIRD1_0596"
     CDS             671212..672561
                     /gene="mpl"
                     /locus_tag="PPUBIRD1_RS03005"
                     /old_locus_tag="PPUBIRD1_0596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_014589539.1"
                     /translation="MHIHILGICGTFMGSLAVLAKELGHRVTGSDANVYPPMSTQLEA
                     QGIELTQGYDPAQLDPAPDLVVIGNAMSRGNPAVEYVLNKGLPYVSGPQWLADHVLQG
                     RWVLAVAGTHGKTTTSSMLAWVLEHAGMSPGFLIGGVPQNFSVSARLGDTPFFVVEAD
                     EYDSAFFDKRSKFVHYHPRTAILNNLEFDHADIFPDLASIERQFHHLVRTIPGEGLVI
                     HPTTEQALERVIGMGCWTPVQTTGEGGQWQARLLSPDGSRFEVLFEGEVQGVVDWALT
                     GQHNVANALATLAAARHVGVVPAMGIEGLSAFKSVKRRMEKVAEVQGVTIYDDFAHHP
                     TAIATTLDGLRKRVGEAPVIAVIEPRSNSMKLGAHRDGLPESVNDADQVIWYAPANLG
                     WDLAGTAAQCKVPSVVADSLEAIIERIKGQARPGTHVVIMSNGGFGGLHGKLAEALK"
     gene            672558..673187
                     /locus_tag="PPUBIRD1_RS03010"
                     /old_locus_tag="PPUBIRD1_0597"
     CDS             672558..673187
                     /locus_tag="PPUBIRD1_RS03010"
                     /old_locus_tag="PPUBIRD1_0597"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic acid decarboxylase"
                     /protein_id="WP_003255348.1"
                     /translation="MNGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQL
                     VMATETDVVLPAKPQAMQAFLTEYTGAADGQIRVYGKEDWMSPVASGSGAPAAMVVVP
                     CSTGTLSAIATGACNNLIERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAV
                     ILPAAPGFYHQPQTIDDLVDFVVARILNLLNIPQDMLPRWGEHHFGVDD"
     gene            673184..673471
                     /locus_tag="PPUBIRD1_RS03015"
                     /old_locus_tag="PPUBIRD1_0598"
     CDS             673184..673471
                     /locus_tag="PPUBIRD1_RS03015"
                     /old_locus_tag="PPUBIRD1_0598"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YceK/YidQ family lipoprotein"
                     /protein_id="WP_003255347.1"
                     /translation="MKRALAGLLALVMLGGCATVRTLDANKPGAPVVYAGTRLDLYVI
                     NGGCCPRDHYGADAPAYPRLDLPGSMLLDTLLLPLSLLTAAGIGFQASGGL"
     gene            complement(673498..674142)
                     /locus_tag="PPUBIRD1_RS03020"
                     /old_locus_tag="PPUBIRD1_0599"
     CDS             complement(673498..674142)
                     /locus_tag="PPUBIRD1_RS03020"
                     /old_locus_tag="PPUBIRD1_0599"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014589540.1"
                     /translation="MYLTPQHVLLAGATGLTGEHLLDRLLNEPTITRVLAPTRRPLAE
                     HPHLENPVGDPAVFLPQLAGRVDIAYCCLGTTLKQAGSESAFRAVDLDMVVAFSKRAR
                     EMGARHLLVVSAVGADPKSSIFYNRVKGEMEEALKAQDWPQLTIVRPSFLLGERLEPR
                     LTEQLVAPFSRFIPGKYRGIEACTLARALWRLALEEEDGVRVVESDELRRLGRI"
     gene            complement(674170..675903)
                     /locus_tag="PPUBIRD1_RS03025"
                     /old_locus_tag="PPUBIRD1_0600"
     CDS             complement(674170..675903)
                     /locus_tag="PPUBIRD1_RS03025"
                     /old_locus_tag="PPUBIRD1_0600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008098332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C13"
                     /protein_id="WP_014589541.1"
                     /translation="MRPLLPITLVLLLAACGDGESLLPPDARLPDGGRYRGQVVDGLL
                     QGEGRIDYPNGSWYAGSFKDGQWHGQGEWHGQNGEVYRGQFAEGLFQGLGELTTPGSH
                     YSGTFRHGRRDGEGTLKQADQTYRGQFKDDLYDGAGQLELADGSRYQGLFAKGKPNGA
                     GVRSDASGNQFSGHFVNGQLQGAGTYDSVDGEQYIGEFKDNRLEGRGRYENADGDVWI
                     GEFKDGSLIGEGELLGSDGSHYRGEFADWRLSGQGSLQLADGSKYIGGFLNDAYHGHG
                     RLILPSGKVESGTWANGVRVRDQNGKLLPDPLDLALLNQGRLLDEALARVPRSAPPIQ
                     LYSLVVAGDGQQSVFLREADYVSNMLKVRFGARGQVTLVNHRDHMATRPMATRENLSR
                     AAATLAERSGPEDLVFIYLTSHGSQDHQLVLDQPRLQLADLAADELATALAPLKDRDK
                     VIVISACYSGGYIAPLKDERTVIMTAARADRVSFGCSEEADFTYFGDALFAEALNQTD
                     DLKQAFELARASVAEREQREGFEASEPQLWAPPAVLEHWHRLRQQQAEEALRNATQAN
                     VREQAKMPGTH"
     gene            complement(676111..677199)
                     /locus_tag="PPUBIRD1_RS03030"
                     /old_locus_tag="PPUBIRD1_0602"
     CDS             complement(676111..677199)
                     /locus_tag="PPUBIRD1_RS03030"
                     /old_locus_tag="PPUBIRD1_0602"
                     /EC_number="1.1.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="butanediol dehydrogenase"
                     /protein_id="WP_014589542.1"
                     /translation="MNGLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCG
                     ICGSDLHEYVAGPVFIPVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVA
                     ADACQHCGTCYYCTHGLYNICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAG
                     ALIEPLAVGMHAVKKAGSLLGQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARK
                     AKAKEVGANVVLDPSQCDALAEIRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKC
                     VLVGIFEEPSEFNFFELVSTEKQVLGALAYNGEFADVIAFIADGRLDIRPLVTGRIGL
                     EQIVELGFEELVNNKEENVKIIVSPGVR"
     gene            complement(677228..678334)
                     /locus_tag="PPUBIRD1_RS03035"
                     /old_locus_tag="PPUBIRD1_0603"
     CDS             complement(677228..678334)
                     /locus_tag="PPUBIRD1_RS03035"
                     /old_locus_tag="PPUBIRD1_0603"
                     /EC_number="2.3.1.12"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_252841.1"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin dehydrogenase
                     dihydrolipoyllysine-residue acetyltransferase subunit"
                     /protein_id="WP_014589543.1"
                     /translation="MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETD
                     KISSSVEAPFSGVLRRQVAKPDETLPVGALLAVVVEGEAEEAEIDAVVQRFQAEFVAE
                     GGSDQSQGPAPQKAEVGGRLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERR
                     VIALDLPGHGESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARL
                     APQRVASLSLVASAGLGEAINGQYLQGFVTAANRNALKPQMVQLFADPALVTRQMLED
                     MLKFKRLEGVDQALQQLAGALADGDRQRHDLRGVLGNHPALVVWGGRDAIIPASHAEG
                     LEAEVQVLPEAGHMVQMEAAEQVNQQLLAFLRKH"
     gene            complement(678331..679353)
                     /locus_tag="PPUBIRD1_RS03040"
                     /old_locus_tag="PPUBIRD1_0604"
     CDS             complement(678331..679353)
                     /locus_tag="PPUBIRD1_RS03040"
                     /old_locus_tag="PPUBIRD1_0604"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_252840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoacid dehydrogenase subunit beta"
                     /protein_id="WP_010951829.1"
                     /translation="MARKISYQQAINEALAQEMRRDSTVFIIGEDVAGGAGAPGEDDA
                     WGGVLGVTKGLYHQFPGRVLDAPLSEIGYVGAAVGAATQGLRPVCELMFVDFAGCCLD
                     QILNQAAKFRYMFGGKAVTPLVMRTMYGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSS
                     PYDAKGLLIQAIRDNDPVIFCEHKLLYSMQGEVPEEVYTVPFGEANFLRDGDDVTLVT
                     YGRMVHVALEAANNLARQGIDCEVLDLRTTSPLDEDSILESVEKTGRLVVIDEANPRC
                     SMATDISALVAQKAFGALKGPIEMVTAPHTPVPFSDALEDLYIPDAAKIEAAVRKVIE
                     AARSAA"
     gene            complement(679387..680364)
                     /locus_tag="PPUBIRD1_RS03045"
                     /old_locus_tag="PPUBIRD1_0605"
     CDS             complement(679387..680364)
                     /locus_tag="PPUBIRD1_RS03045"
                     /old_locus_tag="PPUBIRD1_0605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019097910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit alpha"
                     /protein_id="WP_003255338.1"
                     /translation="MSNQLSTDQLLHAYEVMRTIRAFEERLHVEFATGEIPGFVHLYA
                     GEEASAAGVMAHLRDSDCIASTHRGHGHCIAKGVDVYGMMAEIYGKKTGVCGGKGGSM
                     HIADLEKGMLGANGIVGAGAPLVAGAALAAKLKGRDDVSVAFFGDGASNEGAVFEAMN
                     MASIMNLPCIFVAENNGYAEATASNWSVACDHIADRAAGFGMPGVTIDGFDFFAVYEA
                     AGAAIERARSGQGPSLIEVKLSRYYGHFEGDAQTYRAPDEVKNLRESRDCLMQFRNKT
                     TRAGLLTAEQLDAIDARVEDLIEDAVRRAKSDPKPQPADLLTDVYVAYP"
     gene            complement(680387..681442)
                     /locus_tag="PPUBIRD1_RS03050"
                     /old_locus_tag="PPUBIRD1_0606"
     CDS             complement(680387..681442)
                     /locus_tag="PPUBIRD1_RS03050"
                     /old_locus_tag="PPUBIRD1_0606"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014859888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-NAD kinase"
                     /protein_id="WP_014589544.1"
                     /translation="MPLPAPIVGIIANPASGRDLRRLTANAGLYSSTDKASAIQRLLA
                     AFGATGIGQVLLPIDMTGIAAAVLKASQGPGARDQHWPAIEILDLPLSQTVADTRLAT
                     RRMVERGVAMIAVLGGDGTHKAVAAEAGDVPLLTLSTGTNNAFPELREATSAGLAGGL
                     LASGRVPASIGLRRNKRLLVNVPEQQLIEWALVEVAVSPQRFIGARALSRSEDLCEVF
                     ACFAEPHAIGLSALCGLWCPVSRQDPHGAWVRLAPDAEQALLAPLAPGLLQACGITAC
                     GPLTPGVAQRLSLASGTLALDGEREIEFAEHDTPTITLDHQGPLSVDVEAVLAHAARH
                     HLLAVPRGHRLHPANPC"
     gene            681726..683579
                     /locus_tag="PPUBIRD1_RS03055"
                     /old_locus_tag="PPUBIRD1_0607"
     CDS             681726..683579
                     /locus_tag="PPUBIRD1_RS03055"
                     /old_locus_tag="PPUBIRD1_0607"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sigma-54-dependent Fis family transcriptional
                     regulator"
                     /protein_id="WP_019438039.1"
                     /translation="MLAANSRAHVDCVSRVLKNADRLPQAPVPPLILDSWRRSMDVYR
                     LDPGSQQGPRILSQSLLNECRERAELFLRIASDAVARLHERVRGADYCVLLTDAQGRT
                     IDYRVESAIRNDCRKAGLYLGTCWSEGEEGTCGVAAVLTSKAPVTVHKRDHFRAAFIG
                     LTCTAAPVFDPLGELLGVVDVSALQSPDDRRSQHLIRQLVEQTAREIENAFFMHSAQG
                     HWVMRAHGTPGYVESQPDYLLAWDADGRLQAINSLARQRLVERLGRLPEHIGELFDID
                     QLRRVSASSAQRLPGLGGLYGRVSAPQQRQRAQPLRQAQDTRIEQHLRLATRVKDCNL
                     AVLVLGETGAGKEVFARQLHQQSQRCDGPFVTLNCAAIPETLIESELFGYVAGAFTGA
                     SSKGMQGLLQQADGGTLFLDEIGDMPLNLQTRLLRVLAEGEVAPLGAARRERVDIQVI
                     CATHRDLAAMVEDGRFREDLYFRLANARFELPPLRERDDRLGLIHQLLDEEAAACGVD
                     VVLADDALQALLVYRWPGNLRQLRQVLRYACAVSEGGQVRLQDLPQEVRGEAVGSAES
                     GVSCPARQLLLDALIRHRWKPADAARALGISRATLYRRVHEHRIDMPRMKG"
     gene            complement(683670..685025)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_RS03060"
                     /old_locus_tag="PPUBIRD1_0608"
     CDS             complement(683670..685025)
                     /gene="accC"
                     /locus_tag="PPUBIRD1_RS03060"
                     /old_locus_tag="PPUBIRD1_0608"
                     /EC_number="6.4.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007914602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="WP_003255333.1"
                     /translation="MSGKLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMH
                     LGLADESVCIGPASSKDSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSG
                     FAFIGPKADTIRLMGDKVSAKDAMIKSGVPTVPGSDGPLPEDEEVALAIARDVGYPVI
                     IKAAGGGGGRGMRVVHKEEDLISSAKLTRTEAGAAFGNPMVYLEKFLTNPRHVEVQVL
                     SDGQGNAIHLGDRDCSLQRRHQKVLEEAPAPGIDEKARQEVFKRCVDACIEIGYRGAG
                     TFEFLYENGRFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNKLSFRQEDVVIR
                     GHSLECRINAEDPKKFIPSPGKVKHFHAPGGNGVRVDSHLYSGYSVPPNYDSLIGKLI
                     TYGKDRDEAMARMRNALDEIVVDGIKTNIPLHRDLVRDEGFCKGGVNIHYLEHKLANQ
                     E"
     gene            complement(685043..685504)
                     /gene="accB"
                     /locus_tag="PPUBIRD1_RS03065"
                     /old_locus_tag="PPUBIRD1_0609"
     CDS             complement(685043..685504)
                     /gene="accB"
                     /locus_tag="PPUBIRD1_RS03065"
                     /old_locus_tag="PPUBIRD1_0609"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009398721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit"
                     /protein_id="WP_014589546.1"
                     /translation="MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTPAAQQF
                     YAPAPMAAAPAAAPVAAAAPAAEAAAAAPALKGTVVRSPMVGTFYRKPSPTSPNFAEV
                     GQSVKKGDTLCIVEAMKMMNHIEADVGGVIDAILVEDGQPVEFDQPLFTIV"
     gene            complement(685604..686059)
                     /gene="aroQ"
                     /locus_tag="PPUBIRD1_RS03070"
                     /old_locus_tag="PPUBIRD1_0610"
     CDS             complement(685604..686059)
                     /gene="aroQ"
                     /locus_tag="PPUBIRD1_RS03070"
                     /old_locus_tag="PPUBIRD1_0610"
                     /EC_number="4.2.1.10"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase 1"
                     /protein_id="WP_010951834.1"
                     /translation="MATLLVLHGPNLNLLGTREPGHYGAVTLAQINQDLEQRARAAGH
                     HLLYLQSNAEYELIDRIHAARNEGVDFILINPAAFTHTSVALRDALLAVSIPFIEVHL
                     SNVHKREPFRHHSYFSDVAVGVICGLGASGYRLALESALEQLAANAQPK"
     gene            complement(686239..688011)
                     /locus_tag="PPUBIRD1_RS03075"
                     /old_locus_tag="PPUBIRD1_0611"
     CDS             complement(686239..688011)
                     /locus_tag="PPUBIRD1_RS03075"
                     /old_locus_tag="PPUBIRD1_0611"
                     /EC_number="1.8.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051084.1"
                     /note="thiol:disulfide interchange protein precursor;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein-disulfide reductase DsbD"
                     /protein_id="WP_014589547.1"
                     /translation="MRRLFFMLFLLLASPAFAAGLLDNRPSATLGAASLANNADFLPV
                     HEAFKLNLVQADAQTIKLRFVATDGYYLYRHRFQFRTEPADITLGTPNIPKGEAKHDE
                     FFGDVEVYHGVLDIELPRKDPRAFTLLVGYQGCADKGLCYPPETARLSIDGEGAANTP
                     ATGEHGWNWKSLLLFFLAGVGLTFTPCVLPMLPILSGVVLRGQVGGVRGLALSLAYVL
                     PMAASFAVLGALMGLFGASLNLQARLQSAWVLVPFALFFVVFALAMFGLFELRLPQAL
                     SNRLNNVANHTRGGSLLGAAVLGVLSSLLVSPCVSAPLAGALLYISASGDALGGALKL
                     FTLGLGMGAPLLLVATGGAAWLPKSGPWMNTVKNAIGVLLLGLAIGLLSRVLPGPVTL
                     LLVGFLAAGVALFLGALEFVVKTTAQRLAQLLGLALLVYALACWYGALTGQGDPLRPL
                     PGASLAASGSLPAAKADAWQTITTPDALDAALAQAKAAGQPVLLDWYADWCISCKVIE
                     HEVLNAPQVQTQLAGFKLLRFDITDSNAEQRTLLDRYQLFGPPALLFFAANGSEITAD
                     RVIGEINAGEFAQILTRVRGKVGL"
     gene            complement(688200..690161)
                     /locus_tag="PPUBIRD1_RS03080"
                     /old_locus_tag="PPUBIRD1_0612"
     CDS             complement(688200..690161)
                     /locus_tag="PPUBIRD1_RS03080"
                     /old_locus_tag="PPUBIRD1_0612"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009685764.1"
                     /note="methyl-accepting chemotaxis sensory transducer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014589548.1"
                     /translation="MRLKWLTNFNTLLLVTVCIALGVTLWWSQRALERPYQLMERYLG
                     LSQQFQNQAARNIQAYLGSGDALRQAAAMEANQQLQAALTDWPVELAEKLRPSLDSLQ
                     AFTANELLAAGKLAGDPQALLLQAERELGANFEQMASYARDSGNAEANRYLLPLLDAT
                     LHLGRLSLARDKLVSSGRPELADEVERELQLIRAQAQTVDGLPLLGVTRTAESGADDF
                     AAMMGLESQSSAQQEDIAVGLKRELQSLLNRYPAELQRTREQIERRAELAATTGQRLE
                     AVQQAIAALEPEVRGQHAKIAAEVRIIQGLMIGLILLIALLIDTLQRRLARTLTGLAP
                     ALSRWAEGDFAQAIALGKTNRELHDIQESLNRLRQYLVELVGTIRHNAEQVAGSSHAL
                     AGMSAALHGGAERQAGDTGQIRDALGELEATIQQVAGDASAAAEASRDAGRAVEQGQA
                     VIGQSLSGLRELVDEVQGNARMIEQLAEESATIGGVLTVIRAIAEQTNLLALNAAIEA
                     ARAGEMGRGFAVVADEVRSLAQRTTGATGEIQALIDRLQQAARSSVAGMRAQLEHAEA
                     TANQAQAADGALDEIVCAIRTIADTAVRIADVTAQQSGAVSEIRDHSERIHALGEDNL
                     QRIGEGREQGEQLLSLGGELNRAVRAFRV"
     gene            complement(690308..691663)
                     /locus_tag="PPUBIRD1_RS03085"
                     /old_locus_tag="PPUBIRD1_0613"
     CDS             complement(690308..691663)
                     /locus_tag="PPUBIRD1_RS03085"
                     /old_locus_tag="PPUBIRD1_0613"
                     /EC_number="2.7.7.65"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589549.1"
                     /translation="MSQAVEPSPQCPVQQLTRNGLRKDDPLDQLLLPVRKPVYILLQD
                     HERAQRLAQQLEFFGLVVQALPSAAAFLASISEYPPSAIIMDVDFTGAGLGLLLAAQV
                     QQGLARAIPLLFFSHHEADTPTRLAAVRAGGQDFLTGSLEASSLLEKVELLTNTAPHD
                     PLRVLIIDDSRTQAMYTERVLAGAGMLTRSLTDPIRTMAELADFQPDLIILDLYMPAC
                     TGPELAKVIRHSDRYVSVPIIYLSAEDDLDKQLDAMSEGGDDFLTKPFRSRHLITTVR
                     NRAARARHLKARMVRDSLTGLYNHTHILQLLEDCSFRARREQQPLSFAMLDIDHFKKI
                     NDRHGHPMGDRVIKSLALFLKQRLRKTDFIGRYGGEEFAIVMPNTALDAAHKVLDEIR
                     RRFAEILYPAQPRDLQCTFSAGVVQLDEGLDALTMASAADEALYRAKHAGRNCVVRVE
                     P"
     gene            691912..692979
                     /locus_tag="PPUBIRD1_RS03090"
                     /old_locus_tag="PPUBIRD1_0614"
     CDS             691912..692979
                     /locus_tag="PPUBIRD1_RS03090"
                     /old_locus_tag="PPUBIRD1_0614"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009041985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589550.1"
                     /translation="MLDWKNREAKAEPRERVDGRGAAARSYLGGLWSRALGTLIGLYL
                     LVCIGLGWYWSQEPALFPVQQNAQAAAERAGQQMVVGYTTVETLKTVAGTLLNKPGGY
                     ISNDRFPPGLWMDNMPSWEYGVLVQVRDLSRALRKDFARSQSQSTEDADLAKAEPRFN
                     FDNKSWILPSSESEFEEGIKSLTRYQTRLAAGDKGAIFYTRADNLNNWLGDVATRLGS
                     LSQRLSASVGRVKLNTTLKTESVVAGQAPQVDEELVETPWLQIDNVFYEARGQAWALS
                     HLLRAIEVDFADVLAKKNATVSVRQIIRELEASQESLWSPMVLNGSGFGMWANHSLVM
                     ANYISRANAAVIDLRQLLSQG"
     gene            692982..693518
                     /locus_tag="PPUBIRD1_RS03095"
                     /old_locus_tag="PPUBIRD1_0615"
     CDS             692982..693518
                     /locus_tag="PPUBIRD1_RS03095"
                     /old_locus_tag="PPUBIRD1_0615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_014589551.1"
                     /translation="MAISPTEAAHRAASDRELVTWVDETDQVLGALPRAELRERGLIG
                     RCTFILLFNSAGELCVHRRTLSKALYPGYWDVAAGGMVTAGEAYAESAARELAEELGI
                     EGADLRFHERFYFDQPDNRLWCAVYSAVSDAPLRLQPEEVIEARFIGLEQAEQESLSK
                     PYCPDSLAALQRYKASLR"
     gene            693802..694173
                     /gene="yciH"
                     /locus_tag="PPUBIRD1_RS03100"
                     /old_locus_tag="PPUBIRD1_0616"
     CDS             693802..694173
                     /gene="yciH"
                     /locus_tag="PPUBIRD1_RS03100"
                     /old_locus_tag="PPUBIRD1_0616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016984929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor"
                     /protein_id="WP_003255318.1"
                     /translation="MAKKASSFSALGGLVYSTDAGRHCPDCGQPVDACTCKQQIIPEG
                     DGIARVRRESKGRGGKTVTTVTGVPLPPDQLKELATTLKRRCGTGGALKDGVIEIQGD
                     HVELLIGELTKQGFKAKKSGG"
     gene            694324..696237
                     /gene="speA"
                     /locus_tag="PPUBIRD1_RS03105"
                     /old_locus_tag="PPUBIRD1_0617"
     CDS             694324..696237
                     /gene="speA"
                     /locus_tag="PPUBIRD1_RS03105"
                     /old_locus_tag="PPUBIRD1_0617"
                     /EC_number="4.1.1.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine decarboxylase"
                     /protein_id="WP_010951840.1"
                     /translation="MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINEAGRVEVR
                     PNGPQSAPIDLFEQVDELRQSGLSLPLLVRFPDILQDRVRQLTGAFDANIARLEYQSQ
                     YTALYPIKVNQQEAVVENIIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDR
                     EFIRLALMGQKLGHNVFIVIEKESEVALVIEEAAELKVKPQVGLRVRLSSLASSKWAD
                     TGGEKSKFGLSAAQLLSVVQRFRDAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRY
                     YGELRALGLPVDHIDVGGGLGVDYDGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQG
                     LPHPHIFSESGRSLTAHHAMLVIQVTDVEKHNDDVPTIENKEALPETVQWLVDLLGPT
                     DIEMVTETYWRATHYMGDVAAQYADGKLSLGEKALAEQCYFAVCRRLHNSLKARQRSH
                     RQVLDELNDKLADKYICNFSVFQSLPDTWAIGQVLPIIPLHRLDEEPMRRAVLQDLTC
                     DSDGKINQYVDEQSIETSMPVHAVKEGEDYLLGVFLVGAYQEILGDMHNLFGDTDSVN
                     IYQNADGSVYHAGIETHDTIEDMLRYVHLSPEELMTHYRDKVASAKITARERTQYLDA
                     LRLGLTRSSYLSS"
     gene            696446..696901
                     /locus_tag="PPUBIRD1_RS03110"
                     /old_locus_tag="PPUBIRD1_0618"
     CDS             696446..696901
                     /locus_tag="PPUBIRD1_RS03110"
                     /old_locus_tag="PPUBIRD1_0618"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589552.1"
                     /translation="MDRHGNHRLRQGRFSEPGRLYLLTTITRDRLPLFKNLLFARTVI
                     QQLRLSDHEGGCRSLAWVLMPDHLHWLIELGPTSLGNLMCAFKSRSSCALYRKGIDRR
                     HIWQPGFHDRALRKEEDVKAAARYIIANPIRAGLVRGAGEYPHWDCVWL"
     gene            complement(696975..698312)
                     /locus_tag="PPUBIRD1_RS03115"
                     /old_locus_tag="PPUBIRD1_0619"
     CDS             complement(696975..698312)
                     /locus_tag="PPUBIRD1_RS03115"
                     /old_locus_tag="PPUBIRD1_0619"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_014589553.1"
                     /translation="MPQLAADWRHRPTHRKVWALAAPMILSNISVPLVALVDSTVIGH
                     LPHAHQLGAVAVGATLFTFMVGLMGFLRMGSTGFAAQAAGRGDGAALRQVLVQGLLLA
                     VGFALLIGLLALPFSQLALHAMQPSAALQQSTEDFFHTRLLGLPAALASYALVGWFLG
                     TQNARAPLAILLTTNLLNIALNLWFVLGLDWGVLGSARASVIAEWSAALLGLALTRPA
                     LRAYPGQIMWAALKRWQAWRPLLAVNRDIFLRSLALQLVFLLITVQGARLGEATVAAN
                     ALLLNGLLLTAYALDGLAHAVEALCGHAIGARNRDTLRRSLVVACGWSLITSLGFAGL
                     FLLGGHLFIDLQTDIESVRAAAYPYLPYLALLPLIAVWSYLLDGLFIGATRAGEMRNA
                     MLVSVLIALPVAVGMSGFGNHGLWMAFLGFMGLRAVTLGWVGWRLQQKGEWIA"
     gene            698590..703485
                     /locus_tag="PPUBIRD1_RS03120"
                     /old_locus_tag="PPUBIRD1_0620"
     CDS             698590..703485
                     /locus_tag="PPUBIRD1_RS03120"
                     /old_locus_tag="PPUBIRD1_0620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589554.1"
                     /translation="MFNKGLLLACALALLSACDSSTPGKPAPVEKTVAPAEAPAPKRE
                     DPAVLAKRYEGRELTVLDVSEVQLDGAATLSISFSVPLDAKQDFATKVHLVDTVKGKL
                     DGAWELSDNQMELRLRHLEPQRKLVLTVDKGLLAVNGKQLDNESITRLETRDMQPTIG
                     FASRGSLLPTRLAEGLPVIALNVDKVDVEFFRVKPDMLSTFLANWGRNSSLYYYQSKE
                     TLDMAELVYSGRFDLNPARNTRETVLLPIAGIKPLQAPGVYLAVMRASGTYDYSQPAT
                     LFTLSDIGVSAHRYRDRIDVFAQALEGGKALSGVNLEIHDEKGKLLAQATTDGKGHAQ
                     LPITPKADTLIATQGVHTTLLRLNTAALDLAEFDITGPQANPLQFFIFGPRDLYRPGE
                     TVLLNGLLRDQDGKPVKAQPVSVEVRRPDEQVSRKFVWEADGNGLYQYQLQLATEAPT
                     GRWQLLLDLGGGRKQVYEFLVEDFLPERLALELKGSSTPLSPDEDARIQVNGRYLYGA
                     PAAGNRLSGQAYVRPLREAVPALPGYQFGSVTETELNQDLELDEVTLDQAGKAVVDIE
                     SRWAEARSPLQLTVQASLQESGGRPITRRLEQPIWPAERLPGLRGLFEGEETDSDGPV
                     EFEFLVADRDGNKLAADALKVRLVRERRDYYWNYSQSDGWSYAYNEKFLTQNEETISV
                     KAGSTAKLSFQVEWGPYRVEVEDPQTGLVSSERFWAGYRAQDNAEGGAVRPDQVKLAL
                     DKPSYTDGATAKVTVTPPAAGSGYLMIESSDGPLWWQEIDVPAEGKTFDVQLDKAWAR
                     HDLYVSALVIRPGERKANATPKRAVGVLHLPLDRAERKLALSLQAPEKMRPKQPLTVK
                     IKAANADGSVPKQVHVLLSAVDVGILNITDFKTPDPFASLFGRKAYGADQLDIYGQLI
                     EAGQGRLASLAFGGDAAMAKGGKRPNTTVTIVAQQSLPVTLDDKGEGQATVDIPDFNG
                     ELRLMAQAWTEEHFGMAEGKTVVAAPLIAELSAPRFLAGGDRTSLALDLANLSGRAQQ
                     LSVEITTDGQLSLAANAVQSINLAEGQRSTLMIPVQAQGGLGQGKVHVRVTGLQLPNE
                     PVNAFEREWTLGVRPAYPAMLKHYRVALKDQPWTLPEADLAAFEPAGLEASLALSSRP
                     PLNLAEQIRALQAYPYGCLEQTTSGLYPSLYADADSLKRLGIKGEPADVRKRKIEMGI
                     EHLLGMQRYNGSFGLWSSDSEEEYWLTAYVTDFLLRARDQGYGVPAEALKKASERLLR
                     YLQERNLIEVDYSENADHTRFAVQAYAALVLSRSQQAPLGALRGLFERRADARSGLPL
                     VQLAVALDKMGDKPRAEQALQAGLGISRGKGWLADYGSALRDQALILALLQESNLASS
                     QVDQRLFALSDELAANRWLSTQERNALFLAGRGLLGKPEGQWQARLDSAGEVRELNNA
                     EAGMKLEGPLLASPLSVQNQGPETLYQQLTLSGYPRQAPAAGGNGMQIHREYLGMNGQ
                     PLDLHNLRSGDLVLVHLALKAEDRVPDALVVDLLPAGLELENQNLAQSAASLDNASSA
                     VKAWRESMQNASVVHQEYRDDRYVAALKLDGYGTTHLLYLARAVTPGTYRVPPPQVES
                     MYRPNLQAVGDGQGEMTVKAR"
     gene            complement(703637..703930)
                     /locus_tag="PPUBIRD1_RS03125"
                     /old_locus_tag="PPUBIRD1_0621"
     CDS             complement(703637..703930)
                     /locus_tag="PPUBIRD1_RS03125"
                     /old_locus_tag="PPUBIRD1_0621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004577004.1"
                     /translation="MHVEGFFEWLGQALGSLIRFIVDALSGLFNLLANAGGNFIDGLS
                     RTLGMDTSLLSILALIIGLMLLYSAIRAFMRASIILGIIWLVLGLWVMSWVIH"
     gene            704008..706362
                     /locus_tag="PPUBIRD1_RS03130"
                     /old_locus_tag="PPUBIRD1_0622"
     CDS             704008..706362
                     /locus_tag="PPUBIRD1_RS03130"
                     /old_locus_tag="PPUBIRD1_0622"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019438044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1C"
                     /protein_id="WP_041166833.1"
                     /translation="MPSLARPRCRAGRLLRATLISLLVLGGLFWLADRVWPLPLPGDD
                     LARVVLAEDGTPLWRFADADGVWRYPVSPEEVSPLYLQALLTYEDRWFYNHPGVNPLA
                     LARAAWLNLRGGRVVSGGSTLSMQVARLLDPHDRTLVGKLRQLWRTLQLEWHLSKRDI
                     LQIYLNRAPFGGTLQGVAAASWAYLGKSPLHLTPAEAALLAVLPQAPSRLRPDRHPER
                     AQRARDKVLQRLAEYQVWPTRQIREAAEEPLVLAPRQEPALAPLLARRLNSADSPPLI
                     RTTLDAALQRRLEDLLLGWRARLPERTSAAILVVEAQSMAVRAYLGSIDLSDERRFGH
                     VDMVRSLRSPGSTLKPFLYGMALDDGLIHSESLLQDVPRRYGDYRPGNFSMGFSGPVS
                     ASSALALSLNLPAVQLLEAYGPKRFAAQLRMAGMPLILPPLAEPNLSLILGGAGSRLE
                     DLVGGYAALARGGNSAQVRLQPQAPLVEHRLLSPGAAWIIRRILSGQARPDRDPHAEL
                     VQRPLLAWKTGTSYGFRDAWSIGVGPRYLIGVWIGRPDGTPVPGQFGLASAAPLMLQV
                     HDLLSNRDSQRGISVPVAPVPANIGVAAICWPLGQPMSKQDTNCRRQRFAWTLDGTTP
                     PTLQAADQPLGLGLREKVWVNEQGLRVDGSCPGAKARDIALWPAPLEPWLPRVERRIA
                     RLPAIDPACPPQAPASAPPLSIVGVRPGDNLRRPATSTEPLQLQVSALGGGGRRWWFL
                     NGQPLGETQGQDSLLLRLPQVGQAELSALDESGQTARVAFQVSE"
     gene            706455..708119
                     /locus_tag="PPUBIRD1_RS03135"
                     /old_locus_tag="PPUBIRD1_0623"
     CDS             706455..708119
                     /locus_tag="PPUBIRD1_RS03135"
                     /old_locus_tag="PPUBIRD1_0623"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ShlB/FhaC/HecB family hemolysin
                     secretion/activation protein"
                     /protein_id="WP_014589556.1"
                     /translation="MRPLVVPLMLLLWALAAQADPLPGFLDSHEYERRLPSANLPMTD
                     YSPVSPHIRLAGAAIENPDWAPANTRLVLHKVRFEGGTVFPLGDLREHYQPLIGRETT
                     LGELQQYTQCLTQRYRQEGYLLSYAYLPPQDVADGRVNVVLVEGYVRDYRVDGDIGPA
                     SEYLQQLLARIEAERPLTRETLERYLGLATRMPGVVIEAELAVARAADGVARLTVHAR
                     RTPLSAAVTVADSSRDAAQALITVASTAQTRHGERVTASWLLPPGNDRVYYQRLDYSQ
                     YLDAAGSQLLLSASRYRSEPGTRIRLDDGRDITREHDSERYAIGLRQPVVVRPNEWLA
                     VQGHLYSVSEHDEDRMAEQPPSRKYDTYVRALSFEGDWRKVEQGRLRIVSAGVHQGLD
                     YLGARSDADYDLDFLRLRLSGLQSDTLLENWQGVVSGVFYWSDDRLPDSERAGFGGQN
                     FGRGYPRDQADGDKGWGVAYELNYSVRSSWLARVQPYAVVDTAQAWHNRGPVEDAHLA
                     SVALGVRLGGGHMFNVALEVAKPLADVALDSLDRRPRLSLNLAIQL"
     gene            complement(708192..708968)
                     /locus_tag="PPUBIRD1_RS03140"
                     /old_locus_tag="PPUBIRD1_0624"
     CDS             complement(708192..708968)
                     /locus_tag="PPUBIRD1_RS03140"
                     /old_locus_tag="PPUBIRD1_0624"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_041167123.1"
                     /translation="MSRPVSDVKVLVVDDQPVIVEQLSEFLETKGYTCVTALSTDEAI
                     EHYVADPSIGLLICDLHMPERDGVELVRALKEINGNKRMFEAIMLTGRAEKQDLIRAL
                     REGFADYYQKPMDLDELLAGVRRQEEALLERQRNLRDLGGLNQRLQELAESVDELYQD
                     LEKARGQGTHRRASDAEESESELPPAFEKLSPRQLEVARLVSKGNTNYQIACELGITE
                     NTVKLYVSQVLRLTHMHNRTQLALALTPSSSPVHQRFTTH"
     gene            complement(709088..709558)
                     /locus_tag="PPUBIRD1_RS03145"
                     /old_locus_tag="PPUBIRD1_0625"
     CDS             complement(709088..709558)
                     /locus_tag="PPUBIRD1_RS03145"
                     /old_locus_tag="PPUBIRD1_0625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004577000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_010951848.1"
                     /translation="MQSIVLLLWLALCSEQDVRQRQISNVLTLGAAGCALAWLFSTGH
                     SWIGAEASEAGWALAIVMLLTLPGYMLGRFGADDVKLMGALALATSPQYVLGTFIGAG
                     VTVLVWLLTRRRLWTLLNPKVKKRLQALTEEMGDKQAFVPYVLSGFLLTAVWIQ"
     gene            complement(709864..710433)
                     /locus_tag="PPUBIRD1_RS03150"
                     /old_locus_tag="PPUBIRD1_0626"
     CDS             complement(709864..710433)
                     /locus_tag="PPUBIRD1_RS03150"
                     /old_locus_tag="PPUBIRD1_0626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_010951849.1"
                     /translation="MLRRLVLLSFALLLAACSSNNVQQDFDASRDFAAYRSWAWQEPG
                     LQYRPDDPRIKSDLTEQRIRQAVADQLDQRGLRPVQGGARPDLTVRTYLIVEQRQQQI
                     TTNYGGGWGGYWGGYWGGPMYNETRSVDYKVATIQVDMFDGRDGKLVWRGSAEQIMNN
                     YPPSPEERNSAIRNTVAKVLGNYPPGSKK"
     gene            complement(710453..711088)
                     /locus_tag="PPUBIRD1_RS03155"
                     /old_locus_tag="PPUBIRD1_0627"
     CDS             complement(710453..711088)
                     /locus_tag="PPUBIRD1_RS03155"
                     /old_locus_tag="PPUBIRD1_0627"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016715411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4136 domain-containing protein"
                     /protein_id="WP_014589558.1"
                     /translation="MPYRLLCLALLPIALAGCQGSNPYVASSRPLPPAPAQAATTFDA
                     SAYPAPARDYGHYRSWSWRNGQLPSGAVDADPAQLADAVSGALDQHGLRPSRAGPGDL
                     LVSADMRLEKRLRQVRDYDTYDPYYGPYPYGGVGYGGYRHGYGGYASVPIVRTYEVEV
                     LVVRIDLYDARSGQPVWSASAESSSNKDSPRERESALRDSVHKALSGYPPS"
     gene            complement(711111..711860)
                     /locus_tag="PPUBIRD1_RS03160"
                     /old_locus_tag="PPUBIRD1_0628"
     CDS             complement(711111..711860)
                     /locus_tag="PPUBIRD1_RS03160"
                     /old_locus_tag="PPUBIRD1_0628"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008093119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_014589559.1"
                     /translation="MNDRHFDELATRFAEKIYGGAKGAIRLAVLQADLAEALPDRPLR
                     ILDIGAGLGHMALWLAERGHQLTLAEPAAPMLDGARARFAEAGQTATFIQAPWQDLLG
                     QLTERYDLVLCHAVLEWLADPESILPVLHQLTAPDGWLSLAFYNRDALVYRNLLKGHF
                     RKLRSNRLEGEKQSLTPQKPLDPRELKAQLEPMWLVESESGVRVFHDYMPKEFQGKAE
                     LLDLLEMELAHRRHPTFAGLGRYLHWVCRPR"
     gene            complement(711857..712162)
                     /locus_tag="PPUBIRD1_RS03165"
                     /old_locus_tag="PPUBIRD1_0629"
     CDS             complement(711857..712162)
                     /locus_tag="PPUBIRD1_RS03165"
                     /old_locus_tag="PPUBIRD1_0629"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017478435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase"
                     /protein_id="WP_003255298.1"
                     /translation="MNLQELTQRLHQIRDTNDWRGFHSPKNLAMAASVEMAELVEIFQ
                     WLSEDESRQLPADKLAHAGQEIGDVVLYLLLLCSELGLDMDQVVRAKLADSERRFAR"
     gene            complement(712239..713090)
                     /locus_tag="PPUBIRD1_RS03170"
                     /old_locus_tag="PPUBIRD1_0630"
     CDS             complement(712239..713090)
                     /locus_tag="PPUBIRD1_RS03170"
                     /old_locus_tag="PPUBIRD1_0630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_041166834.1"
                     /translation="MSRQWHDLHNPAARASLYLRAASKRSISGDRLPDDGLRCFIRVQ
                     PGNLGAYRRLCHFPDDGRLPGTYPHVMAFALQLQLMTADEFPFPLLGLVHLHNRIEVL
                     RPLGAVEGLRFAVYAHNLQRHAKGGTFDLVTEAEDGIGLLWRETSRMLVRGLALEGEA
                     SEPADPEPGPLPEATRWYADSDIGRRYAKVCGDYNPIHLSAVSARLFGFPTAIAHGMW
                     TKAMALAALRGHLPHSGYAFEVDFRKPVRLPSEVVLSASEAGPSGQLRLDGHGDVLHM
                     VGRWECL"
     gene            complement(713093..714445)
                     /locus_tag="PPUBIRD1_RS03175"
                     /old_locus_tag="PPUBIRD1_0631"
     CDS             complement(713093..714445)
                     /locus_tag="PPUBIRD1_RS03175"
                     /old_locus_tag="PPUBIRD1_0631"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255294.1"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-oxoacyl-ACP reductase"
                     /protein_id="WP_014589561.1"
                     /translation="MSDRYLGFANSNLGRRLVDALGLPHPAPLERWQAGRLRPVEGAL
                     VLGGGPLAKQIEAIAPRLTDEVYSFNADNLQAEAWVAGLGPKIKALVFDASHLSDSDA
                     LKQLREFFQPLLRSLAPCAHVLVLGRAPEGLDDPLASVAQRALEGFSRSLAKELRNGA
                     TAQLLYVAPGAEDQLEGALRFFLSPKSAFISGQVLRLQACTSQVEDWTRPLGGRRALV
                     TGAARGIGAAIAETLARDGADVLLLDVPQASQDLDALAARLGGKALPLDICASDAATQ
                     LLAALPDGIDIVVHNAGITRDKTLANMTPEYWDAVLAVNLKAPQVLTQALYDNGALGE
                     SARITLLASVSGIAGNRGQANYAASKAGLIGLAQAWAPRLAERGGSINAIAPGFIETH
                     MTAAMPMGLREAGRRLSSLGQGGRPQDVAEAIAWLSQPGSGSVNGQVLRVCGQALMGA
                     "
     gene            714563..715840
                     /locus_tag="PPUBIRD1_RS03180"
                     /old_locus_tag="PPUBIRD1_0632"
     CDS             714563..715840
                     /locus_tag="PPUBIRD1_RS03180"
                     /old_locus_tag="PPUBIRD1_0632"
                     /EC_number="2.3.1.16"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015634021.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_014589562.1"
                     /translation="MRSTRRVAILGGNRIPFARSNGAYATASNQAMLTAALEGLIERY
                     RLHGLRLGEVVAGAVLKHSRDMNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVA
                     NKIALGQIDCGIAGGVDSTSDAPIAVNEGLRHILLQANRGKSLGERFKPFLKLRPHHL
                     KPELPRNSEPRTGLSMGEHCERMAHTWRVARAEQDELAVLSHQKLAAAYAEGWQDDLL
                     TPFLSLIRDNNLRPDLSLEQLARLKPAFDRSGQGTLTAGNSTPLTDGASLVLLSSEAW
                     AQQQGLQVLAYLVDGETAAVDFVTGREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHE
                     AFAAQVLCTLKAWEDADYCRERLGLEAPLGAIDRSKLNVKGSSLAAGHPFAATGGRIL
                     ASLAKLLATAGKGRGLISICAAGGQGVTVIVER"
     gene            715930..716709
                     /locus_tag="PPUBIRD1_RS03185"
                     /old_locus_tag="PPUBIRD1_0633"
     CDS             715930..716709
                     /locus_tag="PPUBIRD1_RS03185"
                     /old_locus_tag="PPUBIRD1_0633"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589563.1"
                     /translation="MPMIGHPRAIPALEHLPRPLYARAESLGAGSWTTRHQHDWVQFS
                     YAISGVLGVYTRDGSYFAPPQWGVWVPADAEHEVITSMQAEMRSLYVRRDACPWAPEQ
                     CRVLEVTPLARELIKQFCLFPADYPEGDSAEARLVAVLLDQLRTLPEVGFSLPLPRHP
                     GLLALCNGLIAAPDKPQTLQQWARELGCSEKTLMRLFQRETGLSFRNWRQRMRLLSSL
                     ALLEAGENVTEAALGCGYDSTSAYIAAFKQLFGATPGELKL"
     gene            complement(716802..718745)
                     /locus_tag="PPUBIRD1_RS03190"
                     /old_locus_tag="PPUBIRD1_0634"
     CDS             complement(716802..718745)
                     /locus_tag="PPUBIRD1_RS03190"
                     /old_locus_tag="PPUBIRD1_0634"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019099767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014589564.1"
                     /translation="MSIKQKLTWAFAVIAGLPIVLVATLVVINLRGEARDGFLDSSSR
                     EIRQVSNAMNIFFQGINQNVEYMASQPMVAATGSELNKYMSATPSYELGEQASKILDF
                     MTRLANSHPAYAYLSYGVNDGGYTGWPAGQKFVNYDPRTRPWYQLAMANPGKTLRTGA
                     YYWAADDAVLVSTVRTVANQLGNPGGVVNIDVSLKGLTEIVKQIKLGESGYLMLVESN
                     GNVMVDPRDAAHNFKQLGSFGDGYAKLAKAGKGLVEVELNGVHYMANVYPDQQLGWTF
                     IGLIEQSEVMQTTTRLTWLIGIVAVVLAALFAVVGATFAKLIVRPINSVTNGLEDIAQ
                     GEGDLTRNLEIRGRDETAQLASWFNQFLGAIRSLIQHIGTAASKILSTSSSSTRVSSD
                     MAEAAGRQREAVDMVSTAFHEMVATANEVARSCSQAAQSADSGQQQAREGQQQIDAAV
                     HSVDRLSHEIEQSAQSIQQLERDSNAIQSILGTIRSIAEQTNLLALNAAIEAARAGEQ
                     GRGFAVVADEVRALAKRTADSTAEIDGLLGNLASRTAEVAEQMHASLEVSQQSVSRIG
                     LARDSFGQIRESVDVIRDMNTQIATAAEEQHQVAEDINRHISQIHGDAQLVAELAQAA
                     RQDSESLAGLSNELDTLVRRFRT"
     gene            complement(718913..719323)
                     /gene="cueR"
                     /locus_tag="PPUBIRD1_RS03195"
                     /old_locus_tag="PPUBIRD1_0635"
     CDS             complement(718913..719323)
                     /gene="cueR"
                     /locus_tag="PPUBIRD1_RS03195"
                     /old_locus_tag="PPUBIRD1_0635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cu(I)-responsive transcriptional regulator"
                     /protein_id="WP_014589565.1"
                     /translation="MNIGQAARRSGLSTKMIRYYESIGLLKPATRSDSGYRLYQAQDL
                     HNLAFIKRSRDLGFSLEEVGKLLTLWQDRQRASADVKALAMHHIDELNRRIEELVSLR
                     DTLGELVSHCQGDDRPDCPILKDLANGAGGSCCH"
     gene            complement(719320..721719)
                     /locus_tag="PPUBIRD1_RS03200"
                     /old_locus_tag="PPUBIRD1_0636"
     CDS             complement(719320..721719)
                     /locus_tag="PPUBIRD1_RS03200"
                     /old_locus_tag="PPUBIRD1_0636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="WP_014589566.1"
                     /translation="MPASTTYNLPISGMTCASCAGRVERALRKVTGAEQVSVNLTTEK
                     ARVLAPPASLPALVEAVREAGYGVPTRTLELQIGGMTCASCVGRVERALGKLAGVERV
                     SVNLASERAHLEVLAALDENLLIDAVQKAGYSASLPQSTKDDQSTVQRRLRNERLAVG
                     AALLLALPLVLPMLVQPFGLHWMLPAWAQFLLATPVQFILGARFYIAAWKAVRAGAGN
                     MDLLVALGTSAGYGLSLYQWAQAPAGMAPHLYFEASAVVIALVLLGKYLESRAKRQTA
                     SAIRALEALRPERALRVVDGVEEDVAIAQLRLGDLVLVKPGERFPVDGVVEDGSSHAD
                     EALISGESLPVPKQPGDSVTGGAINGEGRLLVRTQALGTETVLARIIRLVEDAQAAKA
                     PIQKLVDRVSQVFVPAVLLLALITLIGWWLAGVPLETALINAVAVLVIACPCALGLAT
                     PAAIMAGTGVAARHGILIKDAEALERAHAVNRVVFDKTGTLTSGSPRVVHSQALDGNS
                     ANLHRLAGALQRGSEHPLAKAVLVACAEQGLDVPSVADSQSLTGRGIAGRVEGRELAL
                     GNRRLLDESGLQPGELAAQAQAWEAEGRTLSWLIERSAQPRVVGLFAFGDSLKPGAAQ
                     AIETLHAQHISSHLLTGDNRGSAKVVAEALGIDDVHAEVLPADKAATVAALKQDGVVA
                     MVGDGINDAPALAAADIGIAMGGGTDVAMQAAGITLMRGDPRLVPAALEISRKTYAKI
                     RQNLFWAFIYNLIGIPLAALGYLNPVLAGAAMALSSVSVVSNALWLKTWKPTSSTQEA
                     P"
     gene            complement(721772..722158)
                     /locus_tag="PPUBIRD1_RS03205"
                     /old_locus_tag="PPUBIRD1_0637"
     CDS             complement(721772..722158)
                     /locus_tag="PPUBIRD1_RS03205"
                     /old_locus_tag="PPUBIRD1_0637"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019438053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589567.1"
                     /translation="MFRAALGVVGLLGALAVVPPAFAEGNSAYSVLIISRERLEVATS
                     CEIGVYLNDQLAGRVFQEQSTSFNLPPGPVDVRLRLLPGQMPGCAAGIEDQRSTRLNL
                     QAGQINKYRIAMGQYGLELKRADLGY"
     gene            722304..722501
                     /locus_tag="PPUBIRD1_RS03210"
                     /old_locus_tag="PPUBIRD1_0638"
     CDS             722304..722501
                     /locus_tag="PPUBIRD1_RS03210"
                     /old_locus_tag="PPUBIRD1_0638"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper chaperone"
                     /protein_id="WP_014589568.1"
                     /translation="MQVFNVQGMTCGHCVKAVTRAVQEQDAAARVEVDLAGKQVRVQS
                     ELAQEQILTAIRDEGYQAELA"
     gene            722609..723790
                     /locus_tag="PPUBIRD1_RS03215"
                     /old_locus_tag="PPUBIRD1_0639"
     CDS             722609..723790
                     /locus_tag="PPUBIRD1_RS03215"
                     /old_locus_tag="PPUBIRD1_0639"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="WP_003255285.1"
                     /translation="MNLRMVLILGALSAFGPLAIDFYLPAFPAMAQAFATDEKHVQAT
                     LAAYFLGLSIGQLAYGPVADRFGRRKPLMFGVTLFTLASLACAYAPNLDTLVVARFIQ
                     ALGGCAGMVLSRAIVSDKCDPVASAKVFSQLMLVMGLAPILAPMLGGVLVNLAGWQSI
                     FLALSLFSAGCLLAVSLGLPESLPEHIPRQPLSGALRQYLRLLADRVFLGHALTGGIA
                     IAGMFAYIAGSPFVFIKLYGVPAEHYGWLFGTNAAGFILVAQVNARLLAKRGPAFLLG
                     RAVWLYLVAGLVLLGVAALRPAQLWPLLVPLFICIASLGCIIPNASACAMSGQGARAG
                     SASALMGCVQFSVAAGAAALVGLLHDGSAVPMAIVISLCGALVVSVALLTRRLQAKAP
                     A"
     gene            complement(723741..723938)
                     /locus_tag="PPUBIRD1_RS26040"
     CDS             complement(723741..723938)
                     /locus_tag="PPUBIRD1_RS26040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_076403763.1"
                     /translation="MKIIVSASSRNPACPWQVQLDQHVVSFRSEAEARAFVATLETRL
                     QAPHPLMREPWPADVGSTARH"
     gene            724428..725141
                     /locus_tag="PPUBIRD1_RS03220"
                     /old_locus_tag="PPUBIRD1_0640"
     CDS             724428..725141
                     /locus_tag="PPUBIRD1_RS03220"
                     /old_locus_tag="PPUBIRD1_0640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004576993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_019438054.1"
                     /translation="MNAASSISQIASLMADPKRSAMLWALIDGTPRLANELAIMTGLT
                     SSSACAHLSLLSSAGLLRHEARGRKRYFCLATPQVGAAVEALASVQLESARGERAEAP
                     VSSLPLSMRRARRCGDHLGGELASELYHRMVVAGWLEGSGRHLRVSDEGRAQLALVGV
                     YIDALAPHQQRGCVICRCTEWNDQGPHLGGVLGQALFRLFLQSGWMRELEDSRALHIS
                     ALGIQQINRIARVATLQVG"
     gene            complement(725162..726109)
                     /locus_tag="PPUBIRD1_RS03225"
                     /old_locus_tag="PPUBIRD1_0641"
     CDS             complement(725162..726109)
                     /locus_tag="PPUBIRD1_RS03225"
                     /old_locus_tag="PPUBIRD1_0641"
                     /EC_number="3.5.4.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009042020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_014589570.1"
                     /translation="MYDWLNALPKAELHLHLEGSLEPELLFSLAERNKIALPWADVET
                     LRGAYAFNNLQEFLDLYYQGADVLRTEQDFYDLTWAYLQRCKAQNVIHTEPFFDPQTH
                     TDRGIAFEVVLNGISQALKDGREQLGISSGLILSFLRHLSEDEAHKTLDQALPFRDAF
                     IAVGLDSSEMGHPPSKFQRVFDRARSEGFVAVAHAGEEGPPEYIWEALDLLKIKRIDH
                     GVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVTVNSDD
                     PAYFGGYVTENFHALHTHLGMTEDQARRLAQNSLDARLV"
     gene            complement(726196..726882)
                     /locus_tag="PPUBIRD1_RS03230"
                     /old_locus_tag="PPUBIRD1_0642"
     CDS             complement(726196..726882)
                     /locus_tag="PPUBIRD1_RS03230"
                     /old_locus_tag="PPUBIRD1_0642"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589571.1"
                     /translation="MANSRTALIIGASRGLGLGLVQRLHEDGWHITATVRNPQQPGDL
                     ANVPGVRIEQLEMNDTVQLDSLQQRLQGQVFDLIFVNAGVMGPLPQDLEAVHNSDIGD
                     LFMTNAVAPIRVARRLVGQIREGSGVLAFMSSILGSVTIPDGGEVCLYKASKAALNSM
                     INSFFVEQQRPDLCVLAMHPGWVKTDMGGENADIDVLTSTRGMIEQIKAQSGKGGLRF
                     INYKGDPLVW"
     gene            complement(727250..727834)
                     /locus_tag="PPUBIRD1_RS03235"
                     /old_locus_tag="PPUBIRD1_0643"
     CDS             complement(727250..727834)
                     /locus_tag="PPUBIRD1_RS03235"
                     /old_locus_tag="PPUBIRD1_0643"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_014589572.1"
                     /translation="MPSTLLDLCEYREEIRKSRFITLAGPISSAAEAMSFIERHSDMA
                     ATHNCWAWKLGAQYRSSDDGEPGGTAGRPILAAIEAQDCDQVVVLVIRWYGGIQLGTG
                     GLARAYGGGANKCLQQAPKRLLVQRSHFSCSCSFSELALVKLRLAEVDGLVLDEQFTA
                     NGVDLVIALGDAHLAPLQQQLADLSRGRILLEAH"
     gene            complement(727844..728506)
                     /locus_tag="PPUBIRD1_RS03240"
                     /old_locus_tag="PPUBIRD1_0644"
     CDS             complement(727844..728506)
                     /locus_tag="PPUBIRD1_RS03240"
                     /old_locus_tag="PPUBIRD1_0644"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003257076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_003255279.1"
                     /translation="MTLEVPAHRLSASGKPAGRIRQKNEQAIIQAAEDEFARHGFKGT
                     SMNTIALKAGLPKANLHYYFTNKLGLYIAVLSNIIELWDSTFNALSVDDDPGEALSQY
                     IRTKMEFSRRNPQASRIFAMEVISGGTCLTEYFSADYREWFRGRAAVFQAWIEAGKMD
                     PVDPVHLIFLLWGSTQHYADFATQICQVTGRSRLTKQDMEDASNNLIHIILKGCGIKP
                     AA"
     gene            complement(728597..729514)
                     /locus_tag="PPUBIRD1_RS03245"
                     /old_locus_tag="PPUBIRD1_0645"
     CDS             complement(728597..729514)
                     /locus_tag="PPUBIRD1_RS03245"
                     /old_locus_tag="PPUBIRD1_0645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012316368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589573.1"
                     /translation="MSRRPDPLAQVSDFDIRLLKIYRSVVECGGFSAAENVLGIGRSA
                     ISQQMNDLEQRLGLRLCQRGRAGFSLTEEGREVYHSALQLLSALESFRTEVNGLHQHL
                     RGELNIGLTDNLVTLPHMRITHALAELKDRGPDVRIQIRMIAPSQVEHGVLDGSLHVG
                     VVPQTSPLSGLEYQPLYSERSLLYCAVGHPLFYADDQQIDDQRLNSQEAITPTFRLPT
                     DIQAHYQALNCTASASDREGMAFLILTGRYIGYLPDHYAMFWVQQGRLRALKPKERFY
                     DLSLSWVTRKGRRPNLVLESFLESLAATR"
     gene            729633..730979
                     /locus_tag="PPUBIRD1_RS03250"
                     /old_locus_tag="PPUBIRD1_0646"
     CDS             729633..730979
                     /locus_tag="PPUBIRD1_RS03250"
                     /old_locus_tag="PPUBIRD1_0646"
                     /EC_number="2.6.1.18"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007930703.1"
                     /note="catalyze the conversion of beta amino acids to the
                     corresponding beta keto acid with pyruvate as the amine
                     acceptor; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase family protein"
                     /protein_id="WP_014589574.1"
                     /translation="MNMPETAPAGIASQLKLDAHWMPYTANRNFQRDPRLIVAAEGNY
                     LVDDHGRKIFDALSGLWTCGAGHTRKEIADAVTRQLSTLDYSPAFQFGHPLSFQLAEK
                     IAELVPGNLNHVFYTNSGSECADTALKMVRAYWRLKGQATKTKIIGRARGYHGVNIAG
                     TSLGGVNGNRKMFGQLLDVDHLPHTVLPVNAFSKGMPEEGGIALADEMLKLIELHDAS
                     NIAAVIVEPLAGSAGVLPPPKGYLKRLREICTQHNILLIFDEVITGFGRMGAMTGSEA
                     FGVTPDLMCIAKQVTNGAIPMGAVIASSEIYQTFMNQPTPEYAVEFPHGYTYSAHPVA
                     CAAGLAALDLLQKENLVQSAAELAPHFEKLLHGVKGTKNIVDIRNYGLAGAIQIAARD
                     GDAIVRPYEAAMKLWKAGFYVRFGGDTLQFGPTFNTKPQELDRLFDAVGETLNLID"
     gene            731049..732542
                     /gene="mmsA"
                     /locus_tag="PPUBIRD1_RS03255"
                     /old_locus_tag="PPUBIRD1_0647"
     CDS             731049..732542
                     /gene="mmsA"
                     /locus_tag="PPUBIRD1_RS03255"
                     /old_locus_tag="PPUBIRD1_0647"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003255276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase (CoA
                     acylating)"
                     /protein_id="WP_003255276.1"
                     /translation="MSIVQHLIHGELVTKGERTADVFNPSTGQAVRKVELASRATVQE
                     AIDSAKAAFPAWRNTPPAKRAQVMFRFKQLLEQNEAKISQMISEEHGKTLEDAAGELK
                     RGIENVEFACAAPEVLKGEYSRNVGPNIDAWSDFQPLGVVAGITPFNFPAMVPLWMYP
                     LAIACGNAFILKPSERDPSSTLYIAQLLLEAGLPKGILNVVHGDKEAVDALIEAPEVK
                     ALSFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSC
                     GERCMAISVAVCVGDQVADALIAKLEPQIKALKIGAGTSCGLDMGPLVTAAARDKVVG
                     YIDDGVAAGAKLVVDGRGFRVAGNEDGYFVGGTLFDKVTPEMRIYKEEIFGPVLCVVR
                     VNSLEQAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFG
                     GWKRSLFGDLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
     gene            733289..734835
                     /locus_tag="PPUBIRD1_RS03260"
                     /old_locus_tag="PPUBIRD1_r0011"
     rRNA            733289..734835
                     /locus_tag="PPUBIRD1_RS03260"
                     /old_locus_tag="PPUBIRD1_r0011"
                     /product="16S ribosomal RNA"
     gene            734911..734987
                     /locus_tag="PPUBIRD1_RS03265"
                     /old_locus_tag="PPUBIRD1_t0005"
     tRNA            734911..734987
                     /locus_tag="PPUBIRD1_RS03265"
                     /old_locus_tag="PPUBIRD1_t0005"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:734945..734947,aa:Ile,seq:gat)
     gene            735012..735087
                     /locus_tag="PPUBIRD1_RS03270"
                     /old_locus_tag="PPUBIRD1_t0006"
     tRNA            735012..735087
                     /locus_tag="PPUBIRD1_RS03270"
                     /old_locus_tag="PPUBIRD1_t0006"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:735045..735047,aa:Ala,seq:tgc)
     gene            735324..738237
                     /locus_tag="PPUBIRD1_RS03275"
                     /old_locus_tag="PPUBIRD1_r0012"
     rRNA            735324..738237
                     /locus_tag="PPUBIRD1_RS03275"
                     /old_locus_tag="PPUBIRD1_r0012"
                     /product="23S ribosomal RNA"
     gene            738366..738481
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS03280"
                     /old_locus_tag="PPUBIRD1_r0013"
     rRNA            738366..738481
                     /gene="rrf"
                     /locus_tag="PPUBIRD1_RS03280"
                     /old_locus_tag="PPUBIRD1_r0013"
                     /product="5S ribosomal RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00001"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00001"
     gene            738739..739398
                     /locus_tag="PPUBIRD1_RS03285"
                     /old_locus_tag="PPUBIRD1_0648"
     CDS             738739..739398
                     /locus_tag="PPUBIRD1_RS03285"
                     /old_locus_tag="PPUBIRD1_0648"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011535731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="WP_014589575.1"
                     /translation="MSNSVEPETLAQLPLDELVACHECDLLLRKPVLQHDEKAQCPRC
                     GYELYAHRHNVVNRSLALVLTALLLFVPANFLPIMQLHLLGQTSDDTVWSGVLGLYNS
                     GMRGVAVVVLLCSMVIPLAKLLCQLAVLLSIRLNFGRDYGLIFYRIYHHLRDWGMLEV
                     YFMGVLVAIVKLVDLAELTVGLGLFCFISLLLIQVWLEVVMSPHQIWSALSGEDLHAG
                     D"
     gene            739385..740008
                     /locus_tag="PPUBIRD1_RS03290"
                     /old_locus_tag="PPUBIRD1_0649"
     CDS             739385..740008
                     /locus_tag="PPUBIRD1_RS03290"
                     /old_locus_tag="PPUBIRD1_0649"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016392923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="WP_014589576.1"
                     /translation="MRAIDAGIVVCNECHELNRQEPDSTSQTCTRCGAIVHARRPNSI
                     VRTWALLIAASILYIPANILPIMTVSTLGQGSPDTIMSGVITLLKHGMVPIAAVVFIA
                     SILVPTFKLVGIGLLLYSVQRRQPLSARQRILMYRFIEFIGRWSMLDIFVIAILVAVV
                     NFGRIASVEANLGAVAFATVVILTMLAALTFDPRLIWDNTESDDDHE"
     gene            740001..742301
                     /locus_tag="PPUBIRD1_RS03295"
                     /old_locus_tag="PPUBIRD1_0650"
     CDS             740001..742301
                     /locus_tag="PPUBIRD1_RS03295"
                     /old_locus_tag="PPUBIRD1_0650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007930129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MCE family protein"
                     /protein_id="WP_014589577.1"
                     /translation="MSDLPTAKTRPASNWSAIWILPLIALMIGGWLAWQAYRDAGVEI
                     EVRFESGEGIVANKTEVIYKGMPVGKVKSLVLDAKGDTQGVIATIEMNKAAEPHLTKG
                     TRFWLVKPSVSLAGISGLETLVSGNYIAVSPGEGERTKRFVALKVAPPLSDSEPGLHL
                     TLKADRLGSLNRDSPVFYKQIQVGRVKSYRLSEDQSTVEVKVFIEPAYASLVRKHTRF
                     WNASGVSIDASLSGVKVRSESLSSIVAGGIAFATPEYRKDSPPTDPSLPFRLYEDFDA
                     AQAGIRVKVKLSDYEGLQAGRTPVMYKGIQVGSLKALKMEDNLASASAELTLDPLTED
                     YLVDGTQFWVVKPSISLAGITGLEALVKGNYIAIRPGEKGARPEREFEARAKAPPLDL
                     KAPGLHMVLFADTLGSLEIGSPVTYRQVKVGSVQSYQFARNSNRILIGVHIEKEYEKL
                     VNGSSRFWNVSGITLTGGLSGIKIKSESLQTLMAGGIAFDTPRPDVPLKRHIPRFRLH
                     DSQEAVNRAGTLITIRVERADGLKPGTAIRFRGLDVGSIESVDLTDDLQAVLLRARIT
                     EAADRIARAGTQFWVVKPALGLVRTENLDTLIGGQYLEVQPAAKNRGPQRDFIALAEA
                     PEVAGPEVGLPLTLSAPRRGSIKPGVPVTYREVTVGKVTGFELGQSADRVLIHILIEP
                     RYAALVRSGSRFWNSSGFGFDWGLFKGATVRTESVETLIDGGIAFATPDGEQMGNPAR
                     PQQTFALFEKAEDEWLQWAPKIQIAK"
     gene            complement(742536..742814)
                     /locus_tag="PPUBIRD1_RS03300"
                     /old_locus_tag="PPUBIRD1_0651"
     CDS             complement(742536..742814)
                     /locus_tag="PPUBIRD1_RS03300"
                     /old_locus_tag="PPUBIRD1_0651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_003247625.1"
                     /translation="MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDA
                     EKAQAAYVLAVPVIDRMADKGIIHKNKAARHKGRLNGHIKALKEAAAA"
     gene            743065..744603
                     /gene="mviN"
                     /locus_tag="PPUBIRD1_RS03305"
                     /old_locus_tag="PPUBIRD1_0652"
     CDS             743065..744603
                     /gene="mviN"
                     /locus_tag="PPUBIRD1_RS03305"
                     /old_locus_tag="PPUBIRD1_0652"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid II flippase MurJ"
                     /protein_id="WP_014589578.1"
                     /translation="MNLLKSLAAVSSITMISRVLGFVRDTILARIFGAGVATDAFFIA
                     FKLPNLLRRIFAEGAFSQAFVPILAEYKTQQGEEATRTFIAYVSGLLTLVLALVTAIG
                     ILAAPWVVWATAPGFVDSTEKYELTTDLLRVTFPYIFLISLSSLAGAILNTWNRFSVP
                     AFTPTLLNVAMIAFAVLLTPYFNPPIMALAWGVLAGGLAQLLYQLPALKKIGMLVLPR
                     LNLKDVGVWRVLKQMLPAILGVSVSQISLIINTIFASFLVAGSVSWMYYADRLMELPS
                     GVLGVALGTILLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTV
                     ALFQYGKFSAFDAAMTQRALIAYSVGLLAIILIKVLAPGFYAQQNIRTPVKIAVFTLV
                     CTQLFNLALVGPLAHAGLALAISLGACLNAGLLFWKLRSQQLFEPQPGWAVFLLKLVL
                     AVALMSAVLLAGMHYMPAWEQGIMLERFLRLGALILAGVVTYFGCLYLCGFRPRHFAR
                     KALH"
     gene            744722..745672
                     /gene="ribF"
                     /locus_tag="PPUBIRD1_RS03310"
                     /old_locus_tag="PPUBIRD1_0653"
     CDS             744722..745672
                     /gene="ribF"
                     /locus_tag="PPUBIRD1_RS03310"
                     /old_locus_tag="PPUBIRD1_0653"
                     /EC_number="2.7.7.2"
                     /EC_number="2.7.1.26"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008090097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="WP_014589579.1"
                     /translation="MQLVRGLHNLRPEHRGCVATIGNFDGVHRGHQAILARLRERGQA
                     LGLPTCVVIFEPQPREYFAPDTAPARLARLRDKIELLATEGIDRVLCLAFNHRLSKLS
                     ADAFVKAILVDGLGVRHLEVGDDFRFGCDRAGDFAFLVEAGNAYGFTVEAANTVIQDG
                     LRVSSTEVRKALSEGDFELAEHLLGRPYRITGRVLHGQKLARQLGTPTANIQLKRRRV
                     PLSGVYLASIVIDGKAWPGVGNIGVRPTVAGDGRPHLEIHLLDFAGDLYGRRLTVEFH
                     HKLREEQRFASLEALKSAIDADIAAARAHWHAQPLTKSLK"
     gene            745669..748500
                     /locus_tag="PPUBIRD1_RS03315"
                     /old_locus_tag="PPUBIRD1_0654"
     CDS             745669..748500
                     /locus_tag="PPUBIRD1_RS03315"
                     /old_locus_tag="PPUBIRD1_0654"
                     /EC_number="6.1.1.5"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003185587.1"
                     /note="Isoleucyl-tRNA synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_014589580.1"
                     /translation="MTDYKATLNLPDTAFPMKAGLPQREPQILQRWDSIGLYQKLREI
                     GKDRPKFVLHDGPPYANGKIHIGHALNKILKDMIVRSKTLAGFDAPYVPGWDCHGLPI
                     EHKVEVTHGKHLSADRTRELCREYAAEQIEGQKTEFIRLGVLGDWDNPYKTMNFANEA
                     GEIRALAEMVKQGFVFKGLKPVNWCFDCGSALAEAEVEYADKKSQTIDVAFPVADEAK
                     LAAAFGLASLAKPAAIVIWTTTPWTIPANQALNIHPEFKYALVDTGERLLVLAEELVE
                     SCLKRYNLEGSVVATAQGSALELINFRHPFYDRLSPIYLADYVELGAGTGVVHSSPAY
                     GEDDFVTCKRYGMVNDDILTPVQSNGVYVESLPFFGGQFIWKANPAIVEKLSEVGALM
                     HTETISHSYMHCWRHKTPLIYRATAQWFVGMDKQPSTGEPLRERALKAIEDTKFVPAW
                     GQARLHAMIANRPDWCISRQRNWGVPIPFFLHKQTGELHPRTVELMEEVAKRVEQQGI
                     EAWFKLDAAELLGAEADQYDKIADTLDVWFDSGTTHWHVLRGSHDIGHATGPRADLYL
                     EGSDQHRGWFHSSLLTGCAIDNHAPYRELLTHGFTVDENGRKMSKSLGNTIEPEKVNN
                     TLGADILRLWVSATDYSGEMAVSEQILQRSADAYRRIRNTARFLLSNLSGFDPARDLL
                     APEDMLALDRWAVDRTLLLQRELEEHYSEYRFWNVYSKVHNFCVQELGGFYLDIIKDR
                     QYTTGANSVARRSCQTALYHISEALVRWIAPILAFTADEIWQYLPGERNESVMLNGWY
                     QGLSELPEGTELDRAYWDRVMAVKASVNKELENQRTAKVIGGNLQAEVTLYADEGLSA
                     DLGKLGDELRFVLITSAASVVPFAQAPAEAVATEVEGLKLQVVKSGHTKCGRCWHFRA
                     DVGSHPEHPEICGRCVDNLTGSGEVRHYA"
     gene            748493..749008
                     /locus_tag="PPUBIRD1_RS03320"
                     /old_locus_tag="PPUBIRD1_0655"
     CDS             748493..749008
                     /locus_tag="PPUBIRD1_RS03320"
                     /old_locus_tag="PPUBIRD1_0655"
                     /EC_number="3.4.23.36"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233817.1"
                     /note="Lipoprotein signal peptidase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="WP_014589581.1"
                     /translation="MPNPAAGRFGRLAWLWLSLLVLVVDQATKLYFNNALTMYQQIVV
                     IPDYFSWTLAYNTGAAFSFLADGAGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAV
                     ALALVLGGAIGNLYDRIVLGHVVDFILVHWQNRHYFPAFNVADSAITVGAVMLALDMF
                     KSKKSEDPVHD"
     gene            749001..749438
                     /locus_tag="PPUBIRD1_RS03325"
                     /old_locus_tag="PPUBIRD1_0656"
     CDS             749001..749438
                     /locus_tag="PPUBIRD1_RS03325"
                     /old_locus_tag="PPUBIRD1_0656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011535724.1"
                     /note="rotamase; accelerates isomerization of the peptidyl
                     prolyl bond, involved in the folding of proteases; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_003247607.1"
                     /translation="MTDTRIGQNTEVTLHFALHLENGDTVDSTFDKAPATFKVGDGNL
                     LPGFENALFGFKAGDKRTVVVAPENAFGQPNPQNVQVMPRSNFEGMELSEGLLIIFND
                     AANTELPGVVKAFDDDQVTIDFNHPLAGKTLTFEVEILEVKAL"
     gene            749453..750400
                     /locus_tag="PPUBIRD1_RS03330"
                     /old_locus_tag="PPUBIRD1_0657"
     CDS             749453..750400
                     /locus_tag="PPUBIRD1_RS03330"
                     /old_locus_tag="PPUBIRD1_0657"
                     /EC_number="1.17.1.2"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_233819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_004577287.1"
                     /translation="MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHEVVHNKF
                     VVEDLRNRGAIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKV
                     HIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVANLQVRDPN
                     HLAFVTQTTLSMDDTSRVIDALRARFPNIGGPRKDDICYATQNRQDAVKQLAGESDVV
                     LVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDQTARIGITAGASAPEVLV
                     RGVIEQLKAWGATGAEELDGREENITFSMPKELRVRSLI"
     gene            complement(750477..750959)
                     /locus_tag="PPUBIRD1_RS03335"
                     /old_locus_tag="PPUBIRD1_0658"
     CDS             complement(750477..750959)
                     /locus_tag="PPUBIRD1_RS03335"
                     /old_locus_tag="PPUBIRD1_0658"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pili biogenesis protein FimT"
                     /protein_id="WP_019436798.1"
                     /translation="MKQRGVTLIQMLSALAVAVLLTQLGMPAYARMSDDLHRAAAARD
                     LAQALRSARSHALLQGQPVLVLALDGNWGNGWRVVLEHNRQVLREQRLPKPLKITSNR
                     GEQFKFSALGVPMTLGNSWLGATLEMCERAAARSRYQVVLASSGRVRLLTEDLSNDRC
                     "
     gene            751069..751251
                     /locus_tag="PPUBIRD1_RS03340"
                     /old_locus_tag="PPUBIRD1_0659"
     CDS             751069..751251
                     /locus_tag="PPUBIRD1_RS03340"
                     /old_locus_tag="PPUBIRD1_0659"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilV, Tfpilus assembly protein PilV"
                     /protein_id="WP_014589583.1"
                     /translation="MHERQGGMTLLEVLLAVVVVAVGMFAAAGLQLQALQAVDSARRN
                     GQAAMAAHSEHERGRR"
     gene            751248..751892
                     /locus_tag="PPUBIRD1_RS03345"
                     /old_locus_tag="PPUBIRD1_0660"
     CDS             751248..751892
                     /locus_tag="PPUBIRD1_RS03345"
                     /old_locus_tag="PPUBIRD1_0660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_014589584.1"
                     /translation="MRRGQRGFGLVELMLALTIGLMLLAAASQLFASAHQAWRLQSTA
                     LRMQDEARQALLRMAQDIRMAGMFGCLRLKPSDFDDPALQQVFARPLVIEASTLSLIV
                     AELPGQAGRPDWFLHTNCLTEVSVDEARKAGDPLVYPVSRYVYQLQDDKLRFKRGNSK
                     FQPLVDNVQAMRVERVQMVGGERVDISLTLYEPTLKVQQRHELSVAIRNPVPAS"
     gene            751889..752353
                     /locus_tag="PPUBIRD1_RS03350"
                     /old_locus_tag="PPUBIRD1_0661"
     CDS             751889..752353
                     /locus_tag="PPUBIRD1_RS03350"
                     /old_locus_tag="PPUBIRD1_0661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589585.1"
                     /translation="MTHQRGVVLLLALVLSVLLGLLATSALRDALVETRMTGYLSDGL
                     MALEEAEATLLAGVRELERAPPDVCNACLPPPRPHDLVGQWQGTQTGFFQLQNLGVST
                     RAAHMPEGQPVSLFRITAVSKQSRSRHVLEAVYAVAGNQTQRITWRQRLRGD"
     gene            752355..752744
                     /locus_tag="PPUBIRD1_RS03355"
                     /old_locus_tag="PPUBIRD1_0662"
     CDS             752355..752744
                     /locus_tag="PPUBIRD1_RS03355"
                     /old_locus_tag="PPUBIRD1_0662"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750371.1"
                     /note="type IV pili biogenesis protein PilE; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilE"
                     /protein_id="WP_014589586.1"
                     /translation="MQQGLSLIELLIVLAVTGILAAIAYPSYSDQLQRAARSEVVGLL
                     HDAALRLERHRVRTGQYAEGDLVLPEGTRYYSLQAQRDSDTFTLRARRLPHGLMAQDG
                     CGDFQLDQAGVQHNPGAVEHSTHCWGS"
     gene            752799..753896
                     /gene="thiO"
                     /locus_tag="PPUBIRD1_RS03360"
                     /old_locus_tag="PPUBIRD1_0663"
     CDS             752799..753896
                     /gene="thiO"
                     /locus_tag="PPUBIRD1_RS03360"
                     /old_locus_tag="PPUBIRD1_0663"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine oxidase ThiO"
                     /protein_id="WP_014589587.1"
                     /translation="MSKQVVVVGGGVIGLLTAFNLAAKVGQVVVCDQGEVGRESSWAG
                     GGIVSPLYPWRYSPAVTALAHWSQDFYPQLGERLFASTGVDPEVHTTGLYWLDLDDEA
                     EALAWAVREQRPLSAVDISAAYDAVPVLGPGFKHAIYMAGVANVRNPRLVKSLKAALL
                     ALPNVTLREHCQISGFVQEKGRVTGVQTADGVLAADEVVLSAGAWSGDLLRTLGLELP
                     VEPVKGQMILFKCAEDFLPSMVLAKGRYAIPRRDGHILVGSTLEHAGYDKTPTGDALE
                     SLKASAVELLPELEGATVVAHWAGLRPGSPEGIPYIGPVPGHEGLWLNCGHYRNGLVL
                     APASCQLFTDLLTGAEPIIDPAPYAPEGRLG"
     gene            complement(754041..755450)
                     /locus_tag="PPUBIRD1_RS03365"
                     /old_locus_tag="PPUBIRD1_0664"
     CDS             complement(754041..755450)
                     /locus_tag="PPUBIRD1_RS03365"
                     /old_locus_tag="PPUBIRD1_0664"
                     /EC_number="3.5.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019436797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_014589588.1"
                     /translation="MTQKTAIGELTAVELLELYQRRQLSPVEVVDDVLARIDLHNPAV
                     NAYCHVDGEGARAAARASEQRWQRGQPCGRLDGVPASIKDLTLTRGMPTRKGSRTTSG
                     AGPWEVDAPFSAFMREAGAVLVGKTTTPEFGWKGVTDNPLYGITRNPWDTRLTAGGSS
                     GGAAAAAALNLGVLHQGSDAGGSIRIPCAFTGTFGIKPTFGYVPQWPASAMTVLSHLG
                     PMTRTVDDSVLMLDCVARPDARDGLAGAPRQAPWLSQQQDLSGLRIAYSANFGYVQVA
                     PQIQALVAQAVQRLARLGAQVEEVDPGFSDPLETFNTLWFAGAARLASALSDEQRALL
                     DPGLRWIAEQGAQISLGEYTQALEARAELIAKMNAFHQRYDVLISPMLPLVAFEAGHN
                     VPPGSGMAQWMEWTPFSYPFNLTQQPAASVPCGFTREGLPVGLQVVAGRFADEQVLRV
                     CKVYEQHYPSRHLQAPITG"
     gene            complement(755452..756729)
                     /locus_tag="PPUBIRD1_RS03370"
                     /old_locus_tag="PPUBIRD1_0665"
     CDS             complement(755452..756729)
                     /locus_tag="PPUBIRD1_RS03370"
                     /old_locus_tag="PPUBIRD1_0665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020192257.1"
                     /note="allantoate amidohydrolase and N-carbamoyl-L-amino
                     acid amidohydrolase are very similar; the allantoate
                     amidohydrolase from Escherichia coli forms a dimer and
                     binds zinc ions for catalytic activity and catalyzes the
                     conversion of allantoate to (S)-ureidoglycolate and
                     ammonia; carbamoyl amidohydrolase from Bacillus sp.
                     converts N-carbamoyl amino acids to amino acids, ammonia,
                     and carbon dioxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-dependent hydrolase"
                     /protein_id="WP_014589589.1"
                     /translation="MNTRIDPSQHLLGQGPLVSRERLWQSLMDLAQLGATAKGGVCRL
                     ALTDLDRQARDLFVHWCEEAGCTVSVDAIGNIFARRPGRNPALPPIMTGSHIDTQPTG
                     GKFDGCYGVMAGLEVMRTLNDLHLTTEAPLEVVVWTNEEGSRFPPCMMGSGVFAGKFG
                     LQETLDKVDDQGLSVGAELQRIGYAGPRVPTGHAVGAYFEAHIEQGPVLEDQRTTIGV
                     VQGCLGQKWFDLTLTGVEAHAGPTPMHLRKDALVGAAEVVAAVNRVAHAHQPHACGTV
                     GCLTLHPGSRNVIPGQVHMTIDLRHLDPGHLDAMVSEVCAAIENSTAKHGLSYQLTPT
                     ADFPPLYFAEQCVDAVRQGARALGLSHMDIVSGAGHDAIFLAELGPAGMIFVPCEGGI
                     SHNEIENAAPQDLADGCDVLLRAMFQAANPGAR"
     gene            complement(756882..757577)
                     /locus_tag="PPUBIRD1_RS03375"
                     /old_locus_tag="PPUBIRD1_0666"
     CDS             complement(756882..757577)
                     /locus_tag="PPUBIRD1_RS03375"
                     /old_locus_tag="PPUBIRD1_0666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017475194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012051120.1"
                     /translation="MLNVDSIHSYYDKSHVLEGVSLKVEAGELVTLLGRNGAGKTTTL
                     RSILGIVRPRQGQISFNGQQLVGREIFDIARLGIALVPEHRGIFRQLSVEENLKIAVR
                     KASRWQLEDVYSMFPRLKERRRNGGFALSGGEQQMLAIARALLNGPKLLILDEPTEGL
                     APVIVDELVKILRRIKDEGLSILLVEQNLMVCDALADRHYVLEQGRVAYQGSAAQFRE
                     DPSIKNRYLALSA"
     gene            complement(757577..758329)
                     /locus_tag="PPUBIRD1_RS03380"
                     /old_locus_tag="PPUBIRD1_0667"
     CDS             complement(757577..758329)
                     /locus_tag="PPUBIRD1_RS03380"
                     /old_locus_tag="PPUBIRD1_0667"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_014589590.1"
                     /translation="MSDYLLETRQLELAYGPFKAVAGVDLKVRAGTIHTIIGPNGAGK
                     TSLFHCLTGERQATAGKILFNGQDIIRKPSHGRVALGMARSFQLTSLFQNLSVRENLR
                     LAAQGRDGLGALNFWRSVEHKRSHWNTADQVLERLKLSARADTLAGELSHGQQRVLEV
                     GMSICAKPTLLMLDEPTSGMGIDDIPVMTDLISDLGRDHTVLLIEHNMSIVMSISQRI
                     TVMSHGQILVEGTPEQVRNDERVRTAYLGEAA"
     gene            complement(758329..759348)
                     /locus_tag="PPUBIRD1_RS03385"
                     /old_locus_tag="PPUBIRD1_0668"
     CDS             complement(758329..759348)
                     /locus_tag="PPUBIRD1_RS03385"
                     /old_locus_tag="PPUBIRD1_0668"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_014589591.1"
                     /translation="MSEKNPLPVAKGRAPALLSLVVASLVALPLLLPSATLATEILIF
                     AMAALACNLLLGYTGLLSFGQGIFFGVGAYGAALLMIHLQWGMFAALLGAAVFGALLA
                     LLVGALAIRRTGIYFVMLTLAFSQMAYFLAYTLSDWTGGDNGLLDVPRPNIEIAGHVL
                     VDLADPRHFYVFVAVLFLLIFAAALRVIRSPFGSTLLAIRENETRAAAIGYDTRHFKI
                     LVFMLSGAITGIAGALYAMLLHFAPLSNIDLMMSENILIMTIVGGTGSLFGSLLGAGA
                     IVLLGDVLSELWPRWLMLLGVILILVVVFMRGGLWGGLTELGKRLLATRNADDKPQAK
                     TKETL"
     gene            complement(759350..760210)
                     /locus_tag="PPUBIRD1_RS03390"
                     /old_locus_tag="PPUBIRD1_0669"
     CDS             complement(759350..760210)
                     /locus_tag="PPUBIRD1_RS03390"
                     /old_locus_tag="PPUBIRD1_0669"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020301305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_003247565.1"
                     /translation="MLDLYLFQLLNGLGLGMIYFLIAVGLTIIFGLLNFVNFAHGAFF
                     LLGAYLCYTAVAVTGNFWLALLIAPLVVAALAWAVERLLIKRIYHLPHTFQILVTLGI
                     ALIIQEASVLIWGPVGKNIAVPPELRGVLILGDFIYPYYRLFLIGFAALIGIGLWLLL
                     ERTRFGALVRAGSESTETVSLLGTNIFRLFSLTFALGVGLAGVAGVLFAPLRGAQPFV
                     GPEILGIAFVVVVIGGMGSFGGALVGGLLVGVVQSMMTSLWPQGASLMIYGAMAAVIL
                     VRPYGLFGRA"
     gene            complement(760276..761478)
                     /locus_tag="PPUBIRD1_RS03395"
                     /old_locus_tag="PPUBIRD1_0670"
     CDS             complement(760276..761478)
                     /locus_tag="PPUBIRD1_RS03395"
                     /old_locus_tag="PPUBIRD1_0670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589592.1"
                     /translation="MQRRTLLKAGLALGALGSLPLGAHRAFADQPLTFYGLKSMSGAF
                     ASYGKYADMGSRLAIAEHPQLLGHPLKYKVIDTEGNAGKAVRKVQEAIGQDGARFFQG
                     CTLSSSALAVSKEIHKAGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETLVPMS
                     RQLPQAKRWYTITPQYVFGDALLDNARKVFAELGVEHIGNSYHSLQEQEFSGYLTNAI
                     AAKPDVLVLLNFGSQASNALRQAVNFGIKDRMKVLMVWSAGLDQFQELGSDVLEGVYL
                     GAQYWHQVDTPLNKQLVAATRKAYGINPNYPLAADYIGTKVMLEAIVKAGSLDGATVS
                     AALQGMRFQGPTGEELIRPGDHQVLKDYYLLRGKPQGQMRDEDDLAEVISSGRSFVEV
                     DHTGCALA"
     gene            complement(761569..762333)
                     /locus_tag="PPUBIRD1_RS03400"
                     /old_locus_tag="PPUBIRD1_0671"
     CDS             complement(761569..762333)
                     /locus_tag="PPUBIRD1_RS03400"
                     /old_locus_tag="PPUBIRD1_0671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FadR family transcriptional regulator"
                     /protein_id="WP_019437914.1"
                     /translation="MLKPKRKRQKLSDVIVESVKRSIVTEALHPGDRLPTERELMEHF
                     ECSKGTAREALKALEVEGLVSTRTGPTGGAYLNEVGTEPASRALRNYLHFQHLDGEQV
                     YQLRKVIEVELAVSVMGKLSEADYAALQANIDFCSAPEDSEEGQREQRLAELEFHTLL
                     ANRCPNPLLRFMAVFLNDLLRDLVVLKKAYLPKRQQFAAANIGYHKQLLTALRASDEP
                     AVRRLMHEHMCDAEHHMTALEGEVARNFLLEFDHHH"
     gene            complement(762338..762655)
                     /locus_tag="PPUBIRD1_RS26045"
     CDS             complement(762338..762655)
                     /locus_tag="PPUBIRD1_RS26045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003256384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_076402506.1"
                     /translation="MSGIAARPTCSRALATKAEHDVCSILKPIRNLWERACPRSRHHG
                     VWHRLRRCSRARPLPQFLSAISCSTYPSPTLSHHLRPLPPASIDPSGQNSLNPIYPHK
                     YEK"
     gene            complement(762600..762830)
                     /locus_tag="PPUBIRD1_RS03405"
                     /old_locus_tag="PPUBIRD1_0672"
     CDS             complement(762600..762830)
                     /locus_tag="PPUBIRD1_RS03405"
                     /old_locus_tag="PPUBIRD1_0672"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589594.1"
                     /translation="MVRLLFWIALIAAAFWLWRKYKVSQQSHPEAKLDAPLKMVRCAH
                     CGVHLPNDRALQQGNEWYCSQAHLQQGPGHQG"
     gene            complement(762925..763944)
                     /locus_tag="PPUBIRD1_RS03410"
                     /old_locus_tag="PPUBIRD1_0673"
     CDS             complement(762925..763944)
                     /locus_tag="PPUBIRD1_RS03410"
                     /old_locus_tag="PPUBIRD1_0673"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009403514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamD"
                     /protein_id="WP_004577276.1"
                     /translation="MRVKHLLLIAILGLTAACSSNKEVIDENLSEAELYQQAQADLDN
                     SSYTSAVNKLKALESRYPFGRYADQAQLELIYANYKNSEPEAAKSAAERFIRLHPQHP
                     NVDYAYYLKGLTSFDQDRGLLARFLPLDMTKRDPGAARDSYNEFAQLTSRFPNSRYAP
                     DAKQRMIYLRNLLASYEIHVADYYLSRQAYVAAANRGRYVVENFQETPSVGDGLAVMV
                     ESYQKLHLDELAATSLETLKLNYPDHPSLVDGEFQPKQTESDGRGWLSKATLGLIETD
                     TPLPPGETRANQDVVKQFQDARDEMPRELLPKDENGDPIVPEGPKEAEKDRSWFSYMT
                     FGLFD"
     gene            764092..765054
                     /locus_tag="PPUBIRD1_RS03415"
                     /old_locus_tag="PPUBIRD1_0674"
     CDS             764092..765054
                     /locus_tag="PPUBIRD1_RS03415"
                     /old_locus_tag="PPUBIRD1_0674"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001621404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine(1911/1915/1917) synthase"
                     /protein_id="WP_041167124.1"
                     /translation="MSEIIQLSAEVPSELGGQRLDQVAAQLFAEYSRSRLTSWIKEGR
                     LTVDGAVVRPRDLVHGGSLLTLEAEQEAQGEWIAEDIELDIVYEDDHILVINKPAGLV
                     VHPAAGHASGTLLNALLHHVPDIVNVPRAGIVHRLDKDTTGLMVVAKTLQAQTKLVEQ
                     MQARKVSRIYECIVIGVVTAGGKIDAPIGRHGGMRQRMAVTDGGKPAVSHYRVLKRFR
                     SHTHVRVKLETGRTHQIRVHMAHVGFPLVGDQTYGGRFRIPPAASPTMVEAVKTFPRQ
                     ALHARFLALAHPITGEVMKWESPLPDDFVWLLSLLNQDRESFIG"
     gene            765051..765791
                     /locus_tag="PPUBIRD1_RS03420"
                     /old_locus_tag="PPUBIRD1_0675"
     CDS             765051..765791
                     /locus_tag="PPUBIRD1_RS03420"
                     /old_locus_tag="PPUBIRD1_0675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multi-copper polyphenol oxidoreductase"
                     /protein_id="WP_014589596.1"
                     /translation="MSELTQALLFPDWPAPASVRACVTTRQGGVSLPPYETFNLGDHV
                     GDDPAAVAENRRRLSEQFAIQPAWLKQVHGRVVADADPAVVAEADASWTRQPGIACTV
                     MTADCLPALFCDRAGTRVAAAHAGWRGLAGGVLEATLDRLALPPEEVLVWLGPAIGPQ
                     AFEVGLEVRDAFTAVHPQAARAFVDGERPGKLLADIYELARIRLAARGVTAVYGGGLC
                     TVSDARFFSYRRTPQGGRFASLVWLDPR"
     gene            complement(765709..765897)
                     /locus_tag="PPUBIRD1_RS26050"
     CDS             complement(765709..765897)
                     /locus_tag="PPUBIRD1_RS26050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557761.1"
                     /translation="MGAIRGHARPHSYTTGFNVCGISVGAGVPAKRPVQASAGPARPT
                     MQNAHPAGYGDRRRTAHH"
     gene            766041..768605
                     /gene="clpB"
                     /locus_tag="PPUBIRD1_RS03425"
                     /old_locus_tag="PPUBIRD1_0677"
     CDS             766041..768605
                     /gene="clpB"
                     /locus_tag="PPUBIRD1_RS03425"
                     /old_locus_tag="PPUBIRD1_0677"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_790675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent chaperone ClpB"
                     /protein_id="WP_041166835.1"
                     /translation="MRIDRLTSKLQLAISDAQSLAVGMDHPAIEPVHLLQALLEQQGG
                     SIKPLLMQVGFDINGLRQGLVKELDQLPKIQNPTGDVNMSQDLARLLNQADRLAQQKG
                     DQFISSELVLLAAMDENSKLGKLLLSQGVSKKALENAINNLRGGAAVNDANAEESRQA
                     LDKYTVDLTKRAEEGKLDPVIGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIAEG
                     LAQRIINGEVPDGLKGKRLLALDMGALIAGAKYRGEFEERLKSLLNELSKQEGQIILF
                     IDELHTMVGAGKGEGAMDAGNMLKPALARGELHCVGATTLNEYRQFIEKDAALERRFQ
                     KVLVEEPSEEDTIAILRGLKERYEVHHKVAITDGAIIAAAKLSHRYITDRQLPDKAID
                     LIDEAASRIRMEIDSKPEVLDRLDRRLIQLKVESQALKKEEDEAAKKRLEKLTEEIER
                     LEREYSDLEEIWASEKAEVQGSAQIQQKIEQSRQELEAARRKGDLNRMAELQYGVIPD
                     LERSLQMVDQHGKTDNQLLRNKVTEEEIAEVVSKWTGIPVAKMLEGEREKLLKMEELL
                     HQRVIGQSEAVTAVANAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELCKALAEFLFD
                     TEEAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVVLLDEVEKA
                     HPDVFNVLLQVLEDGRLTDSHGRTVDFRNTVIVMTSNLGSAQIQELVGDREAQRAAVM
                     DAVGAHFRPEFINRIDEVVVFEPLGREQIAGITEIQLGRLRSRLLERELSLSLSPEAL
                     DKLIAVGYDPVYGARPLKRAIQRWIENPLAQLILAGKFLPGSAITAKVEADEIVFG"
     gene            768968..769043
                     /locus_tag="PPUBIRD1_RS03430"
                     /old_locus_tag="PPUBIRD1_t0007"
     tRNA            768968..769043
                     /locus_tag="PPUBIRD1_RS03430"
                     /old_locus_tag="PPUBIRD1_t0007"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769001..769003,aa:Asn,seq:gtt)
     gene            769048..769124
                     /locus_tag="PPUBIRD1_RS03435"
                     /old_locus_tag="PPUBIRD1_t0008"
     tRNA            769048..769124
                     /locus_tag="PPUBIRD1_RS03435"
                     /old_locus_tag="PPUBIRD1_t0008"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769082..769084,aa:Pro,seq:tgg)
     gene            769132..769207
                     /locus_tag="PPUBIRD1_RS03440"
                     /old_locus_tag="PPUBIRD1_t0009"
     tRNA            769132..769207
                     /locus_tag="PPUBIRD1_RS03440"
                     /old_locus_tag="PPUBIRD1_t0009"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769165..769167,aa:Lys,seq:ttt)
     gene            complement(769399..770694)
                     /locus_tag="PPUBIRD1_RS03445"
                     /old_locus_tag="PPUBIRD1_0678"
     CDS             complement(769399..770694)
                     /locus_tag="PPUBIRD1_RS03445"
                     /old_locus_tag="PPUBIRD1_0678"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003260618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_003247549.1"
                     /translation="MTHRIVIVGGGAGGLELATRLGKSLGKRKQAEITLVDTNLTHIW
                     KPLLHEVAAGSLNSSEDELNYVAQAKWNHFNFQLGRMSGLDREGKQIQLAATLDEEGR
                     ELLPARTLGYDTLVIAVGSNTNDFGTLGAAQHCLFLDTRKQAERFHQQLLNHYLRAHA
                     GDVASEKISVAIVGAGATGVELAAELHHAAHELAAYGLDRIQPKDMHITLIEAGPRVL
                     PALPERISVPVHKTLEKLGVKVMTNAAVSEVTEDGLKTKDGEVIQASLKVWAAGIRAP
                     GFLKDIDGLETNRINQLVVRPTLQTTRDDNIFAFGDCAACPQPGSDRNVPPRAQAAHQ
                     QASMLAQSLKARLENKALPTYEYKDYGSLVSLSRFSAVGNLMGNLMGSVKLEGWLARM
                     FYVSLYRMHQMALYGFFRTALMMLGSKIGRGTEPRLKLH"
     gene            complement(770779..770952)
                     /locus_tag="PPUBIRD1_RS03450"
                     /old_locus_tag="PPUBIRD1_0679"
     CDS             complement(770779..770952)
                     /locus_tag="PPUBIRD1_RS03450"
                     /old_locus_tag="PPUBIRD1_0679"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004577274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3094 domain-containing protein"
                     /protein_id="WP_008091951.1"
                     /translation="MTSRLNPEDQRRVDEYLRAPQHQVERRPFRPWLLLVLVLAVTIG
                     LGLISRLLSGLVL"
     gene            complement(771085..771714)
                     /locus_tag="PPUBIRD1_RS03455"
                     /old_locus_tag="PPUBIRD1_0680"
     CDS             complement(771085..771714)
                     /locus_tag="PPUBIRD1_RS03455"
                     /old_locus_tag="PPUBIRD1_0680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011266631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247546.1"
                     /translation="MDDSDYLRLLTIQAEQANAFLSNARKWERERWVCQRLLQGLNIP
                     YRSEDFTPAGQEPPDVLFRDAAFEVFFVLDEGRRLNDEWREELQRRRSAFSLAQLVRR
                     EARPRRISATELLGRLAPTLRKKAHNYRERGLELNELDIIAFSSLKREVLDLNTHFPP
                     PTEYLRQGWRSLSLVGPTFARVLFAHPDAPDFLRGNLGRSIVFDVGISL"
     gene            complement(771770..772201)
                     /locus_tag="PPUBIRD1_RS03460"
                     /old_locus_tag="PPUBIRD1_0681"
     CDS             complement(771770..772201)
                     /locus_tag="PPUBIRD1_RS03460"
                     /old_locus_tag="PPUBIRD1_0681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589598.1"
                     /translation="MLEGTNPALLLAAALNATIGVIHLAIIAVGPRWYRLFGAGERMA
                     VAAEKGRCYPALITAAIACVLLAWSAYALSAAGAIGRLPLLLPVICLITLVYLLRGLL
                     GPVLLAGTGRSQRFIVVSSLICLGFGLVHLVGLVQQWPVLG"
     gene            772288..772995
                     /locus_tag="PPUBIRD1_RS03465"
                     /old_locus_tag="PPUBIRD1_0682"
     CDS             772288..772995
                     /locus_tag="PPUBIRD1_RS03465"
                     /old_locus_tag="PPUBIRD1_0682"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020190540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589599.1"
                     /translation="MAAKGIVQVISAQVLSGTTLTLGWLGYVPLLIWAVSRVRWVELF
                     TDRRRQHLLFGTVFCLFALWLVRRDFDTGVSYHFIGMTAVTLLLDWPLAVLGGFMAQL
                     GLLALGRQDLAALGVNGLLLIGLPVLITEVCAIVVERAQPRNLFVYIFCSGFFPAALT
                     VLVCVPAALGVLWLDGRFALPEWLSDFVGYLWLMMFPEAFINGMVISALVVFCPEWLE
                     TFNRTRYLQAPWKEDER"
     gene            complement(773172..773372)
                     /locus_tag="PPUBIRD1_RS03470"
                     /old_locus_tag="PPUBIRD1_0683"
     CDS             complement(773172..773372)
                     /locus_tag="PPUBIRD1_RS03470"
                     /old_locus_tag="PPUBIRD1_0683"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003260624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor YacG"
                     /protein_id="WP_014589600.1"
                     /translation="MSQPLTVDCPTCGAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEE
                     HKIPGSEESEDELYSGDLEPRH"
     gene            complement(773369..773992)
                     /locus_tag="PPUBIRD1_RS03475"
                     /old_locus_tag="PPUBIRD1_0684"
     CDS             complement(773369..773992)
                     /locus_tag="PPUBIRD1_RS03475"
                     /old_locus_tag="PPUBIRD1_0684"
                     /EC_number="2.7.1.24"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437918.1"
                     /note="Dephospho-CoA kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_014589601.1"
                     /translation="MTTAAFTPWILGLTGGIGSGKSAAAERFVELGVHLVDADQAARW
                     VVEPGRPALASIVERFGPGVLQGDGQLDRAALRQLIFADPAQRKWLEQLLHPLIGQEI
                     FSYLAKAQSPYAVYVSPLLIESGQYHKTQRVLVIDAPQDLQIARTLARDNTSAEQVQA
                     ILQAQLAREDRLRHADDVVVNDGGLAALHEQIDRLHHFYLTLKGGQP"
     gene            complement(773992..774858)
                     /locus_tag="PPUBIRD1_RS03480"
                     /old_locus_tag="PPUBIRD1_0685"
     CDS             complement(773992..774858)
                     /locus_tag="PPUBIRD1_RS03480"
                     /old_locus_tag="PPUBIRD1_0685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin peptidase"
                     /protein_id="WP_019437919.1"
                     /translation="MTLWALLVEQPAYFLTLATVLGLLVGSFINVLVYRLPIMLERQW
                     QREAQEVLGLPTTQHARFDLCLPASRCPHCAHRIRAWENIPVISYLALGGRCSSCKNR
                     ISLRYPVVEVASALLSLVVAWRFGASVEALLALPLTWCLLALSLIDADHQLLPDVLVL
                     PTMWLGLIVNAFGIHVPLADALWGAVAGYLSLWTVYWVFRLVTGKEGMGYGDFKLMAL
                     IGAWGGWQVLPLTLLLSSVVGALVGLCLLRFRRHALGTAIPFGPYLAIAGWIAVLWGD
                     EIYASYIQLLGY"
     gene            complement(774861..776069)
                     /locus_tag="PPUBIRD1_RS03485"
                     /old_locus_tag="PPUBIRD1_0686"
     CDS             complement(774861..776069)
                     /locus_tag="PPUBIRD1_RS03485"
                     /old_locus_tag="PPUBIRD1_0686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019097783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="WP_041166836.1"
                     /translation="MTSSSLLYRWHGTDANGAPVSGQTPGRSPAYVRAGLIRQGITVA
                     SLQPASGLAFSLPKRREKADPAGFSRQLATLLKAGVPLLQAFEVMGRSGCDAAQAALL
                     ERLKQDVASGLGLADALQRHPAWFDALYCNLVRVGEQSGTLDRQLEQLAGMLEQRRVL
                     HKKVRKAMIYPLLLLLTGLGVSAILLLEVIPKFESMFSGMGAALPAFTQWVINLSTGL
                     SRFAPLLLVMGLVLGVAVRQLYRQHAPARLWISWRVLGLPVFGKLLGQAALARFARSL
                     ATSYGAGVPLLDALGTVARVTGGDLHEQAVLRLRQGMANGQGLNQAMAGEPLFPPLLV
                     QLTAIGESSGTLDQMLEKAASHYEEQVSQALDQLTSLLEPAIVLILGLLVGGLVVAMY
                     LPIFQLGSLI"
     gene            776286..776696
                     /locus_tag="PPUBIRD1_RS03490"
                     /old_locus_tag="PPUBIRD1_0687"
     CDS             776286..776696
                     /locus_tag="PPUBIRD1_RS03490"
                     /old_locus_tag="PPUBIRD1_0687"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_033701422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prepilin-type cleavage/methylation
                     domain-containing protein"
                     /protein_id="WP_014589604.1"
                     /translation="MKGQRGITLIELMIVVAIIGILATIALPMYTNHQARSKAAAGLL
                     EISALKTAMDLRLNDGKDVADVAALGGQPATAHCAITASGKAADGSGSIVCTLVDAPA
                     NALGKALILTRSASGWACTTDIEEDLAPKGCKGA"
     gene            776768..776843
                     /locus_tag="PPUBIRD1_RS03495"
                     /old_locus_tag="PPUBIRD1_t0010"
     tRNA            776768..776843
                     /locus_tag="PPUBIRD1_RS03495"
                     /old_locus_tag="PPUBIRD1_t0010"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:776801..776803,aa:Thr,seq:cgt)
     gene            777093..778247
                     /locus_tag="PPUBIRD1_RS03500"
                     /old_locus_tag="PPUBIRD1_0688"
     CDS             777093..778247
                     /locus_tag="PPUBIRD1_RS03500"
                     /old_locus_tag="PPUBIRD1_0688"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019408906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="filamentation induced by cAMP protein Fic"
                     /protein_id="WP_014589605.1"
                     /translation="MPQFSHHDLQLLNPSFDSPLVDVLAELEFLRRLRLEGDTPPQVF
                     FQLKALFHTLESLGSARIEGNHTTLADYIDSKVEGKAESTDQLLEIANIEKAMDYIEA
                     VIEPGADLTEHTIRELHAMTVLGLRREGDKTPGAYREGAVRIAQAEHLPPEGVLVPQY
                     MQELVSFINRDDSPKYALMKVALAHHRFGWIHPFGNGNGRVVRLLTYALLMKYGFNVN
                     TGGRVLNPTAVFCNDRDKYYTMLGLADTGTAAGLEAWCTYVLQGIRDELEKVDKLTDY
                     GYLTKCILLPAVSFARSREWITETEEQILVSVIKMKVVKSSDIAQALPALTANQRTYQ
                     IKNLVEQGMLLPINPGSRQYTIGFSNNYLVRGVIKALREQGFIPEPLDRP"
     gene            778879..779126
                     /locus_tag="PPUBIRD1_RS26055"
                     /pseudo
     CDS             778879..779126
                     /locus_tag="PPUBIRD1_RS26055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017338156.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            779692..780396
                     /locus_tag="PPUBIRD1_RS03505"
     CDS             779692..780396
                     /locus_tag="PPUBIRD1_RS03505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017045618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166837.1"
                     /translation="MIYLGGTDFYIDVPSLPRHEFEQYSTKLFDEWEAYVENALKIPD
                     YSLALEVEEGSIKGSAKVAAALGAIYIGIGQYGSFISGLQTIRGQVSAVGSFLAAQAS
                     TPFPYGEVKPKIKKYNGALGDLQRLFNKVQQGEITAEQAMLKAELILGDEVSSEPGFM
                     VELKDSFESTTLLTRQLDLPLNNFEQGSVLQLDNKMRKPRVPRPKPELPIGQQFRVEV
                     WRESKKKKRKVRVIQL"
     gene            780478..781311
                     /locus_tag="PPUBIRD1_RS03510"
     CDS             780478..781311
                     /locus_tag="PPUBIRD1_RS03510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017049926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166838.1"
                     /translation="MRKPRIFIASAVESLDVADAFNVNLDHQTEVTVWKHGFNLSQNT
                     IDSLVKMAESVDFAIFIFTPDDIAEIRDQQKHVVRDNVLFELGLFVGTLGKERCFIVK
                     PRDTELHFPTDLLGLTPADYNGGRSDGNLEAAVNHPCVLIKKEVANLGLLSQDLNIHT
                     KPRRKAGYNYKLGDVEHRLLAKVLESYASSPDGVSVWSTFNNLKGVEQGVLSLAAIKL
                     ERVGFLDRSIAIDHEYNGSEYYSFTITADGIDYLLENEELLHKASKKVDVVDFNSDIP
                     F"
     gene            782550..783569
                     /locus_tag="PPUBIRD1_RS03515"
     CDS             782550..783569
                     /locus_tag="PPUBIRD1_RS03515"
                     /inference="COORDINATES: protein motif:HMM:PF13020.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166839.1"
                     /translation="MPAKKPLLMFRVGYMLQYDGIAEIKGGGSHIEKHGEGGEMWNFR
                     PESGRCYGYVMTRHFSGIDLSRIDGSKSWHENEELEGIDIVFFAKKPEGGQTVIGWYK
                     NATVFHKVYRKRRGMKTHGDWEKLDYLCEVDAENAVLLDESDRTFEVPYAPVHGKGYP
                     GHSNVWYGDAKEPRSQDFLKDLSNYIDQYSKAADKSSGACKLGSRSSQYDQELISNIE
                     KAAIRTTWDHYESLGYKLTSVEKDNRGWDLEALKGVELLRLEVKGHLGNVVQFELTPN
                     EYMQMQGNAFSYRVCMVRTCLSTPELTILFPKKIGQDWMLETSDLKVRVQLSEKIAAK
                     AYEVI"
     gene            783660..783950
                     /locus_tag="PPUBIRD1_RS03520"
     CDS             783660..783950
                     /locus_tag="PPUBIRD1_RS03520"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166840.1"
                     /translation="MTSKILIELDKEDEVRANLQDLLGDVVFIDAKRFDGADVLQILA
                     ALNTVTIPVLGKIAIERIRSNRHVVIKKDGVVVSGLSADNAIKVLNKLANND"
     gene            784405..785097
                     /locus_tag="PPUBIRD1_RS03525"
     CDS             784405..785097
                     /locus_tag="PPUBIRD1_RS03525"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166841.1"
                     /translation="MAHEVAHSRWCLDKDNLNKEVSRHIDEFICEGSGFYINASNSLS
                     GYYKAALDQAPAGFLEEIFADDFGALIAFRVADRLGVPAWQRAAGVILAFKYMRLFRY
                     LDLLAHRIAKLSAETDAKSFKRKIKVLKKDILNGNTEDIRLYQFREHFIRHRLRIACS
                     RISSYDASDEVKISALIDDYETNTEQPIVLDLIERLSKRLKFKVWVDLNKKISAHRDG
                     VALVDEMTGWAK"
     gene            complement(785473..787005)
                     /locus_tag="PPUBIRD1_RS03530"
                     /old_locus_tag="PPUBIRD1_0692"
     CDS             complement(785473..787005)
                     /locus_tag="PPUBIRD1_RS03530"
                     /old_locus_tag="PPUBIRD1_0692"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010954007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
                     /protein_id="WP_014589608.1"
                     /translation="MISMPENLPDDPVLLKQLLEQMISERASDKGKIVHLEEEVALLR
                     QRLFERKTEQTGDAATPQLPLFDEAESLAEPLDEADDEEVVAPTKRRGKRKPLPADLP
                     RIEVVHELPEHELTCACGCRKHAIVEEVSEQLEIVPMQIRVIKHVRKVYGCRDCESAP
                     VTADKPAQMIEKSMASPSVLAMLLTTKYVDGLPLHRFEKVLGRHGIDIPRQTLARWVI
                     QCSKHFQPLLNLMRESLLNSWIIHCDETRVQVLKEPSREPSSQSWMWVQTGGPSDRPV
                     ILYDYATSRAQEVPVRLLDGYRGYVMTDDYAGYNALAAQDGLERLGCWVHARRKFVEA
                     HKVQPKGKTGRADIALNLINKLYGVERDLKDSDDEDRKVARMERSLPLLTQLNNWVEK
                     TQPQVTTQNALGKAIGYLASNWSKLARYVEHGYLPMDNNAAERAIRPFVIGRKNWLFS
                     DTPKGATASAQLYSLVETAKANGQEPYAWLRHALERLPQACSVEDYEALLPWNCTPQI
                     HS"
     gene            complement(787159..787380)
                     /locus_tag="PPUBIRD1_RS03535"
                     /old_locus_tag="PPUBIRD1_0693"
     CDS             complement(787159..787380)
                     /locus_tag="PPUBIRD1_RS03535"
                     /old_locus_tag="PPUBIRD1_0693"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007245788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_080557840.1"
                     /translation="MRPDAKVEKVYLYPKLVDFRKSIDGLAALVELDIKVAVFDPVLF
                     VFLNKPRNRVKILYWERNGFCLWLKRLES"
     gene            complement(787745..788386)
                     /locus_tag="PPUBIRD1_RS25860"
     CDS             complement(787745..788386)
                     /locus_tag="PPUBIRD1_RS25860"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049870065.1"
                     /translation="MTVNIFKVDQYQTEAFTKAIRSRFDILRLWMDSIKVIINYFPPH
                     EAITAAEIHIHNSRMSRLFYSSGPKTFSVAFPFRVEADAGSFTVKTISGIDIDSRLSS
                     EILLIASLLKNNGLINEWTLAEHFESQGGASNDFWPVLAELLDAEDGYLRFDHDPDRR
                     DGHKHPLDHADLFYTNGASFKIGLHKKIALDEIIDILNRETDCHYLGRVTERK"
     gene            complement(788393..790399)
                     /locus_tag="PPUBIRD1_RS03545"
                     /old_locus_tag="PPUBIRD1_0694"
     CDS             complement(788393..790399)
                     /locus_tag="PPUBIRD1_RS03545"
                     /old_locus_tag="PPUBIRD1_0694"
                     /inference="COORDINATES: protein motif:HMM:PF13538.4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_014589610.1"
                     /translation="MSSYIFSSIEASAEIEGFLHELADWCAEKFVQCYIIDKPLIEVK
                     GNYESDKCFAILIPKRKIVFASCSTDENTLSEYADDFVEDIGYISTKFNYKEKIGRPK
                     RWQNILTSQKPNAENLSIAEYLEASELDNPEEQRLSELLVSLATGSINDIERVGVEVP
                     ENDLDRIKRNILLFDGDQTRFVYQDLKQKEVRIQGLSGTGKTELLLHKLKELYVADDS
                     SKIAVTCHNKILAANLRARIPKFFNFMKVEQQIEWNQRLLCVHAWGSSGQPYSGAYAA
                     ICSAYDIPCHPWSRSMDFDRACSLSLEALKAKGGTDGVYAFDYMLIDESQDFPESFFV
                     LCELATKNSLFIAGDIFQSIFDERKNAGAKAEFTLSKCYRTAPTTLMFAQALAMGYFE
                     DRKLNWLDNDDLDACGYQNHTDPHTGELILKREPISRFEDISQESRSVDLIRLNGEYR
                     QQSCLQIIECIRDIKRQYPNVTANDVGIIMIDKGKAIYEMSDMLAQIIPREVGWPVNK
                     AYESGNPSKDGELFLSNTNHVKGLEFPFVICVTSHLSESFNHRNALYMAITRSFLKTY
                     FLVPNGAMNQTLDRIQEGLEKISESGVLRVMPPPAEEQDRIRASVKWHGRLKSFDDLA
                     LDILTELGTPESQVARYLNAMKSLLDPDASKVEIHKLARKLTSE"
     gene            791520..791732
                     /locus_tag="PPUBIRD1_RS03550"
                     /old_locus_tag="PPUBIRD1_0695"
     CDS             791520..791732
                     /locus_tag="PPUBIRD1_RS03550"
                     /old_locus_tag="PPUBIRD1_0695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589611.1"
                     /translation="MSDQERLSTIQSYAWTLELLGEALVQHDEMLECEHNPRLSFRNT
                     AGIHQAIRIISRLASEQCGKVMEQGG"
     gene            791977..792675
                     /locus_tag="PPUBIRD1_RS03555"
                     /old_locus_tag="PPUBIRD1_0696"
     CDS             791977..792675
                     /locus_tag="PPUBIRD1_RS03555"
                     /old_locus_tag="PPUBIRD1_0696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589612.1"
                     /translation="MDQNRDSLKTTNPIAGLPGAVFEKAWEVRWALKLAYVGLFIDIA
                     LMHSLGTTLLGFSGDMAIVWENVGRIFVGIMVFCLVVSVVIPVLARVAAIMGSFVPWY
                     RLQGPRDYSLFPNYVTFSALREHSLREGNEFLYNYWKRLTVQREEWRQQRFQAGVLVF
                     GLVLMAIANAGVSAHFQLPGLMAYFTFWFGWKGYALLSIVTLYLLHWAWWSSDEIGQI
                     YYPPLAEKLKKNQY"
     gene            complement(792772..794157)
                     /locus_tag="PPUBIRD1_RS03560"
                     /old_locus_tag="PPUBIRD1_0697"
     CDS             complement(792772..794157)
                     /locus_tag="PPUBIRD1_RS03560"
                     /old_locus_tag="PPUBIRD1_0697"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010449199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="WP_014589613.1"
                     /translation="MTPLDIQLLLTALASVLVLVALIVSRLKMHPLLALLVVSIGVGF
                     ATHMAPGSIVSHLLTGAGKTLGAVGVVIALGAMLGKILADAGVTEQVADVILKRTSDR
                     MIPWAMMLVAFVIGIPMFFEVGLVIMLPLIFSVARKLESKARFKGSAYVYVGVPVISA
                     LAAMHGMVPPHPGPLTAIAVLKTSVGPTMLYGFVAAIPAMILGGPLYGMFISPRMNTR
                     PDQALLDQFTLTEKADGQPRPGVMVGMLAALLPAILMLVHAVAEMLLPKGNALLEMAS
                     FLGNPLIAMLLGVLFAGASLVLARGGDAEQLRDALGKSLKPIASIIMIIAGGGAFQEM
                     LTSAKVGDAIVHLTQQSAFPPLILGWLIAMLLSVSTGSATVGIVGAAGLLAPLAGADP
                     SLNLPLLALSIGCGSLFFNYANHAGFWMVKESFGMTMGEATKTISVVQSIVAVVGLIV
                     VLLLNAAIAVS"
     gene            complement(794154..794435)
                     /locus_tag="PPUBIRD1_RS26060"
     CDS             complement(794154..794435)
                     /locus_tag="PPUBIRD1_RS26060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557762.1"
                     /translation="MTIQQGESINEHAVQAPRRHTTTHRPQRHASLLPIFRCQAAACE
                     RQLAQSRVPFLETVAAAAMAATWVCPVETPVTPSNPECSRAPAQPRFLE"
     gene            794590..795519
                     /locus_tag="PPUBIRD1_RS03565"
                     /old_locus_tag="PPUBIRD1_0698"
     CDS             794590..795519
                     /locus_tag="PPUBIRD1_RS03565"
                     /old_locus_tag="PPUBIRD1_0698"
                     /EC_number="1.1.1.37"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_014589614.1"
                     /translation="MNKLTIVGAGLVGEAAAQIIARDELCRELVLMDVQGELAQGKAL
                     DVWQAAVDSGSDTHVHGGAKAEMLEGSELVVITAGVPRKPGQSRQDVLSTNLPILDSI
                     MADIKHHAPTATVLVVSNPVDVLTYRAWSVSGQGRDKVFGQAGVLDTARMKCFIAEQT
                     GFSARDITALVLGGHGDSMVPLMRYCQIGSVPLSHFLSSEQIEQIVERTRKGGGEILG
                     LKKTGSACDAPGVAIAQMVDAIANGRNRILPAVAILEGEYGRTDIAMGVPCVLAEKGL
                     ARVIELPLDAQEQAMFDHSADQVARDIAEMKAL"
     gene            complement(795625..796446)
                     /locus_tag="PPUBIRD1_RS03570"
                     /old_locus_tag="PPUBIRD1_0699"
     CDS             complement(795625..796446)
                     /locus_tag="PPUBIRD1_RS03570"
                     /old_locus_tag="PPUBIRD1_0699"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009686081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_003247513.1"
                     /translation="MSTFPPSPKPVAKPAGAGLFGFRTRLLLTWLALFGLFVAFFLSF
                     DLKFAIILEKFPNLAGFKLGPNGFLQGAALTLFLCLCSMVVSVLLGFAAALARLSNSA
                     VLVGVASFYTSFFRGTPLLIQILLIYLGLPQVGLVPGAISAGIIALSLNYGAYLSEIF
                     RAGILGVARGQREAALALGMRTPQIFCHIILPQAMRVIIPPTANQFISMLKDSSLISV
                     MGVWEVMFLAQSYGRSSYRYLEMLTTAAVIYWVLSILLELLQARLERHFGKAYQR"
     gene            complement(796443..797264)
                     /locus_tag="PPUBIRD1_RS03575"
                     /old_locus_tag="PPUBIRD1_0700"
     CDS             complement(796443..797264)
                     /locus_tag="PPUBIRD1_RS03575"
                     /old_locus_tag="PPUBIRD1_0700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003247511.1"
                     /translation="MRFSSLLGAGLVLLATATQAFAGATLERVESRKEMVNVLMESYP
                     PFSFLNDHNQLDGYDVDVAKAVADKLGVKLRLETPSWDVIAAGRWSGRYDICICSMTP
                     SKARAEVFDFPVEYYASPAVIVVNASDERIHGAKDLEGRKVGSISASSYESYLNKNLV
                     IEGKEDQKIDYPFDFVQAAPYDTENVAFQDLGLGTGVRLDAIITNLVTAQPRLQQDKR
                     FKLAGAPLYEEPNAVAIEKGDPEWDAKVRQVFAELKADGTLAKLSQKWIGADISK"
     gene            797368..798267
                     /locus_tag="PPUBIRD1_RS03580"
                     /old_locus_tag="PPUBIRD1_0701"
     CDS             797368..798267
                     /locus_tag="PPUBIRD1_RS03580"
                     /old_locus_tag="PPUBIRD1_0701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019361903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine S-methyltransferase"
                     /protein_id="WP_033724844.1"
                     /translation="MAERTMVILDGGMGRELQRSGAPFRQPEWSALALSEAPEAVVGV
                     HAAFIDAGAQVITSNSYAVVPFHIGEERFAAEGRQLAHIAGQLARHAADSGAHPVRVA
                     GSLPPLFGSYRPDLFQSERVAEVLTPLLQGLAPHVDLWLAETQSSVAEVRAIHSHLPA
                     DGRPFWVSFTLQDEDVDEVPRLRSGEPVAEAIEAAVSLGVAAVLFNCSQPEVIGAAID
                     VARSVIERHNAEIAIGAYANAFPPQPKEATANDGLDELREDLDPPGYLAWAKDWRARG
                     ASMVGGCCGIGPEHIAELKRNLA"
     gene            798435..799706
                     /locus_tag="PPUBIRD1_RS03585"
                     /old_locus_tag="PPUBIRD1_0702"
     CDS             798435..799706
                     /locus_tag="PPUBIRD1_RS03585"
                     /old_locus_tag="PPUBIRD1_0702"
                     /EC_number="2.5.1.48"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020193339.1"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_010951917.1"
                     /translation="MNNNEKFEGNAAAGVGTRVVWSGEQVQHPYNATQTPIVVSAAYG
                     YNDIDAWYDVAQGKQPGFIYSRMSNPTVATLEAKLAELEQAESAVAFSSGMAAISAVL
                     HTFLSNGKRVVSTRDSYGGTNKIFEEFLPRMGVQVCLCDTLDTEALEREIAAGCDLLY
                     LETPTNPTLKVLDIRRLSAAAHKVGALVVADNTFATPLNQNPLALGVDVVVHSATKFL
                     SGHGDVLGGVVCGAEALMAQVRHYREINGAALDPFSAYLIIRGIKTLAVRLRQQQASA
                     MALAHYLSTEPLVEAVNYPGLPAHAGHAIAKAQMRGFGAIVSFVLKGGMPTVARLLPR
                     LKYAHRAGNLGAVETIYGPARTTSHVENTLEERLALGISEGLVRISVGIEETDDLLAD
                     LAQACASVREELAVAKELHADADACQSPVQA"
     gene            799906..801288
                     /locus_tag="PPUBIRD1_RS03590"
                     /old_locus_tag="PPUBIRD1_0703"
     CDS             799906..801288
                     /locus_tag="PPUBIRD1_RS03590"
                     /old_locus_tag="PPUBIRD1_0703"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="WP_019437932.1"
                     /translation="MQTRHIVMLALGGVIGTGLFLTSGYTVNQAGPLGAVIAYILGAI
                     MVYLVMMCLGELAVHMPEVGSFSSYATRYLGPGTGYMVAWMYWLTWTVAIGSEFTAAG
                     ILMVRWFPDTPVWMWSALFGAAVFISNIISVRSFAETEFWLSLVKVLAVIAFLVVGGG
                     AILGGFEIQQAHSAGLGNFTREGLFPTGFWSIAMTLLAVAFAFSGTELIGIAAGETKD
                     PEKNVPKAIRTTVLRLALFFIGTIFVLATLLPREQAGVIESPFVMVFAMIGIPYAADI
                     MNFVIITALLSAANSGLYAASRMLWTLSDQGNMPRRYATLSRRGTPFNAIVLSMAGGM
                     ASLLSSVFAPDTIYLALVSISGLAVVVVWISIAASQIAFRRHYIASGGKLEDLKFRVR
                     GYPFVPLGAIFCCVLACVGIAFDPAQRVALYFGLPFIAWCYLAYWLTCKYRSRRTGPV
                     EIVAPGSEAA"
     gene            801334..802218
                     /locus_tag="PPUBIRD1_RS03595"
                     /old_locus_tag="PPUBIRD1_0704"
     CDS             801334..802218
                     /locus_tag="PPUBIRD1_RS03595"
                     /old_locus_tag="PPUBIRD1_0704"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589618.1"
                     /translation="MTQKTLPPLNWLRAFEVSARYLNFTHAAEELHLTQGAVSQQIRH
                     LESQLGVALFKRLPRGLGLTEEGQSYLPVVQDAISRLAVGTNEIFGQRQRRPLKVRGS
                     LSFLHFWLAPRLADFRRSHPQVDIRYISNLWVKELDAEDDLEIRWGSGQWAGVEAQRL
                     TRDVLVPVCAPALLASCPLRDPRDLARVPLLHVLGYEEGWGYWLERVGADQVDSSSGL
                     QFDTLVSTLRMAELGLGVALARSSLVEDLLQEGRLVAPFAQRIEASESFFLVRGLGEA
                     LSPDAQAFSHWLVAMAHR"
     gene            802243..803631
                     /locus_tag="PPUBIRD1_RS03600"
                     /old_locus_tag="PPUBIRD1_0705"
     CDS             802243..803631
                     /locus_tag="PPUBIRD1_RS03600"
                     /old_locus_tag="PPUBIRD1_0705"
                     /EC_number="4.2.3.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020193337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_014589619.1"
                     /translation="MQYTSTRGNEIRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIA
                     SWSWLPFDELAWRVMAPFVGDTLDEPTLRALVSDSYRGFRHRGIAPLQQLGHNEWILQ
                     LFHGPTRSSKDFAAQLQARFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGL
                     LALYPSAGTPADRAAVMRSAASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSF
                     NSTNWVGVLAQIVFYFHAALQLGGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQII
                     VSTNRNDALHRFIHCNRYSRGSTSQTLSPVMDFSLFSNLERFVWELYDRDGGATRALM
                     EHFEACGELSIGNRQWLHARMLFDSYAVDDVLIREEIVTLFHETGSAVDPHAATGVFA
                     GRLHRRNIGAPIVTLGQFAPEKSAGLLAELGAWHGEVPAGAVGTAGDEPLLAPDDLAG
                     VHALLARLQAGR"
     gene            803628..804065
                     /locus_tag="PPUBIRD1_RS03605"
                     /old_locus_tag="PPUBIRD1_0706"
     CDS             803628..804065
                     /locus_tag="PPUBIRD1_RS03605"
                     /old_locus_tag="PPUBIRD1_0706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lrp/AsnC family transcriptional regulator"
                     /protein_id="WP_014589620.1"
                     /translation="MKRILDPLDERILAELTANARIAHAELGLKVNLSRNAVRQRIER
                     LERDGAIQGYTLRIGEGRRPASLINAVIFVYRYDRMRGDAVLDALRQIPEVIQCEVLS
                     GEFDLMLRVEASSPERVHHVWKEIAAMPGVENTVTSFVLAAVV"
     gene            804264..805307
                     /locus_tag="PPUBIRD1_RS03610"
                     /old_locus_tag="PPUBIRD1_0707"
     CDS             804264..805307
                     /locus_tag="PPUBIRD1_RS03610"
                     /old_locus_tag="PPUBIRD1_0707"
                     /EC_number="1.1.1.3"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_014589621.1"
                     /translation="MTEYKIALVGFGGVNRALAQLIAERNARWQQELGFGLKIVGVTD
                     LFLGSVIDRDGLDAAMLAALPAQKGALAQIPQGSAEAFNEAVIKQSGADIIAEATFTN
                     PKDGEPAATFCRWALEAGKHVVTTNKGPIALHAQALKALAKANDVSFEYEGAVMSGTP
                     VLRMARQTLAGAGLVGFEGILNGTSNYVLTRMEEGLGFNEAVAQAQALGFAEADPTAD
                     VEGHDVRLKVVILANELLGACLQVGDVACSGISAIDSAAIERAQAAGERWKLIGSARR
                     EADGSVRASVEAKLLPGHHPLAGISGATNALAFDTELLGAVTVSGPGAGRIETAFALL
                     SDIVAIHAAGHSA"
     gene            805320..806738
                     /locus_tag="PPUBIRD1_RS03615"
                     /old_locus_tag="PPUBIRD1_0708"
     CDS             805320..806738
                     /locus_tag="PPUBIRD1_RS03615"
                     /old_locus_tag="PPUBIRD1_0708"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020193335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_014589622.1"
                     /translation="MSLTSVSRALVQQPALIDVYNPFDGSLVGSVDNLGAEAVPALLA
                     RARQGVRESAALPRHRRAHILEHAAQLIERDAADFAGLIVDEAGKTLRQAEKEVKRCI
                     NTLKLSAEEARRNAGEVVPFDAYEGSESRQGWFTREPLGLILAITPYNDPLNLVAHKL
                     GPALAGGNAVILKPSELAPLSALKLVQYLVDAGLPEAVVTVATGGAELGKALVAVREV
                     RMVSFTGGFATGEKIAHGAGLKKLAMDLGGNAPVLVLKDCDLEATVESCVSGAFWAAG
                     QNCIGTQRILVDASIYEAFRERFVALTQAMVWGDPGRRETDMGPMITEAAARQIEERV
                     NQALEGGARLLCGHQRQGAVYAPTVLESVDPVSRLWLEEVFAPVVMLAPFETVEQAIA
                     LANAPEYSLHAGVFTRDLSLALSLARRIEAGGVMINDSSDYRFDAMPFGGAKYGSLGR
                     EGVRFAYEDMTQPKVVCFNQMG"
     gene            806785..807102
                     /locus_tag="PPUBIRD1_RS03620"
                     /old_locus_tag="PPUBIRD1_0709"
     CDS             806785..807102
                     /locus_tag="PPUBIRD1_RS03620"
                     /old_locus_tag="PPUBIRD1_0709"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020193334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RidA/YER057c/UK114 family protein"
                     /protein_id="WP_014589623.1"
                     /translation="MSLAVSYRGLFETAGIVADDLQQDVQGQLRQALSVIDGLMGQAN
                     VGKAQLTRVQMWLADYRHFDLVNEVYDAWLQGCAKPVRACVGADLGAGYLVEVQVFAV
                     CPE"
     gene            complement(807130..808083)
                     /locus_tag="PPUBIRD1_RS03625"
                     /old_locus_tag="PPUBIRD1_0710"
     CDS             complement(807130..808083)
                     /locus_tag="PPUBIRD1_RS03625"
                     /old_locus_tag="PPUBIRD1_0710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic resistance protein"
                     /protein_id="WP_014589624.1"
                     /translation="MTREQLETRQIPIYFAAVLAAIVFGLLASDTARQLEALITPAIA
                     VLMYAMFLQIPFLDLRQGLGNRRFITALLLANFMLVPLLVWAITRGLVEHPAILVGAL
                     LVLLTPCIDYVVVFTHIGKGDSRLTLAATPVLLLAQLVLLPVYLALMLGGGSQVAISI
                     TPFVEAFVLLIVVPMALAVLTSAGARRSRAVATWNDAWAWLPVPAMALVLMVVIASQI
                     VVVLRDFDRLLPVVPVYIGFMLLAPVLGFICARLLRLPASEARSVTFSAATRNSLVVL
                     PLALALPEEMRGLAAAAVITQTLVELVSELIYVRAVPRFVH"
     gene            complement(808332..809585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS03630"
                     /old_locus_tag="PPUBIRD1_0711"
     CDS             complement(808332..809585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS03630"
                     /old_locus_tag="PPUBIRD1_0711"
                     /EC_number="2.1.2.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_253292.1"
                     /note="Serine hydroxymethyltransferase 2; catalyzes the
                     reaction of glycine with 5,10-methylenetetrahydrofolate to
                     form L-serine and tetrahydrofolate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_014589625.1"
                     /translation="MFSRDLTIAKYDAELFEAMQQEALRQEEHIELIASENYTSPAVM
                     EAQGSVLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHAGSQAN
                     AAVYLALLSAGDTILGMSLAHGGHLTHGASVSSSGKLYNAIQYGIDGNGLIDYDEVER
                     LAVEHKPKMIVAGFSAYSQVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGVYPNPVP
                     FADVVTTTTHKTLRGPRGGLILARANADIEKKLNSAVFPGAQGGPLEHVIAAKAICFK
                     EALQPEFKAYQQQVVKNAQAMASVFIERGFDVVSGGTQNHLFLLSLIKQEISGKDADA
                     ALGKAFITVNKNSVPNDPRSPFVTSGLRFGTPAVTTRGFKEAECKELASWICDILADL
                     NNEAVIDAVREKVKAICKKLPVYGN"
     gene            complement(809892..813722)
                     /locus_tag="PPUBIRD1_RS03635"
                     /old_locus_tag="PPUBIRD1_0712"
     CDS             complement(809892..813722)
                     /locus_tag="PPUBIRD1_RS03635"
                     /old_locus_tag="PPUBIRD1_0712"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008091994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GGDEF domain-containing protein"
                     /protein_id="WP_014589626.1"
                     /translation="MTNLTHPSSLRSAPQAPATILRGSIKGALALLALILLGLLLWQL
                     FAQFNHTQAELRKQSLDASAELADHLSLNMALKAQQAVNVVQPYLDAPTPAALPSLLG
                     TLRERLPALQSVAWLDNTGQLRADSLAGSPDRQSLDELLVLSQGRPYFFTNSADNHIL
                     YLLLRQDASQGSGYWLLRLSPDYYRELTLHLEGSGHPQWLLENSRSGEVLQRHAAADT
                     SDEPLQSVMLAFIENSTWQLRGLFDAKLAQQKLLPALLGKCLLVLFCALLPVLALINM
                     RRRQRALQEDRRRYQEIFEGTGVALCVLDLSSLPGQLDRYHLRNRAALKHSLALDPNL
                     RRSLLLELKITEVNQVARQLLNIHCHEGAWQRLIDGTGDSRDSVGMQLIDALIEQRPL
                     LELEVRLPTPQGTELHLWLMARLPLQRRDYQAVILSISDITSRKQVELSLLERESFWS
                     DVVRTVPDQLYVQDVPSQRMIFSNRHLGQTLGYDRTELAQMGDRFWELLLHPEDAAHY
                     QALRQQQRDSGHDQPLHCQLRFRHRDGSWRCYDIREQVLSRNAEGLVTRIIGVGKDVT
                     VQIEASQSLRDSEQRYRMLAESISDVIFSTDNQLKLNYVSPSVQSVLGYQADWIFANG
                     WQSIVANPAQLTGIYSLMERVSKAMGDPAQMAQLCSQLPTQLFLFDCLRADGRKIPIE
                     LRLVLVWDDDQRFEGVLGVGRDISQQRRAEKDLRMAATVFEHSTSAILITDPAGYIVQ
                     ANEAFSRVSGYAVSEVLDQLPGMLTVDEQQEGHLRYVVKQLHQRGSWEGEVWLKRRDG
                     DHYPAWVGITAVLDDEGDLASYVCFFTDISERKASEQRIHRLAYYDALTHLPNRTLFQ
                     DRLYNALQQAERQKAWVVLMFLDLDRFKPINDSLGHAAGDRMLKDMALRLLACVDDDD
                     TVARMGGDEFTLLLQPRPTREMALNRAIHVAENILGSLVRPFVLENREFFVTASIGIA
                     LSPQDGSELSQLMKNADTAMYHAKERGKNNFQFYQAEMNASALERLELESDLRHAMEQ
                     NEFILYYQPQFSGDGKRLTGAEALLRWRHPTRGLVPPGDFIPVIEELGLVVDVGDWVL
                     REASRQLKAWHKAKVRVPKVSVNISARQFSDGQLGTRIANILEESGLPPACLELELTE
                     SILMREVNEALQILASLKNLGLSIAVDDFGTGYSSLNYLKQFPIDVLKIDRTFVDGLP
                     EGEQDAQIARAIIAMAHSLNLAVIAEGVETHEQLEFLREHGCDEVQGYLFGRPMPAHQ
                     FEAQFSNETLFMFH"
     gene            813971..814375
                     /locus_tag="PPUBIRD1_RS03640"
                     /old_locus_tag="PPUBIRD1_0713"
     CDS             813971..814375
                     /locus_tag="PPUBIRD1_RS03640"
                     /old_locus_tag="PPUBIRD1_0713"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589627.1"
                     /translation="MVTHFSSNGLDSACGRSSQTLVSTAVTEDVSCKSCQRSLGKPEA
                     AAAAKSKAPSLAELRKTAKVAAEPAVAVAAAKPAAKVVSTAPAPAKPAKAAEQQPARS
                     GSFSVKSAWAARLAEQGDRCRLPRGKAKQRHV"
     gene            814680..816347
                     /locus_tag="PPUBIRD1_RS03645"
                     /old_locus_tag="PPUBIRD1_0714"
     CDS             814680..816347
                     /locus_tag="PPUBIRD1_RS03645"
                     /old_locus_tag="PPUBIRD1_0714"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003443957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy-dependent translational throttle protein
                     EttA"
                     /protein_id="WP_010951931.1"
                     /translation="MAQYVYTMHRLSKVVPPKREILKNISLSFFPGAKIGVLGLNGAG
                     KSTLLRIMAGVDKEFDGEARPMPDINVGYLPQEPQLDPTKTVREVVEEAVSVIKDAQA
                     RLDEVYAAYAEPDADFDKLAAEQAKLEAILQAADGHNLERQLDVAADALRLPAWDARI
                     EHLSGGEKRRVALCRLLLSAPDMLLLDEPTNHLDADSVAWLERFLHDFPGTVVAITHD
                     RYFLDNVAGWILELDRGAGIPYEGNYSGWLEAKSERLAQESKQQSAHEKAMKEELEWV
                     RKGAKARQSKSKARLQRFEEMQSQEFQKRSETNEIYIPAGPRLGDKVIEFKNVTKGYG
                     DRVLIDNLSFSMPKGAIVGVIGGNGAGKSTLFRMLMGKEQPDSGSIEIGETVQLACVD
                     QSREDLDGAKTVFQQISDGSDQIRIGNYEIPSRTYVGRFNFKGGDQQKFVKDLSGGER
                     GRLHLALTLKEGGNVLLLDEPSNDLDVETLRSLEEALLDFPGAAIVISHDRWFLDRVA
                     THILAYEDDSNVVFFEGNYTEYEADRKKRLGDAAAQPHRVRHKKLAQ"
     gene            816569..817909
                     /locus_tag="PPUBIRD1_RS03650"
                     /old_locus_tag="PPUBIRD1_0715"
     CDS             816569..817909
                     /locus_tag="PPUBIRD1_RS03650"
                     /old_locus_tag="PPUBIRD1_0715"
                     /EC_number="1.4.1.4"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_253278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014589628.1"
                     /translation="MIESVDNFLARLKQRDPGQPEFHQAVEEVLRTLWPFLEANPHYL
                     QSGILERMVEPERAVLFRVSWVDDQGKVQVNRGYRIQMSSAIGPYKGGLRFHPSVNLS
                     VLKFLAFEQVFKNSLTSLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADC
                     DVPAGDIGVGAREIGFMFGQYKRLANQFTSVLTGKGMTYGGSLIRPEATGYGCVYFAE
                     EMLKRQDKRIDGRRVAVSGSGNVAQYAARKVMDLGGKVISLSDSEGTLYAEAGLTDAQ
                     WDALMELKNVKRGRISELAGQFGLEFRKGQTPWSLPCDIALPCATQNELSAEDARTLL
                     RNGCICVAEGANMPTTLEAVDIFLDAGILYAPGKASNAGGVAVSGLEMSQNAMRLLWT
                     AGEVDSKLHNIMQSIHHACVHYGEEADGRINYVKGANIAGFVKVADAMLAQGVV"
     gene            complement(818074..818571)
                     /locus_tag="PPUBIRD1_RS03655"
                     /old_locus_tag="PPUBIRD1_0716"
     CDS             complement(818074..818571)
                     /locus_tag="PPUBIRD1_RS03655"
                     /old_locus_tag="PPUBIRD1_0716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012051151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor GreAB"
                     /protein_id="WP_014589629.1"
                     /translation="MSRAFVNEDQAADQADQPVERRISEQPNYVTASGLRQLQTRVAE
                     LNALRSELQAQGERGDKQRLADTERDLRYFSARVQSAQVVPAATSHSKVQIGSRVRFV
                     DAQDQEQLVQLVGEDEADAGRGLINWGSPLGRALLGAGPGDEVVWQRPVGEQVIEVVE
                     ILGEG"
     gene            complement(818639..818995)
                     /locus_tag="PPUBIRD1_RS03660"
                     /old_locus_tag="PPUBIRD1_0717"
     CDS             complement(818639..818995)
                     /locus_tag="PPUBIRD1_RS03660"
                     /old_locus_tag="PPUBIRD1_0717"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_003247495.1"
                     /translation="MSRYWFGVCIALLLSGCETTHEQMVNHGYPPAYADGFQDGCSSG
                     RQAAGLMVGNFRKNVPRYLHERQYETGWDDGFRQCHAMQNSEEQRQYHERFWDQRDRE
                     WEQEKDRGAAKAYRHN"
     gene            complement(819212..821065)
                     /locus_tag="PPUBIRD1_RS03665"
                     /old_locus_tag="PPUBIRD1_0718"
     CDS             complement(819212..821065)
                     /locus_tag="PPUBIRD1_RS03665"
                     /old_locus_tag="PPUBIRD1_0718"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589630.1"
                     /translation="MLKRLAALALCACAPVHAAPMLDPGRLQQLANTPYWLAIGHYET
                     AKLGGWRSYVDDDAFFLAEDGAHHPDQELKATVAALYAPASLGDKHAQCVFPARTRWL
                     REQLDLQDLPQPDCQEFKTWYQSIDPHSAALIFPAAYLNSPSSMFGHTLLRIDQSNTR
                     SDDTTLLSYAINFGAYIEGSDNSILYAWKGLMGGYPGLFALMPYQEKLSEYRSLENRD
                     LWEYQLDLTPEETGRMVEHVWELKQIQFDYFFFDENCSYRLLELLQVARPSLDLTSQF
                     PLTAIPTDTVKAVKQSGLVASETYRPSRERELLARAEPLDHDEKRQVLAVSADTAQLQ
                     SPEFQALPRERQALVQDAAYRLERYRANGQERDPGQAKRSFELLRAINSNPPPPLQTE
                     RPGLPEDGHDSRTWQLGVGTREDRAYAEYGLRMAYHDLNDNAYGFPLGAQIEILQLKL
                     RQYEGNDWQVQRLDLATIRSLTPRNELLKPWSWQVAGGLERVPGKHDDEVLVSHVNGG
                     AGGTWQLADGLLGFALGTVRVEHHNDFAQFIAPAAGFNGGLLWRNGLGNMTLEAKGDY
                     FTNGEVRRSVSLNQQWEISQNLGLRLSASREFSHLATAQNEVMLELKWYHY"
     gene            complement(821137..821625)
                     /locus_tag="PPUBIRD1_RS03670"
                     /old_locus_tag="PPUBIRD1_0719"
     CDS             complement(821137..821625)
                     /locus_tag="PPUBIRD1_RS03670"
                     /old_locus_tag="PPUBIRD1_0719"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019650956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247492.1"
                     /translation="MKRILLGTLFTVVSLNAMAEAPGGPNCGWGNMLFEGQRGTPAHF
                     LASTTNGTSGNATFGMTSGTNGCSTKASLTYGGKSWFAMNGMMNELSEDMAMGQGEAL
                     TTYAVVLGVAPEDRSYFNSVTHQHFNQIFSSADVTAETVHSNTLAVLKSDPRLAKYAT
                     EA"
     gene            821876..824314
                     /locus_tag="PPUBIRD1_RS03675"
                     /old_locus_tag="PPUBIRD1_0721"
     CDS             821876..824314
                     /locus_tag="PPUBIRD1_RS03675"
                     /old_locus_tag="PPUBIRD1_0721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017340867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_004575710.1"
                     /translation="MPDPVAARLRLAPEALTRRFSPEQFAFTHTDDLEPFRGVLGQER
                     AVEALQFGVAMPRPGYNVYVMGEPGTGRFSFVKRYLKAEGKRQQTPADWVYVNHFDDT
                     REPRALELPSGSAAEFISDMGGLIDNLLSTFPAVFEHPSYQQKKGAIDRAFNQRYDRA
                     LDVIERASLEKDVALYRDASNVAFTPMADGKALDEAEFAQLPEEVREQFHEDIALLEE
                     RLNEELASLPQWKRESNNQLRQLNEETITLALQPLLAPLSEKYAENAAVCAYLQSVQL
                     NLLRTLVEQLVDDSKSDAVARKLLEEQYAPSLVVGHHADGGAPVVFEPHPTYDNLFGR
                     IEYSTDQGALYTSYRQLRPGALHRANGGFLILEAEKMLGEPFVWDALKRALQSRKLKM
                     ESPIGELGRVATVSLQPQVIPLNVKLVIIGSRQLYYALQDHDPDFQEMFRVLVDFDED
                     MPMVDENLEQFAQLLRTRTNEEGMAPLTSDAVARLATYSARLAENQSRLSARIGDLFQ
                     LVSEADFIRQLASDEMTDAGHIERALKAKATRTGRVSQRVLDDMLAGIILIDTEGAAI
                     GKCNGLTVLEVGDSAFGMPARISATVYPGGSGIVDIEREVNLGQPIHSKGVMILTGYL
                     GSRYAQEFPLAISASIALEQSYGYVDGDSASLGEACTLISALSRTPLKQCFAITGSIN
                     QFGEVQAVGGVNEKIEGFFRLCEARGLTGEQGVIIPRANVATLMLDERVLQAVENGMF
                     HVYAVSQADEALSLLVGEEAGVLDDKGLFTEGSVNARVVERLREIAEMISEEDIEKAE
                     KERLEEVIAQAKPA"
     gene            824477..824815
                     /locus_tag="PPUBIRD1_RS03680"
                     /old_locus_tag="PPUBIRD1_0722"
     CDS             824477..824815
                     /locus_tag="PPUBIRD1_RS03680"
                     /old_locus_tag="PPUBIRD1_0722"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019099373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951936.1"
                     /translation="MRNLSLTRQCLGLVTRIECSIRPLAGDNGMWTLLFAAGMAGEQP
                     SAIKAQGPFHGPLVAESVLNAIVDSLTMHGYQVADDPQIWCLHLQAQLRRINGERCRN
                     LGDYQFHPET"
     gene            825005..825493
                     /locus_tag="PPUBIRD1_RS03685"
                     /old_locus_tag="PPUBIRD1_0723"
     CDS             825005..825493
                     /locus_tag="PPUBIRD1_RS03685"
                     /old_locus_tag="PPUBIRD1_0723"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_794334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003247486.1"
                     /translation="MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPN
                     VFALSEADLILVILSLIDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDS
                     SSLKMKVAASIVAISSIHLLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKLT
                     KH"
     gene            825710..826015
                     /locus_tag="PPUBIRD1_RS03690"
                     /old_locus_tag="PPUBIRD1_0724"
     CDS             825710..826015
                     /locus_tag="PPUBIRD1_RS03690"
                     /old_locus_tag="PPUBIRD1_0724"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011532164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589631.1"
                     /translation="MNLHQLNTEARAGHVDELNLIAIEGGDYLLEARVKGHPHPLSDT
                     RGERLRVHSVEDARKLLQTIPMVSMNLVHWSVQDEMCGMGTHPEEDLKVPISQRSAW"
     gene            826101..826718
                     /locus_tag="PPUBIRD1_RS03695"
                     /old_locus_tag="PPUBIRD1_0725"
     CDS             826101..826718
                     /locus_tag="PPUBIRD1_RS03695"
                     /old_locus_tag="PPUBIRD1_0725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020798655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_003247482.1"
                     /translation="MSELNLSTDETRVSYGIGRQLGGQLRDNPPPGVSLEAILAGLTD
                     AFNGADSRVSEADLSASFKVIREVMQAEAAAKAEAAAAAGKEFLVENAKREGITTLAS
                     GLQFEVLTAGEGAKPTREDNVRTHYHGTLIDGTVFDSSYERGQPAEFPVGGVIAGWTE
                     ALQLMNAGSKWRLYVPSELAYGAQGVGSIPPHSVLVFDVELLDVL"
     gene            complement(826745..826990)
                     /locus_tag="PPUBIRD1_RS03700"
                     /old_locus_tag="PPUBIRD1_0726"
     CDS             complement(826745..826990)
                     /locus_tag="PPUBIRD1_RS03700"
                     /old_locus_tag="PPUBIRD1_0726"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951938.1"
                     /translation="MTYLIDAWLERPHPYLRILHRETGEVCAVLEEEALDELRDQGDL
                     DMSGLNSSEPGVLKELVRNLFLFCYARALRPGGTDWN"
     gene            complement(827075..827416)
                     /locus_tag="PPUBIRD1_RS03705"
                     /old_locus_tag="PPUBIRD1_0727"
     CDS             complement(827075..827416)
                     /locus_tag="PPUBIRD1_RS03705"
                     /old_locus_tag="PPUBIRD1_0727"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016484830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951939.1"
                     /translation="MSTLPPCPKCNSEYTYEDGTQLICPECAHEWSASGDAEAASDDV
                     VKKDSVGNILQDGDTVTVIKDLKVKGSSLVVKVGTKVKNIRLCDGDHDIDCKIDGIGA
                     MKLKSEFVRKV"
     gene            complement(827576..828544)
                     /locus_tag="PPUBIRD1_RS03710"
                     /old_locus_tag="PPUBIRD1_0728"
     CDS             complement(827576..828544)
                     /locus_tag="PPUBIRD1_RS03710"
                     /old_locus_tag="PPUBIRD1_0728"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014821448.1"
                     /note="polyprenyl synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl diphosphate synthase"
                     /protein_id="WP_014589632.1"
                     /translation="MQPQTFYRAVADDFSAVDEIIKKQLTSRVPLVSKIGDYITSAGG
                     KRLRPLLVLLCGKALGREGDDLRLLAATIEFLHTATLLHDDVVDMSGMRRGRSTANAL
                     WGNAPSVLVGDFLYSRSFEMMVELGSMPVMQILSKATRVIAEGEVLQLSRVRDASTTE
                     EVYMEVIRGKTAMLFEASTHSAAALAQATDEQREALRTFGDHLGVAFQLVDDLLDYKG
                     DSQTLGKNVGDDLAEGKPTLPLIYTMREGTTEQAALVRQAIQKGGLEDLEQIRVAVEE
                     SGALKYTAELARDYVKRAIACLEVLPASEYRDALVELSEFAVARTH"
     gene            828789..829103
                     /gene="rplU"
                     /locus_tag="PPUBIRD1_RS03715"
                     /old_locus_tag="PPUBIRD1_0729"
     CDS             828789..829103
                     /gene="rplU"
                     /locus_tag="PPUBIRD1_RS03715"
                     /old_locus_tag="PPUBIRD1_0729"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_003247466.1"
                     /translation="MSYAVIVTGGKQYKVAEGEFLKIEKLEVATGESVTFDRVLLVAN
                     GEEVTIGAPVVAGAKVVAEVVSQGRHDKVRIIKFRRRKHHMKRMGHRQWFTEIKITGI
                     QA"
     gene            829142..829399
                     /locus_tag="PPUBIRD1_RS03720"
     CDS             829142..829399
                     /locus_tag="PPUBIRD1_RS03720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007950960.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_003247464.1"
                     /translation="MAHKKAGGSTRNGRDSESKRLGVKMYGGQVIKPGNIIVRQRGTE
                     FHAGYGVGMGKDHTLFAKIEGVIKFEKKGEFMRRYVSIVAA"
     gene            829588..830814
                     /gene="obgE"
                     /locus_tag="PPUBIRD1_RS03725"
                     /old_locus_tag="PPUBIRD1_0731"
                     /gene_synonym="cgtA; obg; yhbZ"
     CDS             829588..830814
                     /gene="obgE"
                     /locus_tag="PPUBIRD1_RS03725"
                     /old_locus_tag="PPUBIRD1_0731"
                     /gene_synonym="cgtA; obg; yhbZ"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_018925882.1"
                     /note="ObgE; essential GTPase; exhibits high exchange rate
                     for GTP/GDP; associates with 50S ribosomal subunit;
                     involved in regulation of chromosomal replication; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase ObgE"
                     /protein_id="WP_003247460.1"
                     /translation="MKFVDEVSIRVKAGDGGNGCMSFRREKFIENGGPNGGDGGDGGS
                     VYMIADENLNTLVDYRYTRHHEAQRGSNGGSTDCTGKKGEDLFLRVPVGTTVIDASTQ
                     EVIGDLVTPGQKLMVAQGGWHGLGNTRFKSSTNRAPRQTTPGKPGEQRDLKMEMKVLA
                     DVGLLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPNLGVVSVDRWKSFVIADIPGLI
                     EGASEGAGLGIRFLKHLARTRVLLHLVDIAPLDESSPADAAEVIVNELTRFSPSLAER
                     ERWLVLNKADMVMDDERDERVQEVIDRLEWEGPVYVISAISKQGTDKLSHDLMRYLED
                     RADRLANDPAYAEELADLDQRIEDEARAQLQALDDARTLRRTGVKSVHDIGDDDGWDD
                     DFEDDEDGPEIIYVRD"
     gene            830900..832018
                     /locus_tag="PPUBIRD1_RS03730"
                     /old_locus_tag="PPUBIRD1_0732"
     CDS             830900..832018
                     /locus_tag="PPUBIRD1_RS03730"
                     /old_locus_tag="PPUBIRD1_0732"
                     /EC_number="2.7.2.11"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002551974.1"
                     /note="Glutamate 5-kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate 5-kinase"
                     /protein_id="WP_014589633.1"
                     /translation="MRSKVTGAKRWVVKIGSALLTADGKGLDRGAMAVWVEQMVALRE
                     AGVELVLVSSGAVAAGMSQLGWTKRPSAMNELQAAASLGQMRLVQAWESSFGEHGKHT
                     AQILLTHDDLSDRKRYLNARSTLRTLVDLGVVPVINENDTVVTDEIRFGDNDTLAALV
                     ANLVEADLLVILTDRDGMFDADPRNNPEAQLIYEARADDPSLDAVAGGTGGALGRGGM
                     QTKLRAARLAARSGAHTIIIGGRIERVLDRLKAGERLGTLLSPERGMIAARKQWLAGH
                     LQTRGTLVLDAGAVQALRQANKSLLPVGVKTVQGSFRRGEMVVCVGPDGVEVARGLAN
                     YSALEAQKIIGQSSEAIESILGYSAEPELVHRDNLVLV"
     gene            832015..832476
                     /locus_tag="PPUBIRD1_RS03735"
                     /old_locus_tag="PPUBIRD1_0733"
     CDS             832015..832476
                     /locus_tag="PPUBIRD1_RS03735"
                     /old_locus_tag="PPUBIRD1_0733"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014859417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951941.1"
                     /translation="MSLLKNVIAVAACVLPMLAGAEEVGQVSTVFKFVGPNDRIVVEA
                     FDDPKVEGVTCYLSRAKTGGVKGGLGLAEDRAEASIACRQVGPINFKGELKDGEEVFK
                     ERTSLVFKTMQVVRFLDKKRNTLVYLVYSDRMIEGSPQNAVTAIPILPWAH"
     gene            832476..832658
                     /locus_tag="PPUBIRD1_RS26065"
     CDS             832476..832658
                     /locus_tag="PPUBIRD1_RS26065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014592316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_085983381.1"
                     /translation="MARSYIRIGGWAQVVVGAGSPAKGPDLLANFHPPFTVAAATVFA
                     GKPAPTYASVVGHRPP"
     gene            complement(832704..835535)
                     /locus_tag="PPUBIRD1_RS03740"
                     /old_locus_tag="PPUBIRD1_0734"
     CDS             complement(832704..835535)
                     /locus_tag="PPUBIRD1_RS03740"
                     /old_locus_tag="PPUBIRD1_0734"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589634.1"
                     /translation="MSQERYGIRRFALLNTAGYSLGLFPLEHPLSVYGANNLGKSASI
                     NALQFPILARMSDMSFGKYSLEQSRRFYFASDTSYILCELSLPHGPHVIGVVGRGPGG
                     GFGHQFFAYKGELDLAHYQKNDTCLRQKELFTNLERLGIKAYELKPDELRRLLVGGHT
                     SVPLDLTMIPLRSTSEQSLKTFRALFINLLHMREITAAKLKQLFLDAFEHSLRSGSVD
                     YIAACEEAFRDVRRMEQDYNALVAAGPLVEALAGGVAQRDILRGKLHRISPVLDTLLG
                     TWQEYAMARKEELVIQSEHYRGEQDRLQNDQRGGTQELMRLEREITGIQRWLGELSVL
                     KHRFALVDDVKVLEQQLLAAKDAHDELAGALAQSRQFSAEDLDERVRDLEKRLKQVKQ
                     QLDHADNNSYARLREEFSQQDVDRLMRLFNGALFSLPLGERGIELDDSDLWVKSLEAV
                     LDGFKGERFEAPGLAIDLTHIDPPALQALADRAALRDQKERLEKELKQLKTQQAVAAD
                     RSASKAQTETLYQEVLDAQKALEDFRRSQTLAAEEPEKLEQLSQLEAAQDELKRSSDA
                     FTERVQQLSAKLQLVGRQLGDLESKQRTLEDALRRRQLLPADLPYGTPYMEAIDDSMD
                     NLLPLLNDYQDSWQGLQRVDNQIEALYAQVRLKGVAKFDSEDDMERRLQLLVNAYAHR
                     TDEALTLAKARRAAVTDIARTLRNIRSDYDSLEHQLALFNREINKRQVSNLESFRVVL
                     APNKEALKHIDQIIHSAGQYEEGETLSVFDLTQSADQDNKNEEAKEYLARLVAANHNQ
                     LGLKDLFELAFEITKVNGQPIIHADIDGAASNGTTMTIKALTNMYLLLHLMDRDLAGR
                     IRLPYYLDEAADIDERNQAALLETSQQLGFVPILASVKPQVSAHVAIDLEGGSGPNGI
                     YIDEADWKFISRLDEVKAVVREDQAEELA"
     gene            complement(835532..836239)
                     /locus_tag="PPUBIRD1_RS03745"
                     /old_locus_tag="PPUBIRD1_0735"
     CDS             complement(835532..836239)
                     /locus_tag="PPUBIRD1_RS03745"
                     /old_locus_tag="PPUBIRD1_0735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247452.1"
                     /translation="MHLDLSELSQLAPIFRELFKGFHVSRRDPELYAQLSNFQDQYRT
                     LFKALGFELVCDTRGFYYFVPDMTAAQVNKTAQRLSLFTFILVEHLADQGRDPMAVLD
                     GGSIGRDELPSLLDKYRDLFLQAEVQTVDELEEKILRRMTQLGFAHEEGGIYRFLPPM
                     HRFLDVCLSVQQDRDLAATLHSALPLPTPVLVEEESAEELNRTDDPLDLTPFQGEESE
                     EDALARAIREEQQEIDA"
     gene            complement(836229..837518)
                     /locus_tag="PPUBIRD1_RS03750"
                     /old_locus_tag="PPUBIRD1_0736"
     CDS             complement(836229..837518)
                     /locus_tag="PPUBIRD1_RS03750"
                     /old_locus_tag="PPUBIRD1_0736"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012270439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247449.1"
                     /translation="MIEPKRVLRALAEHWALIEPLCERFDQGTLSLVELRQHVARQQL
                     ESTPQDITQLLDVWIRLDILVPVAKSPNRFELNAQIHDFLAYLRREHRLGLCLEIEAY
                     LRHLERLAGHIQDAFDNRDSDDLARQLRLLDMRVRDVLKKLDNDEQALVAVAERAKTS
                     NRQIPLRQRYAEVLATWDEYVEPMIQLVNADGAFEQGVRKVETVLLKLLGEQARLGHL
                     VDDDMLLRTHARILEMQTSAQLTLRHARELLLPLREEARRHNAVTRGAALALSVIRRK
                     GIDAVPQAAMPMFTRPQSTFLGSASQVEAYVYALARFEPKPARFPKAHKTQSGALPRA
                     PRTVKEMAERCEQALPLPDLMVWLLEQEPEGATDELLYWFSRLSREKRFKRERLDRRE
                     YTTQEHLVSLHSFALTSSREDAPSAPTEPNASPAHAS"
     gene            837730..838515
                     /locus_tag="PPUBIRD1_RS03755"
                     /old_locus_tag="PPUBIRD1_0737"
     CDS             837730..838515
                     /locus_tag="PPUBIRD1_RS03755"
                     /old_locus_tag="PPUBIRD1_0737"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016713341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589635.1"
                     /translation="MLTEPRRRAYLSAMQVVHWLPRAELPFAAPSRPELLLPVAPVED
                     IDFEVRPASAANETPVTPQARSGERPTIEIPRPGSVPKPAVKPAEAQEQLAAPRPAPV
                     PPPRFSLQLLRAGSCLLLVELATGQPFQSRDPSYLLLKDMLRAAGLPDAPQIIGEPVR
                     WPLLVRGNMDQGPEAARDFVQGFVQARLEDAPCTCLWLVGLPALRFAANADADAYYQT
                     LTLDGLGDAWALPGLELLMDEPQRKADVWKAMRQLMARWKSVE"
     gene            838512..838967
                     /gene="rimI"
                     /locus_tag="PPUBIRD1_RS03760"
                     /old_locus_tag="PPUBIRD1_0738"
     CDS             838512..838967
                     /gene="rimI"
                     /locus_tag="PPUBIRD1_RS03760"
                     /old_locus_tag="PPUBIRD1_0738"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011532177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal-protein-alanine N-acetyltransferase
                     RimI"
                     /protein_id="WP_014589636.1"
                     /translation="MSDSISFRPMTEADLDAVLKIEYAAFSHPWTRGIFQDALKSYEV
                     WLMFDGQQQVGHGVINVIIDEAHLLNITVKPENQGCGLGLRLLQHLMARAYQLNGREC
                     FLEVRASNQSAYRLYERYGFNEIGRRRDYYPIAGGREDALVMACTLFED"
     gene            839097..839600
                     /locus_tag="PPUBIRD1_RS03765"
     CDS             839097..839600
                     /locus_tag="PPUBIRD1_RS03765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M15"
                     /protein_id="WP_019437367.1"
                     /translation="MFAQWAGDHQTRPFREMLVDARLYGVVPIHQLLRSASDWKLCNA
                     SPFAVPPPGNWAAVRSTLALIKALDDQGILRQFEVVSAYREPRLNACAGGAANSAHTR
                     AFAVDILLPAWADPNPLCRFWQQHGQAWNMGLGRYPSGRIHLDTAGYRTWGGDGGAGA
                     SFCINPK"
     gene            complement(839540..840457)
                     /locus_tag="PPUBIRD1_RS03770"
                     /old_locus_tag="PPUBIRD1_0739"
     CDS             complement(839540..840457)
                     /locus_tag="PPUBIRD1_RS03770"
                     /old_locus_tag="PPUBIRD1_0739"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014861554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589637.1"
                     /translation="MKLPPLNAFRYFDIAAQTESFVRAAEHLHVTHGAVSRQIRLLEE
                     SLGVELFERRNRAIFLTPAGRALQSTTQAIFEQLEGAVQRLQQQARDNVLVLSCEPTI
                     AMRWLIPRLPRFHATHPDLQLHLVAAGGPLDFARSGVDLAIRRDDFHWDNQLYSQKIC
                     DEWIGPVCHPAASARLDGQRLLHSATRPAAWPTWLRLSGQQARHCERSDYEHFYLSIQ
                     AASAGLGLAIASALMVRDELDSGQLQAPFGFVCDGSAYHLLSPQPLADSGKRQRFAGW
                     IMDECRECLAHLGLIQNDAPAPPSPPQVR"
     gene            840684..841298
                     /locus_tag="PPUBIRD1_RS03775"
                     /old_locus_tag="PPUBIRD1_0740"
     CDS             840684..841298
                     /locus_tag="PPUBIRD1_RS03775"
                     /old_locus_tag="PPUBIRD1_0740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016501533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine transporter LysE"
                     /protein_id="WP_014589638.1"
                     /translation="MTELIAVALFTLLAVISPGADFAMVTRSSYAQGRKAGLAAAVGI
                     ALGVQVHVLYTVLGIAVIISQSPTLFFVMKVLGAGYLIYLGYKSLTNTRRISLDGVGQ
                     SAASVLQALRTGFLTNALNPKTMLFVISAFTQVVQPGSPLALNFAYGAFMSVAHWLWF
                     SLVAVFFSSTALRRAMIERQVLVDRAIGLALIGLGLAVAVTGIR"
     gene            complement(841429..841505)
                     /locus_tag="PPUBIRD1_RS03780"
                     /old_locus_tag="PPUBIRD1_t0060"
     tRNA            complement(841429..841505)
                     /locus_tag="PPUBIRD1_RS03780"
                     /old_locus_tag="PPUBIRD1_t0060"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(841469..841471),aa:Met,seq:cat)
     gene            complement(841601..842524)
                     /locus_tag="PPUBIRD1_RS03785"
                     /old_locus_tag="PPUBIRD1_0741"
     CDS             complement(841601..842524)
                     /locus_tag="PPUBIRD1_RS03785"
                     /old_locus_tag="PPUBIRD1_0741"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589639.1"
                     /translation="MSAKQLQPDPQQEALAWFSLLRQPGCDETQRQAFAAWCQVQENA
                     HAYAELETFWQQLQPAPARPRPRHVTVRRSHLGKWLALAFLLGLGAAAYLYWPLMQRL
                     ASELHTDVGERRSIRLADGTTLNLDSASAMNVDLRGRTRQLHLVQGQVHLEVVLDGRA
                     MDVEVGNARIQVYGTRLQIARHAGRDELVVFSGKAMVTQGGEQRMVSAGERVTFDDTR
                     IDPVRKADLKTADSWRNGRLKATDMPLRQVLERLAGYQGQRLWMMDEQVAHRRVSGDF
                     NLDQPGQSLQSLAAAQQLQLLGVLGHWLVVR"
     gene            842718..843932
                     /locus_tag="PPUBIRD1_RS03790"
                     /old_locus_tag="PPUBIRD1_0742"
     CDS             842718..843932
                     /locus_tag="PPUBIRD1_RS03790"
                     /old_locus_tag="PPUBIRD1_0742"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589640.1"
                     /translation="MATSSASTASNPAAASQASPMVMRIIGFCALAHLINDLIQSVLP
                     AIYPMLKANYDLSFAQIGMITLTFQITASLLQPWVGFFTDRRPTPNLLPLGTLCTLVG
                     IVMLAFVGSFPMILLASALVGIGSSTFHPETSRIARLASGGRFGLAQSTFQVGGNTGS
                     ALGPLLAAAIVIPFGQTHVAWFGLAGLFFLGVTLMLRGWYKEHLNQAKARKAVQATHG
                     ISRNRVIAALIVLGLLVFSKYFYMASFTSYFTFYLIEKFGVSVASSQLHLFLFLGAVA
                     AGTFFGGPIGDRIGRKAVIWFSILGVAPFTLALPYADLFWTTVLSVVIGFILASAFSA
                     IVVYAQELVPGSVGMIAGIFFGLMFGFGGIGAALLGYVADLRGIEYVYGLCSFLPLFG
                     LLAVFLPSTGKR"
     gene            844257..845414
                     /locus_tag="PPUBIRD1_RS03795"
                     /old_locus_tag="PPUBIRD1_0744"
     CDS             844257..845414
                     /locus_tag="PPUBIRD1_RS03795"
                     /old_locus_tag="PPUBIRD1_0744"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589641.1"
                     /translation="MNMRLLAGLLFAVSVVGFSLGASLPLVSLRLHEAGASTLEIGII
                     SAIPAAGMMLSAFLVDVCCRHLTRRTIYLLCFSLCTVSIALLESAFGSLWLLALLRLG
                     LGLGMGIAIILGESWVNELCPEHNRGKIMALYATSFTGFQVLGPAMLAVLGADSPWIT
                     GVVTVCYGLALLCIVLTVPNDHVEHEEGEKSFGLAGFFRVAPALCMAVLFFSFFDAVV
                     LSLLPVYATSHGFAVGVAALMVTVVFAGDMLFQLPLGWLADRVERTGLHLACGLVAMV
                     IGIGLPWLLNLTWLLWPLLVVLGAVAGGIYTLALVLIGQRFKGQDLVTANASVGLLWG
                     VGSLVGPLVSGAAMNVAPHGLPMALALMAGLFVCFARQSYRRRGRMRAVAQ"
     gene            complement(845422..846372)
                     /locus_tag="PPUBIRD1_RS03800"
                     /old_locus_tag="PPUBIRD1_0745"
     CDS             complement(845422..846372)
                     /locus_tag="PPUBIRD1_RS03800"
                     /old_locus_tag="PPUBIRD1_0745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron dicitrate transporter FecR"
                     /protein_id="WP_014589642.1"
                     /translation="MPDGTPAQAQVDQAIDWLVKLRFDTPSPRTEQQFQHWLASHPHN
                     RLAWQRVSNLGDELAGLPKDLSRRTLDASQHPKASRRDHLKLLGLLAVGGSLGWAARE
                     PLGLPQLLADTSTATGERRQWQGSDGSRLQLNTASAIDLHYSAEQRQLKLIHGEVSLD
                     SNPNDNRPFHVATPVGPLTTFDGQLLLRENSQGLLLSVRRGEVTLFPASASARQVLPG
                     ETLQITAEGSIQARALHNDPWGWTEGVLSVQQMPLAEFASELGRYRPGLLRCAPEVAG
                     LKVSGTYQLADTGQILQLLTRSLPVRVEYRTRYWVSIGAA"
     gene            complement(846365..846880)
                     /locus_tag="PPUBIRD1_RS03805"
                     /old_locus_tag="PPUBIRD1_0746"
     CDS             complement(846365..846880)
                     /locus_tag="PPUBIRD1_RS03805"
                     /old_locus_tag="PPUBIRD1_0746"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019471006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014589643.1"
                     /translation="MQINDTLKPNEVALLYQSHHAWLRGWLRSRVGCSEHAADLAQDT
                     FVRLLRARQVSPLKEPRAYLSSIARGLMIDQFRRRALERAYQESLAHLPEAEVPSEED
                     KLVLLDSLERLDRALQQLKPRVRQAFLLAQLDGLSIVQVAQRLGVSRATVERDLAKAL
                     GACYRLRYADA"
     gene            847052..847678
                     /locus_tag="PPUBIRD1_RS03810"
                     /old_locus_tag="PPUBIRD1_0747"
     CDS             847052..847678
                     /locus_tag="PPUBIRD1_RS03810"
                     /old_locus_tag="PPUBIRD1_0747"
                     /EC_number="3.2.2.21"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020191526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase 2 family
                     protein"
                     /protein_id="WP_014589644.1"
                     /translation="MMLADLSPEAYREAAQHLAALDPDWSRHIAAIGPCLHQATPGRE
                     PYEALVRAIAYQQLHARAAEAILGRLLALFPADDFPQPEQLLAVTPETLRACGFSASK
                     LVTVQGIAQATLEGLVPTREQALNMADEALIERLVALRGVGRWTVEMLLIYSLGRSDI
                     LPVDDFGVREGYRRLKGLETAPTPAQMRSLGGAWRPFRTVAAWYLWRA"
     gene            847726..848778
                     /locus_tag="PPUBIRD1_RS03815"
                     /old_locus_tag="PPUBIRD1_0748"
     CDS             847726..848778
                     /locus_tag="PPUBIRD1_RS03815"
                     /old_locus_tag="PPUBIRD1_0748"
                     /EC_number="2.1.1.63"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010951954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional transcriptional activator/DNA
                     repair protein Ada"
                     /protein_id="WP_014589645.1"
                     /translation="MNLYTTPDQRWQALKSRDTAATGHFVYAVRTTGVYCHPGCKSRQ
                     AKRMNVEFYDTAAAAEAAGYRACKRCISKASATRHSQLVTHACRLIETSDPAPSLDQL
                     SARLAVSPFHLHRLFKAETGVTPKAYAMAFRARRLRAHLEGGQHSVTDAIYNAGYNSN
                     SRFYESADQRLGMRPRQYRAGGAGATIHFALGQCSLGAILVAQSDKGICAILLGDDPE
                     GLLHELQDQFPKAHLIGGDSAYENMVAEVIGFVEAPALGLALPLDVQGTAFQERVWQA
                     LREVPAGSRVSYTDIAERIGAPKAVRAVAMACAANRIAVAIPCHRVVRRDGDISGYRW
                     GVERKQQLLKRETALS"
     gene            848835..851246
                     /locus_tag="PPUBIRD1_RS03820"
                     /old_locus_tag="PPUBIRD1_0749"
     CDS             848835..851246
                     /locus_tag="PPUBIRD1_RS03820"
                     /old_locus_tag="PPUBIRD1_0749"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014755308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein MscS"
                     /protein_id="WP_014589646.1"
                     /translation="MRRVSLARYCPGVIALLALMLLFVSPTWSAPATPLSNLAAAEAP
                     ALDENASLEQLSDRLDLIRQGVTSEANDDVLSQLRLGAMQVQRQADALSALRTADVGK
                     LDDQLKVIGPAQPDEAATLTQQRKALEAEKKALVAQQDQATKLTQSARDLSTQIVNLR
                     RSQFNSQITSRAASPLSPAFWQSIIRPTQDDVARLRDLRGEAADAISSAFSAENRWQF
                     VASLVAAILVWTLVRRVLERLLASAMIRWLPEGRLRRSALALGVSLATLGTIAGSVSL
                     LRWGLESNARLGSDIASLTNHILTLVVFSAFITGLGRAMLMLQRPSWRLPAIHDEVAS
                     ALGWFPKVLALALMVMMTMERMNSVIGASLALTVAVNGLTALVVALTFAGALLCYRRT
                     LRKHGLERPTGLAGLIPFVMVIWLTLILLALLTGYLTLAYFLTAKLLWVSLVITCAYL
                     LTTFFGDLCETLLSPRQPGGLALASTLGLAPRHQAQASTILAGIGRTVVLFLALLLVL
                     MPSGTSPSELLLSLGDWDGTGGKVLGNLNIVPQDIMLALAIFLGGLFAIRVVKRWLSD
                     RLLPETEMDAGMRASLVTLVGYLGFLFLAMLVMSTLRINLTSLTWVVSALSVGIGFGL
                     QQIVQNFISGLILLTERPVKVGDWVSLAGVEGDIRRINVRATEIQMSDRSTVIVPNSQ
                     FISQNVRNVTMGNALGVVSITLTLPLETDANRVRELLLTAYHEHEAILDAPATSVSFK
                     DLTASGMVIGVSGYVAGPRQVSGARSDLLFTILGRLRDEGIPLSSPQSMVLVQEGARP
                     ADESV"
     gene            851167..851361
                     /locus_tag="PPUBIRD1_RS26070"
     CDS             851167..851361
                     /locus_tag="PPUBIRD1_RS26070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014592080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080557764.1"
                     /translation="MKAFHCLRRRAWCWCRRGRGRLTSRCRHRVGCPAGRSGFTRERA
                     GPAGQFPPAVHCCRRYRIRG"
     gene            complement(851686..853116)
                     /locus_tag="PPUBIRD1_RS03825"
                     /old_locus_tag="PPUBIRD1_0751"
     CDS             complement(851686..853116)
                     /locus_tag="PPUBIRD1_RS03825"
                     /old_locus_tag="PPUBIRD1_0751"
                     /EC_number="1.2.1.8"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019750435.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="betaine-aldehyde dehydrogenase"
                     /protein_id="WP_014589648.1"
                     /translation="MTTSHYIAGHWVEGQGSDCISVTDPALGQPFAELMAASVSQVDQ
                     AVTAARSALPAWKSTCASERAAFLRGFAEQLGQRREALVTLQMRNNGKPRHEAEIDLD
                     DAIATFGYYAELAEQLPSKNRTVPLAAPGFTARTRLEPVGVVGLIVPWNFPLVTSAWK
                     LAPALAAGCTVVLKPSEVTPLIEQAYGQIADALGLPAGVLNIVNGKAETGAALSNHNG
                     LDKLSFTGSNSVGSQVMRSASAQCRPVTLELGGKSAIVVFDDCDVDQAVEWIVAGITW
                     NAGQMCSATSRLLVQDGIADALLPRLQAALENLRVGNPLTEEVDMGPLTSQAQWLKVA
                     SYFATAREEGLQCLAGGHALDREGWFVSPTLYTDVPKDSRLWTEEIFGPVLCARRFAS
                     EEQAIAEANDSRFGLVATVCSADLERAERVADALEVGHVWINSVQAVFVETSWGGTKG
                     SGIGRELGPWGLSAYQSVKHVTRCLG"
     gene            complement(853130..854629)
                     /locus_tag="PPUBIRD1_RS03830"
                     /old_locus_tag="PPUBIRD1_0752"
     CDS             complement(853130..854629)
                     /locus_tag="PPUBIRD1_RS03830"
                     /old_locus_tag="PPUBIRD1_0752"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_004575698.1"
                     /translation="MSHSTGIETNGVEQIPADQRDASPLDLFRLIFGGANTFATAVLG
                     SFPVLFGLSFQAGVWAILLGVGIGALILAPMGLFGALNGTNNAVSSGAHFGVHGRIVG
                     SFLSLLTAVAFFSLSVWSSGDALVGGAKRLAGLPETDLTLGLAYGVFAVLVLVVCIFG
                     FRFMLWVNKIAVWASSLLFLLGIVAFAGPFDAGYAGSVNLGQAGFWAAFVGAAILAMS
                     NPVSFGAFLGDWSRYIPRETPKARIMLAVIAAQGATLIPFLFGLCTATLVATQAPDYI
                     AANNYVGGLLAVAPSWFFLPVCLIAVIGGMSTGTTALYGTGLDMSSVFPRLLSRAGAT
                     LLIGVLAIGFIFIGRFTFNLVQSVSTFAVLIITCTSPWMVIMILGLITRRGFYHADDL
                     QVFTRGQRGGHYWFLHGWNWRGMGAWIPSAAVGLCFVNLPGQFVGPLGDLAGGIDLSL
                     PVTLGLAGVLYLLLLNLFPEPAGVYGPLGPRWVRCKSTAHTPVTTAEMA"
     gene            complement(854722..855111)
                     /locus_tag="PPUBIRD1_RS03835"
                     /old_locus_tag="PPUBIRD1_0753"
     CDS             complement(854722..855111)
                     /locus_tag="PPUBIRD1_RS03835"
                     /old_locus_tag="PPUBIRD1_0753"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019470999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004575697.1"
                     /translation="MDQTLQVRQAAADLVAAFASNDTARYFACFSEDATFLFHTLPYP
                     LLSRRAYEELWAQWQAEGFTVLACESGNAHVSLQGDVAVFMHDVATRIRIGGEEHPLS
                     ERETIVFRRHGDQWLACHEHLSVVTPA"
     gene            855320..855940
                     /locus_tag="PPUBIRD1_RS03840"
                     /old_locus_tag="PPUBIRD1_0754"
     CDS             855320..855940
                     /locus_tag="PPUBIRD1_RS03840"
                     /old_locus_tag="PPUBIRD1_0754"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019098866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_010951959.1"
                     /translation="MAFQYKRLDKNNAAVLLVDHQTGLLSLVRDIDPDRFKNNVLALS
                     DLAKYFKLPTILTTSFETGPNGPLVPELKEQFPDAPYIARPGNINAWDNEDFVKAVKA
                     TGKKQLLIAGVVTEVCVAFPALSALEEGFEVFVVTDASGTFNELTRDSAWRRMEAAGA
                     QLMTWFGVACELHRDWRNDIEGLGTLFSNHIPDYRNLMTSYNKLAK"
     gene            856091..856861
                     /gene="ppk2"
                     /locus_tag="PPUBIRD1_RS03845"
                     /old_locus_tag="PPUBIRD1_0755"
     CDS             856091..856861
                     /gene="ppk2"
                     /locus_tag="PPUBIRD1_RS03845"
                     /old_locus_tag="PPUBIRD1_0755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010225726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyphosphate kinase 2"
                     /protein_id="WP_049870069.1"
                     /translation="MGGKAYEKALKNLHVELVKLQEWVVAKGLKVCIVFEGRDGAGKG
                     GTIKAITERVSPRVFRVVALPAPTEREKTQMYLQRYLGHLPAAGEVVIFDRSWYNRAG
                     VERVMGFCSGEQVDKFLAGVPVFERVMVDSGIILIKYWLEVSADEQTRRLQDRINDGR
                     KLWKLSPMDLKSYTRWDDYTQARDDMFQASDTAWAPWFMANSNDKRRARLNIISHLLS
                     RIPYKDITRDQQVKLPKRGKIGKYKAVAYPFKFVEERF"
     gene            856898..858094
                     /locus_tag="PPUBIRD1_RS03850"
                     /old_locus_tag="PPUBIRD1_0756"
     CDS             856898..858094
                     /locus_tag="PPUBIRD1_RS03850"
                     /old_locus_tag="PPUBIRD1_0756"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="portal protein"
                     /protein_id="WP_014589651.1"
                     /translation="MPHDGSLLQATVVFLLAVVLLVPLAQRLKMGAVPGYLLAGILIG
                     PSVFGLLGNPDNVARLSEMGVVMLLFVIGLELSPKRLWTMRRALFGVGSLQVGLTAVL
                     LGLLAFWLFDQSKPAAIVLGLGLALSSTAFGLQVLAERKDLGKPHGRLAVAILLFQDI
                     AAIPLIAVVPLLGGDVSTADEGAWPLLAVVVGIGVLIVFGRYLLTPIFKWTVGSGLPE
                     LSTATALLVVLGTAWLMEHVGVSMALGAFLAGVLMAESPFRHELETQIEPIKGLLLGL
                     FFVGVGMSADLRLLFGMPLMVLGLTVLLVVVKLPLLYGLGHTVGGLNQAQALCLGVVL
                     ASGGEFAFVVFKLALEHQVLTQQVHDLLVLAITLSMAVVPLVMMALARQLRDDSPVQA
                     SPETGQ"
     gene            858135..859232
                     /locus_tag="PPUBIRD1_RS03855"
                     /old_locus_tag="PPUBIRD1_0757"
     CDS             858135..859232
                     /locus_tag="PPUBIRD1_RS03855"
                     /old_locus_tag="PPUBIRD1_0757"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014589652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_014589652.1"
                     /translation="MQSSFKLDSALSRGLLDVLIKAGLVAALVIFAFQVFQPFLELML
                     WAVILAVTLYPLHCRIQRRTGLKQGYAATLVVLLVLVLLLVPIYLVVMSIGESVDSLV
                     TLLKSGAWSVPVPPDSVAAWPLIGPKVYALWLAASENMASVLNQWMPQIKGAGLTVLG
                     AAASAGGAFLLFIGAIIISGVIMAFGERGEIATQRIAMRVSGAERGKPLATLCTATIR
                     AVAQGVIGIAFIQMLLIGVGFVVKGVPGAGMLAIVILMLGIAQAPATLVTLPVIIYVF
                     NAEGFTVATIIFAIYTFVAGLADNVLKPLLLGRGVDVPMPVVLIGALGGMVVKGIIGL
                     FIGPVILGVTYVLFWQWVALQVPEQPAPPAA"
     gene            859236..860750
                     /locus_tag="PPUBIRD1_RS03860"
                     /old_locus_tag="PPUBIRD1_0758"
     CDS             859236..860750
                     /locus_tag="PPUBIRD1_RS03860"
                     /old_locus_tag="PPUBIRD1_0758"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TolC family protein"
                     /protein_id="WP_014589653.1"
                     /translation="MPKRCYGLGLLMVLAGCTQVGPDFEKPQVPWLDGWSTPMLEQAG
                     RSAAAPGLRQWWAVFADPTLDALIAEADANNTNLRVAGLRIAEARAQLAIVQTGRYPQ
                     LQQLSAQSLYLKQDQSGTPSARDSVFWQSSVGFDIGWEIDFWGRFSRAIESADAVYFA
                     SQANYADAMLLLRAQVADTYFALRTAEARLAIAQENAKRQARSLEITERLFRHGENDE
                     LDWQQARTQYLATLATIPEFENQLNALRNVLCSLLGRPPGPLPQLEAGHGQLPLPNRA
                     VLQDVPASLLQRRPDIRAAEQAVAAQSALVGVAEADLYPQLSLLGSIGWTFLSANHLP
                     DTFDLAAGPSLIWNPFDYGRRKNTVRVEDARLQQLIELYQQGVREAAREADDAASGLV
                     RSLQSATIRDQASQAAQRSLNLASSQYREGFADFQRVLDAQQLLLQQQDGYLVSRGNA
                     VSSLVTLYKALGGGWDASRAPLDPATRQQMQQRTDWGELLDEPAPTAHAQGETE"
     gene            860747..861844
                     /locus_tag="PPUBIRD1_RS03865"
                     /old_locus_tag="PPUBIRD1_0759"
     CDS             860747..861844
                     /locus_tag="PPUBIRD1_RS03865"
                     /old_locus_tag="PPUBIRD1_0759"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003247419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family secretion protein"
                     /protein_id="WP_014589654.1"
                     /translation="MSDATPTPPPSAPDRGMRWVLLLIAVSLLWYLLADRYTPYTQQA
                     RLQAYVVPVAAEVAGQIKRVAVGNNQEVRQGDVLFELDQEQYRIALARAEADLDTVRR
                     QIGASTAGIDSAQAALVAAQANERKARQDAERLKRLIDEDPGTVSVRRLEGAQATRDQ
                     AISQVAAARAEVERAREQQGGAQEDNAQLRSAAANVEKARLDLARTVVRADANGLITD
                     LRTDVGHYVGAGSPMMTLISIHDVWISADMTENNLGRLRPETPVLVVLDALPGTVLKG
                     RIRSIGYGVSVGQSTPPGTLPTVQNSREWLRSAQRFPVIVELERDQLQDKTVLRVGGQ
                     AEVMALPSEGNPLNLLGRLFMWLMGWLSYAY"
     gene            861834..862856
                     /locus_tag="PPUBIRD1_RS03870"
                     /old_locus_tag="PPUBIRD1_0760"
     CDS             861834..862856
                     /locus_tag="PPUBIRD1_RS03870"
                     /old_locus_tag="PPUBIRD1_0760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016501514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589655.1"
                     /translation="MPIELRRLRALRLAWGGALCLAVSFGLGLPVPILAPVFAVLLLA
                     MRSQPLPLRAAPVLALLVLLACGSGLLLIPLLRHAPLAGVLLVGVGVFLTLRYALKGG
                     NGLLANLLVIGLTMIAAAGTSDFTLALSVVEALAKGMLLAVLGTSVAHTLFPEPANAP
                     AQPVPPLLGSEHVSWVALRATLIVMPAFLLALIAPDQYMPLIMKAVSVGQQAGETRAR
                     HASRELIGSTLLAGVLAIVLWVALSLFVHLWMFFLWVLLFALWQARRLYQAVPSRHSP
                     AYWVSCLTTMLILLGQSVQDSAGGQDVYKAFAVRMALFLAVSVYASAMLIWIDRLRSR
                     RGLLRG"
     gene            complement(862876..864588)
                     /locus_tag="PPUBIRD1_RS03875"
                     /old_locus_tag="PPUBIRD1_0761"
     CDS             complement(862876..864588)
                     /locus_tag="PPUBIRD1_RS03875"
                     /old_locus_tag="PPUBIRD1_0761"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575691.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-independent anion transporter"
                     /protein_id="WP_014589656.1"
                     /translation="MPQPTRFDWQRWLPGLVTLLHYKAAWLPKDIAAGLVLTTMLVPV
                     GIAYAEASGVPGIYGLYATIIPLLAYALFGPSRILVLGPDSALAAPILAVVVQYAASD
                     PQRAIAIASMMALVAGAFCVIAGLLRLGFITELLSKPIRYGYMNGIALTVLISQLPKL
                     FGIKVDSEGPLRDLWYLGQALYAGQGHWPSFVVGAGSLALILLLKPFKRLPGILIAVV
                     LATLAVSVFNLDQIGVKVLGQLPQGLPGFVFPWVSDIDLVEVLLGGIAVALVSFADTS
                     VLSRSYAARLKMRVNPNQEMFGLGVANVASGLFQGIPISSSSSRTPVAEAAGSQTQLT
                     GIIGALAVTLLLLVAPNLMQHLPNSALAAVVIAAALGLFEFADLKRIFRMQQWEFWLS
                     FTCFVGVAVFGAIPGICIAVAVSVIEFLWDGWRPHYAVLGRADGLRGYHDIQRYPQAR
                     RIPGLVLLRWDAPLFFANAEQFQNTVMAAVDASPTPVQRVVIAAEPVTSIDITSADML
                     AELDRALEARGVELQFAEMKDPVKDKMRQFELFEHMGEKAFHPTVGAAVDAYLEESGV
                     DWQP"
     gene            complement(864626..865549)
                     /locus_tag="PPUBIRD1_RS03880"
                     /old_locus_tag="PPUBIRD1_0762"
     CDS             complement(864626..865549)
                     /locus_tag="PPUBIRD1_RS03880"
                     /old_locus_tag="PPUBIRD1_0762"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575690.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589657.1"
                     /translation="MARRFGHLGDVETLLEVVERGSLSAAAVALATTPSVVSRAISRL
                     ESHLGVQLLRRTTRRLSLTDSGLEYVEQARAAFQQIASAEQALSGHGEVQGRVRLSAP
                     TTYGHHRLPAMLAAFTLRYPKVQVELNITNRNVDLVAEGYDLAIRLGDLPDSSLVARR
                     LEEARLCLVAAPAYLARAGRPQSLAELAGHNCLPFIMPSNGRPGVWQFRQGEEELLFV
                     PQGNPVVADDVLGCISLAEQGVGICQTYEFIVAERLQRGRLVRLLEDYEGARRPFSVI
                     YPPHRQLSGASRALIDSLMTTGRKAALDPSI"
     gene            865666..866514
                     /locus_tag="PPUBIRD1_RS03885"
                     /old_locus_tag="PPUBIRD1_0763"
     CDS             865666..866514
                     /locus_tag="PPUBIRD1_RS03885"
                     /old_locus_tag="PPUBIRD1_0763"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 1 glutamine amidotransferase
                     domain-containing protein"
                     /protein_id="WP_014589658.1"
                     /translation="MRTYQRLALAAVIGSASLGAHAANVLVVLSDESHLELRDGKAFA
                     TGFYLNELLEPTKTLLDAGHQVTFATPLGRAPTLDRSSAAAQYFGNDPKQLEQYQALL
                     DQLQLTSAKHSPVISLSRVEQIGYGNFDAVYVPGGHAPMQDLLADPAMGRLLRAFHAE
                     GKTTALVCHGPIALLSALERPQKLIQALENGDRTATPEDWIYAGYRMTVISNQEEEQA
                     KGLLGGGQMKFYPQTALERAGGQYQSNPSPWATNVVIDRELITGQNPASAAQVGQAIL
                     HRLQKH"
     gene            866530..867252
                     /locus_tag="PPUBIRD1_RS03890"
                     /old_locus_tag="PPUBIRD1_0764"
     CDS             866530..867252
                     /locus_tag="PPUBIRD1_RS03890"
                     /old_locus_tag="PPUBIRD1_0764"
                     /EC_number="1.1.1.100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004575688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589659.1"
                     /translation="MTQRTFLVTGASKGIGRAISEQLVEEGHQVVGIARQAADASFPG
                     ELIATDLSDSERLIATLADLTKRYAFDGLVNNVGLVRPQPLGEIDLASFDEVMRVNLH
                     PALQATQALLPGMRERCWGRVVNISSLTVLGIRQRTSYAAAKAALVSFTRSWALELAQ
                     TGITVNAVAPGPIETELFRSGNPVGSAGEAAYIDGVPMGRLGQPHEVASAVTFLLGDR
                     SAFITGQTIYVDGGASIGRSGL"
     gene            complement(867377..868477)
                     /gene="ychF"
                     /locus_tag="PPUBIRD1_RS03895"
                     /old_locus_tag="PPUBIRD1_0765"
     CDS             complement(867377..868477)
                     /gene="ychF"
                     /locus_tag="PPUBIRD1_RS03895"
                     /old_locus_tag="PPUBIRD1_0765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002552142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_003247414.1"
                     /translation="MGFNCGIVGLPNVGKSTLFNALTKSGIAAENFPFCTIEPNSGIV
                     PMPDARLAALAEIVKPNRILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIAH
                     VVRCFEDENVIHVSNSVDPKRDIEIIDLELIFADLDSCEKQLQKVARNAKGGDKDALA
                     QKAILEKLIPHFTEGKPARSLMKHMADDEKAVIRGFHLLTSKPVMYIANVAEDGFDNN
                     PHLDVVKAIAEEEGAVVVPVCNKIEAEIAELEDGEEKDMFLEALGLEEPGLNRVIRAG
                     YELLNLQTYFTAGVQEVRAWTVRVGATAPQAAGVIHTDFEKGFIRAEVVAYDDFIQFK
                     GEAGAKEAGKWRLEGKDYIVKDGDVMHFRFNV"
     gene            complement(868502..869086)
                     /locus_tag="PPUBIRD1_RS03900"
                     /old_locus_tag="PPUBIRD1_0766"
     CDS             complement(868502..869086)
                     /locus_tag="PPUBIRD1_RS03900"
                     /old_locus_tag="PPUBIRD1_0766"
                     /EC_number="3.1.1.29"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_253361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-tRNA hydrolase"
                     /protein_id="WP_003247413.1"
                     /translation="MTAIQLIVGLGNPGPEYEQTRHNAGALFVERLASAQRVSLTADK
                     KYFGLTAKFSHQGNDVRLLIPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPG
                     VAKLKRGGGHGGHNGLRDIIAQLGNQNDFHRLRLGIGHPGDAKLVSNFVLGRAPRAEQ
                     EKLDASIDFALGVLPDVLAGDFAKAMRELHSQKA"
     gene            complement(869166..869759)
                     /locus_tag="PPUBIRD1_RS03905"
                     /old_locus_tag="PPUBIRD1_0767"
     CDS             complement(869166..869759)
                     /locus_tag="PPUBIRD1_RS03905"
                     /old_locus_tag="PPUBIRD1_0767"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020190538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L25/general stress protein
                     Ctc"
                     /protein_id="WP_003247411.1"
                     /translation="MTDFILNAQARTDLGKGASRRLRHSLSIPAVVYGGDKEAQSLTI
                     LAKEITKLFENEAAFSHVIELNVDGVKQNVIIKAMQRHPAKQFIMHADFVRVVAGQKL
                     TAKVPVHFINEEAPVKKGGEISHVESEIEVSCEAKDLPEFIEVDLGNAEIGTIIHLSD
                     LKAPKGVEFVALAHGDDKAVANVHAPRVAPEAEGAAE"
     gene            complement(869878..870819)
                     /locus_tag="PPUBIRD1_RS03910"
                     /old_locus_tag="PPUBIRD1_0768"
     CDS             complement(869878..870819)
                     /locus_tag="PPUBIRD1_RS03910"
                     /old_locus_tag="PPUBIRD1_0768"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012702657.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_003247410.1"
                     /translation="MSKMMVFTGNANPDLARRVVRQLHIPLGDVSVGKFSDGEISTEI
                     NENVRGKDVFIIQPTCAPTNDNLMELVVMADAFRRSSASRITAVIPYFGYARQDRRPR
                     SARVAISAKVVADMLTVVGIDRVLTVDLHADQIQGFFDIPVDNIYGSPVLVDDIEDQR
                     FENLMIVSPDIGGVVRARAVAKSLGVDLGIIDKRREKANHSEVMHIIGDVEGRTCILV
                     DDMVDTAGTLCHAAKALKEHGAAKVYAYCTHPVLSGRAIENIEKSVLDELVVTNTVPL
                     SAAAQACDRIRQLDIAPVVAEAVRRISNEESISAMFR"
     gene            complement(870868..870942)
                     /locus_tag="PPUBIRD1_RS03915"
                     /old_locus_tag="PPUBIRD1_t0059"
     tRNA            complement(870868..870942)
                     /locus_tag="PPUBIRD1_RS03915"
                     /old_locus_tag="PPUBIRD1_t0059"
                     /product="tRNA-Gln"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(870908..870910),aa:Gln,seq:ttg)
     gene            complement(870963..871823)
                     /locus_tag="PPUBIRD1_RS03920"
                     /old_locus_tag="PPUBIRD1_0769"
     CDS             complement(870963..871823)
                     /locus_tag="PPUBIRD1_RS03920"
                     /old_locus_tag="PPUBIRD1_0769"
                     /EC_number="2.7.1.148"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437900.1"
                     /note="4-diphosphocytidyl-2-C-methyl-D-erythritol kinase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-diphosphocytidyl-2C-methyl-D-erythritol
                     kinase"
                     /protein_id="WP_014589660.1"
                     /translation="MQKLTLPAPAKLNLWLHIIGRRADGYHELETVFQFLDHGDELSF
                     ALRDDGVIRLHTEIETVPHDSNLIVRAARMLQAQSGTTLGADIWLTKVLPMGGGIGGG
                     SSDAATTLLALAHLWQLDWDEDRLAALGLSLGADVPVFVRGHAAFAQGVGEQLTPVDP
                     IEPWYVVLVPQVSVSTVEIFSHPQLTRDSLPLKMRPVPEGNSRNDCQPVVEQNYPEVR
                     NALNSLGKFTEARLTGTGSCVFGAFPSKAEADKVLALLSATQTGFVAKGSNVSMLHRK
                     LQSLVKKSSA"
     gene            complement(871828..872445)
                     /locus_tag="PPUBIRD1_RS03925"
                     /old_locus_tag="PPUBIRD1_0770"
     CDS             complement(871828..872445)
                     /locus_tag="PPUBIRD1_RS03925"
                     /old_locus_tag="PPUBIRD1_0770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009405958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein LolB"
                     /protein_id="WP_003247402.1"
                     /translation="MFLRHCITFTMIALLAGCAGFGSREALQGHGDPQQWRAHKAQLS
                     SLDGWQINGKVGIRAPRDSGSGTLFWLQRQDYYDIRLAGPLGRGAARLTGRPGGVVLE
                     VANQGRYEATSPEALLEEQLGWQLPVSHLVWWVRGLPAPDSKSKLTLDGDSRLASLDQ
                     DGWQVQYLSYTEQNGYWLPERLKLHGKDLDVTLVVKDWQPRQLGH"
     gene            complement(872450..874171)
                     /locus_tag="PPUBIRD1_RS03930"
                     /old_locus_tag="PPUBIRD1_0771"
     CDS             complement(872450..874171)
                     /locus_tag="PPUBIRD1_RS03930"
                     /old_locus_tag="PPUBIRD1_0771"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013970899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589661.1"
                     /translation="MNKPYALLLAFALLQGCQSLAPQKAEPPVAEAGKAEAEKPVVYG
                     SFKQDTLYSLLVAELAGQRNRFDIALANYTDQAAKTQDPAVSERAYRIAEYLGADEPS
                     LENALVWARNDPQNLDAQRAAAIQLARAGRYDESMTYMEKVLQGQGDTHFDFLALSAA
                     ETDQSTRDGLLHSFERLLVKYPDNGQLIFGKALLLNQDGKTEEALELLESHPAQNGEI
                     APILLRARLLQALDRGPEALPLLRGAIRDNPDDKRLRLTYARTLVEQDRIADAKGEFI
                     SLVQQYPDDDELRYSLALVCLENKDWDEAEGYLQELIERDSYVDAAHLNLGRIHEERH
                     DPAGALDEYALVGPGPDYLPAQLRQADILIANGRGSDASRLLAEAREAQPDYAIQLFL
                     IESESYSNNNKDAQANQVLQQAIQRYPDDLNLLYTRAMLAEKRNDLTQMEKDLRAIIA
                     REPENAMALNALGYTLADRTTRYAEAKALIDKAHQLTPDDPAVLDSLGWVNYRLGNLD
                     VAETYLRQAFANFPDHEVAAHLGEVLWANGKRREARHVWAKGFEAQADSPILRKTLLR
                     LTGSETL"
     gene            complement(874428..>874556)
                     /locus_tag="PPUBIRD1_RS26075"
                     /pseudo
     CDS             complement(874428..>874556)
                     /locus_tag="PPUBIRD1_RS26075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611762.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS5/IS1182 family transposase"
     gene            complement(874641..875366)
                     /locus_tag="PPUBIRD1_RS03935"
                     /old_locus_tag="PPUBIRD1_0772"
     CDS             complement(874641..875366)
                     /locus_tag="PPUBIRD1_RS03935"
                     /old_locus_tag="PPUBIRD1_0772"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019437898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transferase"
                     /protein_id="WP_014589662.1"
                     /translation="MKAIILAAGRGSRLQALTDERPKALVPFNGAPLLQRAIETLRRC
                     DVSEVGIVAGYRSEMLAPFADTLFHNHRWHSSGIFSSLNCASDWLSAEPCLVSYGDIF
                     YDSTLVSELINHPADIVLGYDPAAVRLWQQRFNDPLPDLENFRLVDGWVSAIGQTATS
                     LEVIQGQYMGLFKVTPAGWQALKKQLQGLTPQARD