GenomeNet

Database: RefSeq
Entry: NC_017530
LinkDB: NC_017530
Original site: NC_017530 
LOCUS       NC_017530            5731541 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Pseudomonas putida BIRD-1, complete genome.
ACCESSION   NC_017530
VERSION     NC_017530.1  GI:386009639
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603225
            Assembly: GCF_000183645.1
KEYWORDS    RefSeq.
SOURCE      Pseudomonas putida BIRD-1
  ORGANISM  Pseudomonas putida BIRD-1
            Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
            Pseudomonadaceae; Pseudomonas.
REFERENCE   1  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro-Tobias,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., Wu,X., van der Lelie,D., Gomez,M.J., Segura,A. and
            Ramos,J.L.
  TITLE     Complete genome of the plant growth-promoting rhizobacterium
            Pseudomonas putida BIRD-1
  JOURNAL   J. Bacteriol. 193 (5), 1290 (2011)
   PUBMED   21183676
REFERENCE   2  (bases 1 to 5731541)
  AUTHORS   Matilla,M.A., Pizarro,P., Roca,A., Fernandez,M., Duque,E.,
            Molina,L., van der Lelie,D., Gomez,M.J. and Ramos,J.-L.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Estacion Experimental del Zaidin, CSIC, C/
            Profesor Albareda 1, Granada, Granada E-18008, Spain
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Source DNA/bacterial strain available from Amalia Roca, Bioiliberis
            R&D, Pol gono Juncaril, c/ Capileira 7, 18220 Peligros, Granada,
            Spain; aroca@bio-iliberis.com.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 11/24/2014 16:32:18
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 5,169
            CDS                          :: 5,034
            Pseudo Genes                 :: 47
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 65
            ncRNA                        :: 1
            Frameshifted Genes           :: 43
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5731541
                     /organism="Pseudomonas putida BIRD-1"
                     /mol_type="genomic DNA"
                     /strain="BIRD-1"
                     /db_xref="taxon:931281"
     gene            complement(54..623)
                     /locus_tag="PPUBIRD1_RS00005"
                     /old_locus_tag="PPUBIRD1_0001"
     CDS             complement(54..623)
                     /locus_tag="PPUBIRD1_RS00005"
                     /old_locus_tag="PPUBIRD1_0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589157.1"
                     /db_xref="GI:504402055"
                     /translation="MLGNSFELPSIFMRAFFLFPLLLASTLAHAELPETDWLELMPKS
                     DQKALEQMPEIDHNSPEAMGTFTAKGGLKQSKGLPAVMYSTKTVAAMNGKDIRLGGYP
                     VPLESDAKGNSTLFFLVPYPGACIHVPPPPPNQLVLVRYPKGLKIDDIYTPLWVSGKL
                     KVEKVSNDLADAAYALDAGKVRVVEDADL"
     gene            complement(636..881)
                     /locus_tag="PPUBIRD1_RS00010"
                     /old_locus_tag="PPUBIRD1_0002"
     CDS             complement(636..881)
                     /locus_tag="PPUBIRD1_RS00010"
                     /old_locus_tag="PPUBIRD1_0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013974826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_012054121.1"
                     /db_xref="GI:501000979"
                     /translation="MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLAT
                     YGGQALGIYQAGQAAGFLGALIGAVVLLVIYGFIKKR"
     gene            complement(990..2072)
                     /locus_tag="PPUBIRD1_RS00015"
                     /old_locus_tag="PPUBIRD1_0003"
     CDS             complement(990..2072)
                     /locus_tag="PPUBIRD1_RS00015"
                     /old_locus_tag="PPUBIRD1_0003"
                     /EC_number="4.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589158.1"
                     /note="phosphoribosylaminoimidazole carboxylase ATPase
                     subunit; With PurE catalyzes the conversion of
                     aminoimidazole ribonucleotide to carboxyaminoimidazole
                     ribonucleotide in the de novo purine nucleotide
                     biosynthetic pathway; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylaminoimidazole carboxylase"
                     /protein_id="WP_014589158.1"
                     /db_xref="GI:504402056"
                     /translation="MKIGVIGGGQLGRMLALAGTPLGMNFAFLDPAPDACAAPLGEHL
                     RADYGDQDHLRQLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAESLRIARDRLFEK
                     SMFRDLGIPTPAFADILSQADLDAAVASIGLPAVLKTRTLGYDGKGQKVLRTPEDVVG
                     TFAELGSVPCLLEGFVPFTGEVSLVAVRGRDGETRFYPLVHNTHESGILRLSVASQAH
                     PLQALAEDYVGRVLQKLDYVGVMAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQ
                     FENHLRAVAGLPLGSTAKVGESAMLNFIGEVPAVDKVVAIGDCHLHHYGKAFKVGRKV
                     GHATLRCHDMATLERKIAEVEALISN"
     gene            complement(2083..2574)
                     /locus_tag="PPUBIRD1_RS00020"
                     /old_locus_tag="PPUBIRD1_0004"
     CDS             complement(2083..2574)
                     /locus_tag="PPUBIRD1_RS00020"
                     /old_locus_tag="PPUBIRD1_0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016489856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-carboxyaminoimidazole ribonucleotide mutase"
                     /protein_id="WP_003253304.1"
                     /db_xref="GI:489346170"
                     /translation="MSALVGVIMGSKSDWSTLSHTADMLEKLGIPYEVKVVSAHRTPD
                     LLFQYAEEAEGRGIEVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSI
                     VQMPAGVPVATLAIGRAGAVNAALLSASILGAKYPQYHAALKQFRTEQTDTVLDNPDP
                     RQA"
     gene            2844..3470
                     /locus_tag="PPUBIRD1_RS00025"
                     /old_locus_tag="PPUBIRD1_0005"
     CDS             2844..3470
                     /locus_tag="PPUBIRD1_RS00025"
                     /old_locus_tag="PPUBIRD1_0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589159.1"
                     /db_xref="GI:504402057"
                     /translation="MKTPCFFALSFGLVLSLQLPSASAAHSLTVTVYVHDDLADMHDG
                     QLNEDFFQHWLNEMRRFSQHPIEVIFQRKVKHITDIAYAGMPSEKLLDAFSQQVYAQK
                     RHRLYSLMDKHLLLTGNSYDHSGLNYNAGLAYFKQKTAIASVAAYGAAAHEVGHLLGA
                     THEDAELKFNGWVCETYTHPRVPARSNCYRYSDRNRANITEYLKDNSN"
     gene            complement(3462..4388)
                     /locus_tag="PPUBIRD1_RS00030"
                     /old_locus_tag="PPUBIRD1_0006"
     CDS             complement(3462..4388)
                     /locus_tag="PPUBIRD1_RS00030"
                     /old_locus_tag="PPUBIRD1_0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012054123.1"
                     /db_xref="GI:501000981"
                     /translation="MCFVNLESKWLEDFSALAATRSFSQAAERRFVTQPAFSRRIRSL
                     EAALGLQLVNRSRTPIELTEAGQLFLVTARTVVDQLSEILRHLHHLEGGQGEVVQVAA
                     AHSLASGFFPRWVAQLRNDGLNIATRLVATNVGDAVHALREGGCDLMLAFYDPDAALQ
                     MDAEIFPSLHMGTTEMLPVCAVDADGKPLFDLEGEGSVPLLAYTAGAFLGRSVNLLLR
                     QRNLRYTTVYETAMADSLKSMALEGMGIAWVPRLSMRGELERGELAICGGSQWHVPLE
                     IRLYRCALVRKANVRLLWRKLESSGAQGEASI"
     gene            4562..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_RS00035"
                     /old_locus_tag="PPUBIRD1_0008"
     CDS             4562..5986
                     /gene="aspA"
                     /locus_tag="PPUBIRD1_RS00035"
                     /old_locus_tag="PPUBIRD1_0008"
                     /EC_number="4.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054124.1"
                     /note="catalyzes the formation of fumarate from aspartate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_029380744.1"
                     /db_xref="GI:657294547"
                     /translation="MSSAASFRVEKDLLGTLEVPADAYYGIQTLRAANNFHLSGVPLS
                     HYPKLVVALAMVKQAAADANRELGHLSDAKHAAISAACARLIKGDFHDQFVVDMIQGG
                     AGTSTNMNANEVIANVALEAMGHQKGEYQYLHPNNDVNMAQSTNDAYPTAIRLGLLLG
                     HDALLASLDSLIQAFAAKGKEFDHVLKMGRTQLQDAVPMTLGQEFRAFATTMTEDLQR
                     LRSLAPELLTEINLGGTAIGTGINADPGYQALAVQRLATISGHPLVPAADLIEATSDM
                     GAFVLFSGMLKRTAVKLSKICNDLRLLSSGPRTGINEINLPARQPGSSIMPGKVNPVI
                     PEAVNQVAFAIMGNDLALTVAAEGGQLQLNVMEPLIAYKIFDSIRLLQRAMDMLREHC
                     IVGITANEQRCRELVEHSIGLVTALNPYIGYENATRIARVALESGRGVLELVREEKLL
                     DDAMLDDILRPENMIAPRLVPLKA"
     gene            6217..7209
                     /locus_tag="PPUBIRD1_RS00040"
                     /old_locus_tag="PPUBIRD1_0009"
     CDS             6217..7209
                     /locus_tag="PPUBIRD1_RS00040"
                     /old_locus_tag="PPUBIRD1_0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589161.1"
                     /db_xref="GI:504402059"
                     /translation="MLHSHLTTLNAVSLILNVFQADGCEASALLAGSGIGPADLGHAD
                     ARITTQQELQVCANAVARREDIGLELGQRMRVSCYGMLGYALLSSATLGDALRLALQY
                     PALLGTVFKLRLLDDGQRVWFSASDYHDSPALSAFNAEFCLVSLKVICDDLLGRPLPL
                     LGARFEHPRPGYHALYAEAFQCPIGFAAEDNAFAFERRWLDMPLPLADPITHKAMSER
                     CRRLNLEFTGRQAWLGRIRQLLAQQLDAAPGLEGLARQMNCSSRTLRRHLQALGSSYQ
                     QLLDELRFERAKQLLADEQMPIYRIAETLGFSETASFRHAFQRWSGVAPSHFRG"
     gene            7506..8549
                     /locus_tag="PPUBIRD1_RS00045"
                     /old_locus_tag="PPUBIRD1_0010"
     CDS             7506..8549
                     /locus_tag="PPUBIRD1_RS00045"
                     /old_locus_tag="PPUBIRD1_0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylpolyamine aminohydrolase"
                     /protein_id="WP_014589162.1"
                     /db_xref="GI:504402060"
                     /translation="MLTIYSDDHRLHHGRCELIDGKLMPCFEMPSRADHVLDQVKKRN
                     LGDIQGPTDFGRAPLLRVHSADYLDFFEGAWARWAALGHEGDLLPFTWPARTLRQVKP
                     TGLHGELGYYSFDAGAPITAGTWQAAYSAAQVALTAQAAIQQGAHAAFALCRPPGHHA
                     AGEVMGGYCYLNNAAIAAQAFLDQGRRKVAILDVDYHHGNGTQDIFYSRDDVFFASIH
                     GDPQDEFPFFLGYADETGEGAGQGYNINYPLPAGSDWTAWSAALEDACKRIASYDADV
                     LVISLGVDTFKDDPISQFKLDSPDYLEMGKRIGQLGKPTLFVMEGGYAVEEIGINAVN
                     VLEGFQRAQPGAR"
     gene            8549..9652
                     /locus_tag="PPUBIRD1_RS00050"
                     /old_locus_tag="PPUBIRD1_0011"
     CDS             8549..9652
                     /locus_tag="PPUBIRD1_RS00050"
                     /old_locus_tag="PPUBIRD1_0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019752811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_003253292.1"
                     /db_xref="GI:489346158"
                     /translation="MVRLKRLLAPFIAATLFAGALHAQAEQRTLRVYNWFDYITPQTL
                     TAFQKDSGVKLVYDIFDTNEALEAKLLTGNSGYDVVVPSNVFLAKQIEAGVFQPLDRS
                     KLPNWQHLDPALMKLIEANDPGNKFAVPYMYGTVLIGFNPAKVKAALGDNAPVDSWDL
                     IFKEENIAKLKQCGVALLDSPSEILPLALQYLGLPPNSDKPADYKKAEELMLKIRPHI
                     TYFHSSKYMADIANGDICVAVGYSGSFSQAANRAREANNGVVVDMRLPKEGAPIWFDM
                     LAIPKGAANPEDAHTFINYLLRPEVIAPISDFVGYPNPNKDATDKVNPTIRNNPNLYP
                     TAEAMAKLYTLKPLTRDAERARTRAWTRIKSGT"
     gene            complement(9684..11213)
                     /locus_tag="PPUBIRD1_RS00055"
                     /old_locus_tag="PPUBIRD1_0012"
     CDS             complement(9684..11213)
                     /locus_tag="PPUBIRD1_RS00055"
                     /old_locus_tag="PPUBIRD1_0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014589163.1"
                     /db_xref="GI:504402061"
                     /translation="MRESPLILPFDPAGIALDRSRGLSQQLYQALRARVLDGRLSSGT
                     RLPATRDLAAMLALSRNSVVRAYDQLYAEGFIESRVGDGTYVSRLPKLSTQVSTGLSL
                     GLSTGLSTFREENTEDLSSGRLFSAPLQRLKNNHLPPPRIGAPRAFRVGIPAFDLFPF
                     DVWAKLQAGFWRNPSPAQLGYGDPAGEPALRDLIAAYLRRSRGLSCTAEQIVITSGAQ
                     QAISLCAQLLLQPGDGVAVENPGYRAAAHAFTLAGGRVFGVPVNEDGLDCSRLEQLTD
                     CRLTYVTPAHQYPTGVTMSLARRLALLAWAERSDGWIIEDDYDGEYRYSGAPLAPLAA
                     LDRHGRVLYVGTFGKIAFPALRLGYLVLPSKLVQAFSQGKALAVRHSEVSSQCVMAEF
                     MARGHFQRHIRRMRKAALKRRDVLKAGWPVDIPGLGAMPEVAAGLHVKVDVDNFAREQ
                     ELVAKAEAVGVEVTPLSNFWLADCEVPVDKRAGLVLGFAAVPEGEIAEALMKLRKVWR
                     K"
     gene            11303..11932
                     /locus_tag="PPUBIRD1_RS00060"
                     /old_locus_tag="PPUBIRD1_0013"
     CDS             11303..11932
                     /locus_tag="PPUBIRD1_RS00060"
                     /old_locus_tag="PPUBIRD1_0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010955832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589164.1"
                     /db_xref="GI:504402062"
                     /translation="MYNSKPHQEHDLTRLHQHMLDTRLAILVSQGEQGLLATHLPVLV
                     DTAEGDFGTVYAHLARANRQWEDLQHGGEALLVFPGADAYVSPGYYPSKAENPKVVPT
                     WNYLAVHAYGPAEVIHEAEPLLSIVSRLTDRHEQGRNEPWKVTDAPADYIEGMLRAIV
                     GIRLPIARLQGARKLSQNRSRQDIDGVREGLSASPDQRDNQLAAHMRQL"
     gene            11944..12390
                     /locus_tag="PPUBIRD1_RS00065"
                     /old_locus_tag="PPUBIRD1_0014"
     CDS             11944..12390
                     /locus_tag="PPUBIRD1_RS00065"
                     /old_locus_tag="PPUBIRD1_0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_003253286.1"
                     /db_xref="GI:489346152"
                     /translation="MPNLTLRPVTAQDHAAWHALWQAYLHFYETELADAVSLSTWQRL
                     LDPSEPTHSALAWVDGKAVGMVNFIYHRSNWSIENSCYLQDLYVDSTQRGLGIGRQLI
                     EHVYTTAKADNCIKVHWLTHETNATAISLYQQVAERSGFIQFRKGL"
     gene            12398..13069
                     /locus_tag="PPUBIRD1_RS00070"
                     /old_locus_tag="PPUBIRD1_0015"
     CDS             12398..13069
                     /locus_tag="PPUBIRD1_RS00070"
                     /old_locus_tag="PPUBIRD1_0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010955833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase GCN5"
                     /protein_id="WP_014589165.1"
                     /db_xref="GI:504402063"
                     /translation="MTDALNWKPAAPPKAEPIEGRFIRLEKLDPGRHGEDLWEALQGP
                     ASDPVLWDYLPYGPFAERAAFDRWLEGNAAGRDPLFYTVIDRASGQAQGILSLMSIVP
                     EHGRIEIGHIAFGAAMQRTPKGTEAVYLLGKLGFALGNRRLEWKCNNANARSKRAAER
                     FGFVYEGVFRKHLVVKDHNRDTAWYSITDDEWPAVAAGFERWLSEENQQPGGQVESLE
                     MCRKG"
     gene            complement(13190..14998)
                     /locus_tag="PPUBIRD1_RS00075"
                     /old_locus_tag="PPUBIRD1_0016"
     CDS             complement(13190..14998)
                     /locus_tag="PPUBIRD1_RS00075"
                     /old_locus_tag="PPUBIRD1_0016"
                     /EC_number="6.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016502269.1"
                     /note="catalyzes the formation of oxaloacetate from
                     pyruvate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit B"
                     /protein_id="WP_003253282.1"
                     /db_xref="GI:489346148"
                     /translation="MSKKIHVTDTILRDAHQSLLATRMRTEDMLPICDKLDKVGYWSL
                     EVWGGATFDACVRFLKEDPWERLRKLRAALPNTRLQMLLRGQNLLGYRHYSDDVVKAF
                     VAKAAVNGIDVFRIFDAMNDVRNLRVAIEAVKAAGKHAQGTIAYTTSPVHTIEAFVNQ
                     AKQMEAMGCDSVAIKDMAGLLTPFATGELVKALKAEQSLPVFIHSHDTAGLAAMCQLK
                     AVENGADHIDTAISSFAWGTSHPGTESMVAALKGSEFDTGLDLELLQEIGLYFYAVRK
                     KYHQFESEFTAVDTRVQVNQVPGGMISNLANQLKEQGALNRMNEVLAEIPRVREDLGF
                     PPLVTPTSQIVGTQAFFNVLAGERYKTITNEVKLYLQGGYGKAPGVVNEQLRRQAIGS
                     EEVIDVRPADLLKPEMAKLRSDIGALARCEEDVLTFAMFPDIGRKFLEEREAGTLTPE
                     VLLPIPEAGAVAAPGGEGVPTEFVIDVHGETYRVDITGVGVKAEGKRHFYLSIDGMPE
                     EVVFEPLNEFVSGGGSKRKQATDPGHVSTTMPGNIVDVLVKEGDMVKAGQAVLITEAM
                     KMETEVQAAIAGKVVAIHVAKGDRVTPGEILIEIEG"
     gene            complement(15010..16425)
                     /locus_tag="PPUBIRD1_RS00080"
                     /old_locus_tag="PPUBIRD1_0017"
     CDS             complement(15010..16425)
                     /locus_tag="PPUBIRD1_RS00080"
                     /old_locus_tag="PPUBIRD1_0017"
                     /EC_number="6.4.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011064323.1"
                     /note="catalyzes the ATP-dependent carboxylation of a
                     covalently attached biotin and the transfer of the
                     carboxyl group to pyruvate forming oxaloacetate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate carboxylase subunit A"
                     /protein_id="WP_003253279.1"
                     /db_xref="GI:489346145"
                     /translation="MIKKILIANRGEIAVRIVRACAEMGIRSVAIFSDADRHALHVKR
                     ADEAHSIGAEPLAGYLNPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFI
                     GPAADVIRRMGDKTEARRTMIAAGVPVTPGTEGNVADIHEALSEGDRIGYPVMLKATS
                     GGGGRGIRRCNSREELEQNFPRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFG
                     NVVHLFERDCSIQRRNQKLIEIAPSPQLTPEQRAYIGDLAVRAAKAVNYENAGTVEFL
                     LADGEVYFMEMNTRVQVEHTITEEITGIDIVREQIRIASGLPLSVKQEDIQHRGYALQ
                     FRINAEDPKNNFLPSFGKITRYYAPGGPGVRTDTAIYTGYTIPPFYDSMCLKLVVWAL
                     TWEEAMDRGLRALDDMRVQGVKTTAAYYQEILRNPEFRSGQFNTSFVESHPELTNYSI
                     KRKPEELALAIAAAIAAHAGL"
     gene            16615..17577
                     /locus_tag="PPUBIRD1_RS00085"
                     /old_locus_tag="PPUBIRD1_0018"
     CDS             16615..17577
                     /locus_tag="PPUBIRD1_RS00085"
                     /old_locus_tag="PPUBIRD1_0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_010955834.1"
                     /db_xref="GI:499258294"
                     /translation="MRKSLMRMTLRQLQIFNEVCDLRSYSRAAEEMALTQPAVSLQIR
                     QLEELIGQPLFEYVGKKLYLTEAAEALQRASHDIFGRLESLDMQLSDMQGSLQGQLKL
                     AIESSAKYFVPHLFAAFKQRHPEVNLTLTVVNRAQAIRRLSDNRDDLIIMSMVPQDMG
                     LEFLPFLNNPIVAVAPPQHPLCKLEQLRMQDLEPHTLLVREQGSGTRKACEEYFKDKR
                     VHFAQTLEVASADAQRECVIAGLGIALLTRHAVNLELATGMLKELPVEELPLYRSWCV
                     VQAKAKRQSPVALAFLAFIRGERALISALVERFSGKLPPTTAIP"
     gene            complement(17947..18813)
                     /locus_tag="PPUBIRD1_RS00090"
                     /old_locus_tag="PPUBIRD1_0019"
     CDS             complement(17947..18813)
                     /locus_tag="PPUBIRD1_RS00090"
                     /old_locus_tag="PPUBIRD1_0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="WP_003253273.1"
                     /db_xref="GI:489346139"
                     /translation="MNLLQHIAQSRHLLRKSELKVADHVLLDPAAVMHSSMADLAHSV
                     GISEPTIVRFCRAIGCSGFQDLKLKLAQSLAAGASFGQFAIHEDDSVADYSLKIFDTT
                     LHTLMEVREHLDPQALQQAVSAMAQAQRVEFYGFGASGAVAADAQHKFFRLLLSAAAY
                     SDPHMQAMSAVTLKPGDVAVCISQSGRSKDLLITANLVRESGANLITLCPSQTPLAEL
                     STVNLAIDVHEDTEIYTPLTSRIAHLVVIDVLAMGVAMARGPSLVNHLKSVKRSLRSL
                     RLSPKSIKATDD"
     gene            18917..20359
                     /locus_tag="PPUBIRD1_RS00095"
                     /old_locus_tag="PPUBIRD1_0020"
     CDS             18917..20359
                     /locus_tag="PPUBIRD1_RS00095"
                     /old_locus_tag="PPUBIRD1_0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253271.1"
                     /note="catalyzes the formation of D-glucono-1,5-lactone
                     6-phosphate from D-glucose 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="WP_003253271.1"
                     /db_xref="GI:489346137"
                     /translation="MTIPCDILVFGGTGDLALHKLLPALYHLFREARLNPAVRVIALA
                     RRNLPRIDYLKLAERHCRAQIARSDFDEEVWQRFSARVDYFPMDASQSADFGRLARYL
                     GEPGGLTRIFYLATAPNLFVPIANHLRIAGLADTEARIVLEKPIGHSLESATAINEAI
                     GTVFEERQVFRIDHYLGKETVQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVEN
                     RGAYYDRAGAIRDMLQNHLLQLLCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDV
                     QDKTVRGQYGAGRIGGQEVPAYYFEKDVDNDSDTETFVAIEAHIDNWRWAGVPFYLRT
                     GKRMARRASQIVIQFKPVPHELFSGGQVNQLLIQLQPDERISLRMMTKSPGKGMRLEP
                     VDLDLNLAQVFSQTRRWEAYERLLLDVLEGDSTLFMRRDEVEAAWAWVDPIIKGCEEH
                     FQAPRPYPAGSFGPEQANSLLARHGRHWHG"
     gene            20574..22760
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_RS00100"
                     /old_locus_tag="PPUBIRD1_0021"
     CDS             20574..22760
                     /gene="uvrD"
                     /locus_tag="PPUBIRD1_RS00100"
                     /old_locus_tag="PPUBIRD1_0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010955837.1"
                     /note="unwinds DNA duplexes with 3' to 5' polarity with
                     respect to the bound strand and initiates unwinding most
                     effectively when a single-stranded region is present;
                     involved in the post-incision events of nucleotide
                     excision repair and methyl-directed mismatch repair;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-dependent helicase"
                     /protein_id="WP_004575197.1"
                     /db_xref="GI:490712354"
                     /translation="MRTDDLSLLLNSLNDAQRQAVAATLGRQLVLAGAGSGKTRVLVH
                     RIAWLIQVEQASPHSILSVTFTNKAAAEMRQRIEQLLGINPAGMWVGTFHGLAHRLLR
                     AHWQEARLVQNFQILDSDDQQRLIKRVMRELGLDEQKWPARQAQWFINGQKDEGLRPQ
                     HIQAGGDLFLATMREVYTAYEQACERAGVIDFSELLLRALDLWRDHPGLLEHYQRRFR
                     HVLVDEFQDTNAVQYAWLRLLARGGDSLMAVGDDDQSIYGWRGAKIENIHQYTADFPD
                     AEMIRLEQNYRSTGGILKAANALIANNSGRLGKELWTDMGEGEPLTLYAAYNEHDEAR
                     YVVETIESLVKQGNARNEIAILYRSNAQSRVLEEALLRERIPYRIYGGQRFFERAEIK
                     NAMAYLRLIEGRGNDAALERVINVPPRGIGEKTVEAIREHARHSQLSMWEAMCQLLAA
                     KALKGRAASALGAFIELIEGLAAKVVDMPLHTMTQTTIEQSGLITYHQEEKGEKGQAR
                     VENLEELVSAARNFESTDEDADLSPLSAFLGHASLEAGDTQADEHEDSIQLMTLHSAK
                     GLEFPYVFLVGMEEGLFPHKMSLEEPGRLEEERRLAYVGITRAMRQLVMTYAETRRLY
                     GSETYNKVSRFVREIPAGLVQEVRLSNSVSRPFGGAKTATNSNLFANASIPQTAFNLG
                     QRVQHAVFGEGVILNFEGSGAQARVQVNFAEGSKWLMLGYAKLEAV"
     gene            22892..23746
                     /locus_tag="PPUBIRD1_RS00105"
                     /old_locus_tag="PPUBIRD1_0022"
     CDS             22892..23746
                     /locus_tag="PPUBIRD1_RS00105"
                     /old_locus_tag="PPUBIRD1_0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589167.1"
                     /db_xref="GI:504402065"
                     /translation="MQRFLSIALALCVGLTLSLDASAKRFGGGKSSGSAPIHQTRQAT
                     PTTPAAAPTAPGRAPAAASGASRWLGPLAGLAAGGLLASMFMGDGFEGFQIMDFLIVA
                     LIAFLVFRFIAARRRQQQPQMAMPGHAPMQREAHAQPAQPSIFGGSAAPAATAAPVIN
                     APAWFNEQSFLAAARNHFQSLQQHWDANEMDKISEFVTPQMLEFLKRERAELGDGFQS
                     TYIDNLEVQLDGVDDRADRTDATLTFRGVSKNSRFDQGEVFSESWHMVRAQGENQPWL
                     VAGIRQNG"
     gene            23860..24267
                     /locus_tag="PPUBIRD1_RS00110"
                     /old_locus_tag="PPUBIRD1_0023"
     CDS             23860..24267
                     /locus_tag="PPUBIRD1_RS00110"
                     /old_locus_tag="PPUBIRD1_0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007954245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall assembly protein"
                     /protein_id="WP_003253266.1"
                     /db_xref="GI:489346132"
                     /translation="MEEVIEQLREANEPVPVPLELPDEDQLVEIEEQLFINIPFVFKE
                     FLLTVSDVVYGSLEPVTVTDPQSHTYLPDVASNAWDAGVPRDLIPLCQDGDNYYCVEE
                     DGTVVLWDAEEEIVGEDSWESVWHWARDVWLES"
     gene            complement(24426..26186)
                     /locus_tag="PPUBIRD1_RS00115"
                     /old_locus_tag="PPUBIRD1_0024"
     CDS             complement(24426..26186)
                     /locus_tag="PPUBIRD1_RS00115"
                     /old_locus_tag="PPUBIRD1_0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016502278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_014589168.1"
                     /db_xref="GI:504402066"
                     /translation="MHAISFIQDLAVIMLIAGVVTILFHRLKQPVVLGYIVAGFIIGP
                     HTPPFGLIHDEETIKILAELGVIFLMFCLGLEFSLRKLFKVGATAFIAAFLEIVLMIW
                     IGFEIGRWFGWSTMDSLFLGAILAISSTTIIVKALNDLKMKNERFAQLIFGVLIVEDI
                     LGIGIIALLSGIAVSGTVSSGEVFSTVGKLSLFMIVALVIGILLVPRLLAYVAKFESN
                     EMLLITVLGLCFGFCLLVVKLEYSMVLGAFLIGAIMAESRQLLKIERLIEPVRDLFSA
                     IFFVAIGLMIDPQVLIDYAWPIVVITLAVVLGKMLSCGMGAFIAGNDGRTSLRVGMGL
                     SQIGEFSFIIAALGMTLQVTSDFLYPVAVAVSAITTLLTPYLIRAADPLSQKLGNVVP
                     ARLARVLSLYGEWLRNIQPQGESAMLAAMIRRILLQVGVNLALVIAIFFSGGYFAGRI
                     GNWLSEWVSDVSQQKAVIWGAALLLSLPFLIAAYRKLKALSMLLAEMGVKPEMAGRHT
                     QRVRRVIAEVIPLLSLLVIFLLLSALSASILPTSELLLVIAVVAAVVVALLWRWFIRV
                     HTRMQIALLETLENSRENSH"
     gene            26526..27011
                     /locus_tag="PPUBIRD1_RS00120"
                     /old_locus_tag="PPUBIRD1_0025"
     CDS             26526..27011
                     /locus_tag="PPUBIRD1_RS00120"
                     /old_locus_tag="PPUBIRD1_0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_003253263.1"
                     /db_xref="GI:489346129"
                     /translation="MEPGNAQLSMTVLMTPDMANFSGNVHGGTLLKYLDEVAYACASR
                     YAGSYVVTLSVDQVIFREPVHVGELVTFLASVNYTGNTSMEVGIKVVTENIRERSVRH
                     SNSCFFTMVAVDDNRRPVPVPPRQPHSSEEKRRFLQGQQRRQIRQELEKRYQDLKTDA
                     I"
     gene            complement(27008..27880)
                     /locus_tag="PPUBIRD1_RS00125"
                     /old_locus_tag="PPUBIRD1_0026"
     CDS             complement(27008..27880)
                     /locus_tag="PPUBIRD1_RS00125"
                     /old_locus_tag="PPUBIRD1_0026"
                     /EC_number="2.7.1.35"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5WB73.1"
                     /note="catalyzes the formation of pyridoxal 5'-phosphate
                     from pyridoxal; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine kinase"
                     /protein_id="WP_014589169.1"
                     /db_xref="GI:504402067"
                     /translation="MKRTPHLLAIQSHVVFGHAGNSAAVFPMQRIGVNAWPLNTVQFS
                     NHTQYGQWAGEVLAPAQIPALVEGISNIGELGHCDAVLSGYLGSAEQGRAILAGVERI
                     KAVNPKALYLCDPVMGHPEKGCIVPPEVSEFLLDEAAATADILCPNQLELDSFSGRRA
                     QSLEDCVNMARSLLERGPQVVLVKHLAYPGRAEEQFEMLLVTAEQSWHLRRPLLAFPR
                     QPVGVGDLTSGLFLARVLLGDSWVQAFEFTAAAVHEVLLETQACASYELQLVRAQDRI
                     AHPRVRFEAQLLAL"
     gene            28001..28393
                     /locus_tag="PPUBIRD1_RS00130"
                     /old_locus_tag="PPUBIRD1_0027"
     CDS             28001..28393
                     /locus_tag="PPUBIRD1_RS00130"
                     /old_locus_tag="PPUBIRD1_0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012274886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253259.1"
                     /db_xref="GI:489346125"
                     /translation="MLTLENLFVLMLVATAGAWLWHNHGLREKALERVKQHCAKLDLE
                     LLDDAVALKRIAFVRDANGRKRLARVYAFEFTVTGEQRHPGTATQFGAHSVQIELAPY
                     PFEIKTPPRADNVIEMQQWRQEHNRWRN"
     gene            complement(28394..29365)
                     /locus_tag="PPUBIRD1_RS00135"
                     /old_locus_tag="PPUBIRD1_0028"
     CDS             complement(28394..29365)
                     /locus_tag="PPUBIRD1_RS00135"
                     /old_locus_tag="PPUBIRD1_0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004575194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CobW"
                     /protein_id="WP_014589170.1"
                     /db_xref="GI:504402068"
                     /translation="MLQNIPTHVIAGPLGAGKTTLIRHLLAQRPANERWAVLINEFGL
                     VGLDAAILSRDEDGIAIGEVAGGCLCCVNGMPFQVGLGRLLRKSRPDRLFIEPSGLGH
                     PLQLLAQLQQAPWVGVLTIQPLLMVVDAQAMARNEPLPEAQQQAFNASESVVFNKSEA
                     VDEIHKLLISNQFKEKRIMWTVQGQLPLSGLPTVSPQIVDSPFLKNRIVDNPGIAPAA
                     LWADPSLPICLVQQGEGGWSIGWRWHPGQQFYPQRLKAFLYAWPWRRAKGVIHSMEGW
                     WSFNGLNGDMPAWQPSDWRKDTRIELIFDQPQPQPALQAGLDECRVS"
     gene            complement(29406..30032)
                     /locus_tag="PPUBIRD1_RS00140"
                     /old_locus_tag="PPUBIRD1_0029"
     CDS             complement(29406..30032)
                     /locus_tag="PPUBIRD1_RS00140"
                     /old_locus_tag="PPUBIRD1_0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589171.1"
                     /db_xref="GI:504402069"
                     /translation="MNLAHRPVDIFQVFGETPQVLAEVLQDGVNLAVWRRRLPAQLED
                     FAALVLSLGQPLADQRVIDVDEEQKPVLPDLLREAADLHGYEAFVADVTWLVAAYTCL
                     VGARRVGLRLRVLDSPMCPRFHVDNVPLRLLTTYVGPGSEWLQERVSGRGELHTAQPS
                     VDNIQQLQAGEVAILKGEKWQGNEGAGLVHRSPSAQQGRLLLSLDWLA"
     gene            complement(30029..31237)
                     /locus_tag="PPUBIRD1_RS00145"
                     /old_locus_tag="PPUBIRD1_0030"
     CDS             complement(30029..31237)
                     /locus_tag="PPUBIRD1_RS00145"
                     /old_locus_tag="PPUBIRD1_0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019752820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxytetrahydrobiopterin dehydratase"
                     /protein_id="WP_041166809.1"
                     /db_xref="GI:752477533"
                     /translation="MSNRLPVTVLSGFLGAGKSTLLNHVLRNRDKLRVAVIVNDMSEI
                     NIDASEVQRNVSLNRAEEKLVEMSNGCICCTLREDLLEEVARLAEEGRFDYLLIESTG
                     ISEPLPVAETFTFRDELGRSLSDMARLDTMVTVVDGLNFLRDYQAADSLASRGETLGE
                     EDERSISDLLIEQVEFADVLLLSKIDLISQHEREELIAILRSLNARAQIVPMVMGQVP
                     LARILDTGLFDFDQAAQAPGWLQELRGEHVPETEEYGIAAMTWQARRPLHPQRFYDFI
                     HKNWENGRLLRSKGFFWLASKYQEAGSWSQAGGMMRHGLAGRWWRFVPREQWPQDVDN
                     TNAILKHWTAETGDCRQELVFIGQNIDVEKLSTALDACLLTDKEMGLGHMGWLRLPDP
                     FGPWHEEAAA"
     gene            31351..31731
                     /locus_tag="PPUBIRD1_RS00150"
                     /old_locus_tag="PPUBIRD1_0031"
     CDS             31351..31731
                     /locus_tag="PPUBIRD1_RS00150"
                     /old_locus_tag="PPUBIRD1_0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014754895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine synthetase"
                     /protein_id="WP_019437631.1"
                     /db_xref="GI:518267423"
                     /translation="MNLPRVMALLVLTMPASLLAMPQNSALALCTRSATLLACQDGKG
                     NYYSVRTEGSTFYLRGYDFSSRRLWAQTNSRYGTLTFFSGLASNGEAWVGYSRRVGWT
                     TLNRVSSSSGERFKLHCSLIEGCR"
     gene            complement(32000..32527)
                     /locus_tag="PPUBIRD1_RS00155"
                     /old_locus_tag="PPUBIRD1_0033"
     CDS             complement(32000..32527)
                     /locus_tag="PPUBIRD1_RS00155"
                     /old_locus_tag="PPUBIRD1_0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012274892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253248.1"
                     /db_xref="GI:489346114"
                     /translation="MKIRLPLLALALGMSSPLVQAQMLQPGLWELTTSNMQVDGKPLP
                     DMEFMLGQLKNLPPEQRAMMEGVLAKQGVSVGGKGVRSCLTPEQVATNDIPLQDPKSG
                     CTQKITDRTGNVWKFQFSCPKAQGSGQATFLSDREFTTQVSGTFNASGVQQQGSMNTR
                     AVWLGNDCGTVKPRS"
     gene            32660..34099
                     /locus_tag="PPUBIRD1_RS00160"
                     /old_locus_tag="PPUBIRD1_0034"
     CDS             32660..34099
                     /locus_tag="PPUBIRD1_RS00160"
                     /old_locus_tag="PPUBIRD1_0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88C19.1"
                     /note="Cardiolipin synthase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cardiolipin synthetase"
                     /protein_id="WP_014589175.1"
                     /db_xref="GI:504402073"
                     /translation="MDYHSPYFFGYLLGLIHLLGIVAALHALFTVRTAQGAIAWAMPL
                     LFIPYLTLIPYLIFGARSFYAYIKARRQANQEMHVAMANLNWRPWVEEALTARESESY
                     TALRAMPKLGRMPCLANNQVKLLINGKATFDAIFAAIEKARDVVLVQFFIIHDDTLGK
                     ALQQLLLRKAAEGVQVFVLYDRVGSHALPASYSQMLRDGGVQIHAFATRRGWFNRFQV
                     NFRNHRKIVVVDGLLGFIGGHNVGDEYLGEHPQLSPWRDTHVQISGPVLACLQESFAE
                     DWYWATRQLPPLILPDTYPDNGVLCQALASGPADPQETCSLFFLEAIHSATRRVWITS
                     PYFIPDEAVFAALRLAVLRGVDVRVLIPSRPDHRIVYAASSLFAFEAVRAGVRMFRYQ
                     PGFLHQKVVLVDDDVSAIGSANLDNRSFRLNFEITLLTVDRGFADQVEHMLQEDFEHA
                     REITAEDTQDTHRLQQLGMRIARLISPIL"
     gene            complement(34182..35366)
                     /locus_tag="PPUBIRD1_RS00165"
                     /old_locus_tag="PPUBIRD1_0035"
     CDS             complement(34182..35366)
                     /locus_tag="PPUBIRD1_RS00165"
                     /old_locus_tag="PPUBIRD1_0035"
                     /EC_number="2.1.1.79"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004575189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclopropane-fatty-acyl-phospholipid synthase"
                     /protein_id="WP_014589176.1"
                     /db_xref="GI:504402074"
                     /translation="MLAQLPPALQSLHLPLRLKLWDGNQFDLGPSPQVTILVKEPQLI
                     SQLTHPSMDQLGTAFVEGKLELEGDIGEAIRVCDELSEALLADEDETPPPRVSHDKST
                     DAKAISYHYDVSNAFYQLWLDQDMAYSCAYFREPDNTLDQAQQDKFDHLCRKLRLDAG
                     DYLLDVGCGWGGLARFAAREYGAKVFGITLSKEQLKLGRKRVQAEGLADKVDLQILDY
                     RDLPQDGRFDKVVSVGMFEHVGHANLALYCQKLFGAVREGGVVMNHGITAKHVDGRPV
                     GRGAGEFIDRYVFPHGELPHLSMISASICEAGLEVVDVESLRLHYAKTLHHWSENLEN
                     QLHKAAALVPEKTLRIWRLYLAGCAYAFQKGWINLHQILAVKPYADGHHDLPWTREDL
                     YR"
     gene            35574..36974
                     /locus_tag="PPUBIRD1_RS00170"
                     /old_locus_tag="PPUBIRD1_0036"
     CDS             35574..36974
                     /locus_tag="PPUBIRD1_RS00170"
                     /old_locus_tag="PPUBIRD1_0036"
                     /EC_number="1.8.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P31046.1"
                     /note="Dihydrolipoyl dehydrogenase 3; Catalyzes the
                     oxidation of dihydrolipoamide to lipoamide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide dehydrogenase"
                     /protein_id="WP_014589177.1"
                     /db_xref="GI:504402075"
                     /translation="MKSYDVVIIGGGPGGYNAAIRAGQLGLSVACVEGRSTLGGTCLN
                     VGCMPSKALLHASELYEAASGDEFAHLGIEVKPTLNLAQMMKQKDESVTGLTKGIEYL
                     FRKNKVEWIKGWGRLDGIGKVVVKAEDGSETALQAKDIVIATGSEPTPLPGVTVDNQR
                     IIDSTGALSLPQVPKHLVVIGAGVIGLELGSVWRRLGSQVTVIEYLDRICPGTDTETA
                     KTLQKALAKQGMVFKLGSKVTQATAGADGVSLTLEPAAGGTAESLQADYVLVAIGRRP
                     YTKGLNLESVGLEADKRGMLGNEHHRTSVPGVWVIGDVTSGPMLAHKAEDEAVACIER
                     IAGKPHEVNYNLIPGVIYTRPEMATVGKTEEQLKAEGRAYKVGKFPFTANSRAKINHE
                     TEGFAKVIADAETDEVLGVHLVGPSVSEMIGEFCVAMEFSASAEDIALTCHPHPTRSE
                     ALRQAAMNVDGMAMQI"
     gene            complement(37045..38052)
                     /locus_tag="PPUBIRD1_RS00175"
                     /old_locus_tag="PPUBIRD1_0037"
     CDS             complement(37045..38052)
                     /locus_tag="PPUBIRD1_RS00175"
                     /old_locus_tag="PPUBIRD1_0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014589178.1"
                     /db_xref="GI:504402076"
                     /translation="MSRVNTTETGKKRLTTSAMIASIAAEGQATRSAPFGHALAALAE
                     QRSDIVGLSADLSKYTDLHIFAKAHPERFYQMGMAEQLLMSAAAGMAREGCVPFATTY
                     AVFASRRAYDFICMAIAEENLNVKIVCGLPGLTTGYGPSHQATDDLAIFRAMPNLMIV
                     DPCDALEIEQAVPAIAAHQGPVYMRLLRGNVPLVLDEYGYKFEIGKAKTLRTGKDVLI
                     ISTGLMTMRSLEAAAHLQKDGVDVAVLHVPTIKPLDEQTILAEARKSGRLVVTAENHS
                     IIGGLGEAVAGLLLRNGVTPTFRQVALPDAFLDAGALPTLHDRYGISTDAVSAQIKAW
                     L"
     gene            complement(38049..38897)
                     /locus_tag="PPUBIRD1_RS00180"
                     /old_locus_tag="PPUBIRD1_0038"
     CDS             complement(38049..38897)
                     /locus_tag="PPUBIRD1_RS00180"
                     /old_locus_tag="PPUBIRD1_0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_014589179.1"
                     /db_xref="GI:504402077"
                     /translation="MTVNAPDTSLSALAERAYNIRRHALRMGQVQGQGYVGQALGAAD
                     LLAVSYFHALRYQPHNPEWEQRDRFYLSIGHYAIALYAALIEAGVIPLEELETYGSDD
                     SRLPMSGMAAYTPGMEITGGSLGHGLGIAVGACLGLKRKKSDSFVYNLLSDGELNEGS
                     TWEAAMSASHWKLNNLIAIIDVNNQQADGYSSEVLAFEPIVDRWQAFGWFTQRVDGND
                     IGALVAAFDAARNHQGAQPRVIICDTKMGKGVDFLESREKTHFIRVDENEWDLALQNL
                     QVGRIV"
     gene            complement(38916..40217)
                     /locus_tag="PPUBIRD1_RS00185"
                     /old_locus_tag="PPUBIRD1_0039"
     CDS             complement(38916..40217)
                     /locus_tag="PPUBIRD1_RS00185"
                     /old_locus_tag="PPUBIRD1_0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589180.1"
                     /db_xref="GI:504402078"
                     /translation="MITTLSLDAVSAVRSNAYRKTAWRLMPFLMLCYLCAYLDRVNVG
                     FAKLQMMSDLALSEAVYGLGAGMFFIGYFLCEVPSNLILHRVGARRWIARIMISWGII
                     SALFAFVETAWQFYALRFLLGIAEAGLAPGLLLYLTYWFPSYRRAKMTVLWFVAIPLS
                     GMIGGPLSGWIMNQFAGFHGWAGWQWMFVIEAIPTVIVGLLVLTYLKDGVHQATWLTD
                     EEKELVTKELAEDNAHKVTHASPREFIRDRRLWLLACIYFCVVMGQYAITFWLPTLIR
                     NAGVSDPLHIGMLTSLPYMCAIVAMLLMGRSGDKHRERRWHLVVPMIAGAIGLTLAAL
                     LGGNLLLSVLSLCLAAAGVLSASSLFWMLPTTLLGGVSAAAGIAGINSFANLAGFCSP
                     YLIGWITTSTGSSAIGMYLITAVLLAGATLVLRIPAASVNR"
     gene            complement(40285..41034)
                     /locus_tag="PPUBIRD1_RS00190"
                     /old_locus_tag="PPUBIRD1_0040"
     CDS             complement(40285..41034)
                     /locus_tag="PPUBIRD1_RS00190"
                     /old_locus_tag="PPUBIRD1_0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003314121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589181.1"
                     /db_xref="GI:504402079"
                     /translation="MLLQGKVAIITGAASARGIGRATAATFAAQGARVVILDLDEAAA
                     RDAAASLGEGHLGLAANVADQAQVNQAVAQIIEHYGRIDVLVNNAGITQPLKTLDIKH
                     SDYDKVLDVSLRGTLLMSQAVIPLMREQRSGSIVCMSSVSAQRGGGIFGGPHYSAAKA
                     GVLGLAKAMARELGPDNVRVNAIAPGLIHTDITGGLMQDDRRHAIIDGIPLGRLGEAQ
                     DVANAALFLASDLSTYLTGITLDVNGGMLIH"
     gene            41229..42146
                     /locus_tag="PPUBIRD1_RS00195"
                     /old_locus_tag="PPUBIRD1_0041"
     CDS             41229..42146
                     /locus_tag="PPUBIRD1_RS00195"
                     /old_locus_tag="PPUBIRD1_0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_029380745.1"
                     /db_xref="GI:657294548"
                     /translation="MRSVDDTAPALPPLRAIQAFEQTARFGNVARAAEVLDLTPSAVS
                     HQLAKLEAMIGRQLFFRAARGVSLTPVGEQYLKDVSGILHSLSVATERASSDVSLDCL
                     RLHSSPSFGLLWLMPRLEAFRMAHPDIQINLSCSYESLHFSRDKIDVDIRHGEPNWPS
                     YEVRTLGNEAFAVLASPKLLARHRIDDASDLLRRDLILSEATLLKWPAWFARHGLARP
                     EKPYALSFDRSYMSLEAASHGLGFALESTLLAQKYLASGTLVEVVPHIFSAPVAAHHL
                     VFPKAHSGFERVRRFLAWMERELGHGFVF"
     gene            complement(42305..43342)
                     /locus_tag="PPUBIRD1_RS00200"
                     /old_locus_tag="PPUBIRD1_0042"
     CDS             complement(42305..43342)
                     /locus_tag="PPUBIRD1_RS00200"
                     /old_locus_tag="PPUBIRD1_0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589183.1"
                     /db_xref="GI:504402081"
                     /translation="MSQPLYRRVVPETYVQLLYEYLEALGHEPESVLGQPWPTPAQEG
                     VGGVDVECWDRLLLTAAQALDDPLLGLHVGQTISARHIGVLGSVLLACGNFGTAMQRL
                     ERYIRLVYDVIPMTRRDGDGWFELVWDVSQYQPGPLVNETGMVAIVQFCRALVRGTAN
                     PLRIDFNHPSPLDTSPYEAFFGCPVRFGQAEAVLRFSAQLLELPFKSPDPALVSLLEQ
                     HADRLLAQLPQQDEFVEQLRKTITHALREGEPSIERISPQLGTSSRTLQRRLQEAGTS
                     FRYELNLVRHELALSYLRDPRLQIVDIAMLLGYSEHSAFTRAFKEWSGRSPHEARQLN
                     SESYWAGSPWN"
     gene            43476..44396
                     /locus_tag="PPUBIRD1_RS00205"
                     /old_locus_tag="PPUBIRD1_0043"
     CDS             43476..44396
                     /locus_tag="PPUBIRD1_RS00205"
                     /old_locus_tag="PPUBIRD1_0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_041167116.1"
                     /db_xref="GI:752477840"
                     /translation="MNTITDLLAPATIQFFSNGSRCVADFYRPLGAGPFPVVVMAHGL
                     GGTRKMRLPAFATRFAAAGYACLVFDYRHFGDSDGEPRQLLDINRQLEDWKAAIDHAR
                     RHADVDSQRVVIWGTSFGGGHVLATAADDARVAAVISQCPFTDGLSSSLATELLVSLR
                     LTLLALADRIGSWFGAKPILVPLAGQPGDTAFMTSPDAWSGYNGLIPSGAHIRKEAAA
                     RFALDIIRYYPGRSTPRIQAPVLFCVCDPDSVAPAKQTLRHARRAPRHEIHRYAHGHF
                     DIYVGKAFEQVVGDQLDFLKRNVPSTPTKR"
     gene            44401..45264
                     /locus_tag="PPUBIRD1_RS00210"
                     /old_locus_tag="PPUBIRD1_0044"
     CDS             44401..45264
                     /locus_tag="PPUBIRD1_RS00210"
                     /old_locus_tag="PPUBIRD1_0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589185.1"
                     /db_xref="GI:504402083"
                     /translation="MYDLQGKVVLITGAAGGIGAASARELYVQGASLVLTDTSQEAVD
                     KLAQEFNSQRVLPLAFDVTDAEAAKAVIRQAVERFGRLDVAFANAGISWRGVPATLRT
                     CDEAEFRRIIEVDLFGVWHAMRAALPEVVRNRGQVLVTSSTYAYLNGMANAPYAASKA
                     AVESLARSLRAELSATGASASVLYPGWTATAIAKVAFGGNAIATQMNETLLPAFLHRA
                     IAPEQVARGVVRGLQKRQPRIVVPARWAPISLLRGLFNVFTDWHLTRDAHLQRLLHQL
                     EEETVRTQSPS"
     gene            45293..46159
                     /locus_tag="PPUBIRD1_RS00215"
                     /old_locus_tag="PPUBIRD1_0045"
     CDS             45293..46159
                     /locus_tag="PPUBIRD1_RS00215"
                     /old_locus_tag="PPUBIRD1_0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589186.1"
                     /db_xref="GI:504402084"
                     /translation="MKSYSLNDRVIAITGATGGLGRAAAQALRDKGAKLVLLDLDLDS
                     LNAMAVTLGGPNVAVGWVANVRSIESLETALKEAAQHFGGIDVVVAGAGVSSVVALEH
                     IDPATFDRVIDINLNGVARTFRASLPHVKARQGYLLAISSMAAFVHSPLNTAYTASKA
                     GVWALCDSLRLELRQHGVSVGSLHPTFFQTPMMEAIVDGPSSTLVWNNHQGIWQFVAL
                     EQVVAALVDCIEQRHDLVTVPRSQMLVAKAPGLLRRLIEWIGFDAGKVAEAVRLSDEV
                     KASLGQGRSLNE"
     gene            46425..47744
                     /locus_tag="PPUBIRD1_RS00220"
                     /old_locus_tag="PPUBIRD1_0046"
     CDS             46425..47744
                     /locus_tag="PPUBIRD1_RS00220"
                     /old_locus_tag="PPUBIRD1_0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein precursor"
                     /protein_id="WP_014589187.1"
                     /db_xref="GI:504402085"
                     /translation="MKINGCEIPCLSAQRKCAAWVKYTSVMALLSASTIAGANGIALN
                     EQSASSAGTAYAGRSSSALDASTIYGNPAGLTKLKRAEISGGAAIISGSDDISDAQSS
                     VAGTNRGDSVPLTILPFAYMSTPLDDRFSIGLGLYAPSGLINEYESTFQGRYQGSYSS
                     TKEVTLQPTIAYRINDYVSIGGGPTINHFDAELQNYLASGALNNGQDTEITLKGDDTA
                     IGYNVGLLVDLSDATSWGINYHSKVSYHLKGHTEVSGSPSVIPLDGKYDNKIDITMPE
                     SVDTSITHHFNSRWTGYLGTTWKRWSRLKKIEAINSDVSALGQSAGLERVDEPLNWHD
                     TWSTAVGTSFQLNQQWLLRAGYAYDPSPISNADRSVRVPVGNRQVVTLGGAYLPSPDL
                     TIDFAYGYLWESKASVNQANNSGLQPEYSANYENSANIFLVQASYRY"
     gene            complement(48338..49579)
                     /locus_tag="PPUBIRD1_RS00225"
                     /old_locus_tag="PPUBIRD1_0047"
     CDS             complement(48338..49579)
                     /locus_tag="PPUBIRD1_RS00225"
                     /old_locus_tag="PPUBIRD1_0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054140.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_014589188.1"
                     /db_xref="GI:504402086"
                     /translation="MNIHANRKSLVLVIPTLLLPINVWAEGFVEDTSATLTLRNFFFE
                     RNFTAPGVTQSHAREWTQGFIFDLKSGFTQGTVGFGVDVLGKYAVKLDGGAGEYGALL
                     LPKDGDGDPAGSFGRLGVALKAKLSNTEVKVGEWMPNFPIVTADDFRALPQTFRGAQI
                     ASQELKNWSFYAGEFTKTSLRNDSSMEDLSFGSAQSDSFTFLGADYRSSSKNTTVRLW
                     SGELEDIYKQHYLGLIQKWQLSQTVSLTSNLGYFWGKDTGVAKAGSLDNQTASALFSL
                     NIAQHSISIGLQNVSGDSGWMRIGGTGGIYLANNTFNHAFDNPRERSWQVRYDLNFVG
                     YGIPGLTLMTRYVHGDNVELRNVKDGSEWVRESELGYVFQSGKLRDLAVRWRNSSVRR
                     NFNASDYDENRLIVSYPLNIF"
     gene            complement(49794..50723)
                     /locus_tag="PPUBIRD1_RS00230"
                     /old_locus_tag="PPUBIRD1_0048"
     CDS             complement(49794..50723)
                     /locus_tag="PPUBIRD1_RS00230"
                     /old_locus_tag="PPUBIRD1_0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_012054141.1"
                     /db_xref="GI:501000999"
                     /translation="MSTKNTIDLKGLVPAPVTPFTRDGEVDYAAIQKLGAWLGSYEGV
                     KGLVVLGHAGEGTFLTQAEQGRVIQAFKESVGGRLPIIAGITGEGTQVAAEEAKRAVD
                     NGAAAGLVYPSHGWLRFGYQKGAAQDRYKAIYEESGLPLILFQYPDVTKATYDLETQL
                     EIAKQPGVFAMKNGVRNMRRWDTEIPVIRREVPDLQILTCHDEYLLHTMFDVDGALVG
                     YGGLTPEPLIELIAAGKRRDYPAARAIHDKLLPVTRNVYHRGSHMEGTVALKHGLVAR
                     GILDHATVRSPLLPLAEGADKEIADALRSAGLV"
     gene            complement(50847..52238)
                     /locus_tag="PPUBIRD1_RS00235"
                     /old_locus_tag="PPUBIRD1_0049"
     CDS             complement(50847..52238)
                     /locus_tag="PPUBIRD1_RS00235"
                     /old_locus_tag="PPUBIRD1_0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589189.1"
                     /db_xref="GI:504402087"
                     /translation="MLMQQVETDPLPDKVKSQANISARLERLPITKQVFWARNIIGAA
                     TFFDGYTVIAIAYAMPVLAKEWSLSGAQIGMILSAGYLGQLFGALIFGWLAEKLGRMK
                     VLTFTILLFVSMDVACLFASSAAMMIAFRFIQGIGTGGEVPVASAYINELIGSKKRGK
                     FFLLYEVMFLLGLVGAGIIGYFLVPIYGWQAMFAVGIVPAMLLIPLRFFLFESPRWLA
                     SKGRLDEADRIVTRLENSALKAGKTLQPPVEVPQIQTDKNGLGWKELFKGMYFKRSLV
                     IWAMWFGAYMVANGLITWLPTLYRQHFNLPLETSLAYGFMTSAGGVVAAVICALLIDK
                     VGRRRWYMGALFLAAIPLAILATTGASAPLKILALAGLGYALVQTVTFSLYLYSAELY
                     PTRLRALGTGVGSAWLRMGSALGPIIVGFTVSGAGVQYVFGTFAVVLLITATITALFA
                     IETKGRILEELSP"
     gene            53576..54298
                     /locus_tag="PPUBIRD1_RS00240"
     CDS             53576..54298
                     /locus_tag="PPUBIRD1_RS00240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_041166810.1"
                     /db_xref="GI:752477534"
                     /translation="MSSSQHIAIVDDYPDIRELVAQYLTQEGYRLTAVADGNELRALL
                     DRDVPDLIILDVMMPGEDGLSLCRHIRSRSNTPVLFLSARTEDLDVILGLEMGGDDYL
                     KKPFNPRELLARVKALLRRATPASEGASSMLEGSIRFGEWVLNCKLRELLGADGVSVS
                     LSGTEFRLLAALLEKPGEIVTRDELLNKVSGRASEPFDRSIDNQISRLRRKIEPDPKN
                     PIYIRTHWGGGYAFVHLVSNSS"
     gene            54295..55695
                     /locus_tag="PPUBIRD1_RS00245"
                     /old_locus_tag="PPUBIRD1_0051"
     CDS             54295..55695
                     /locus_tag="PPUBIRD1_RS00245"
                     /old_locus_tag="PPUBIRD1_0051"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014589191.1"
                     /db_xref="GI:504402089"
                     /translation="MKLRNPNLAARFIGLMLLALIVSQALTLSIFWDERAGALREVAK
                     SDFLSRTSSLASLLDRMPVDERQMTLQVSSTAYERFWLFPASPSQPSEWWKFARRHLL
                     EPLSHGKPQGTLSIQFRSEDEVPPATIDATAAWSVPGEALWPSPRTARFIYLPQLNVM
                     GVATPLNNGTWLHAAYAKPVTDSPFSRRALVSLGITALALTLIAVLIARGISQPLRDL
                     ALAAQRLGRGHSGTELREHGPEDIRRTAKAFNQMQRRIQRFVDDRTRMLAAVGHDLRT
                     PLTSLRLRVEFIQDPEVQRKMLATLDEITAITEAAIGYGRDNAVTEPTRTMDIGTLVE
                     SLCEDLVTLGMAVSFSCNSKVILECRPDALRRAIRNLIENAVRYGECADVRVYSADKH
                     VHISVTDRGNGIPDSELEAVFTPFYRLEHSRNRNTGGVGLGLSIVRSIARQHGGEITL
                     INHNGGLEAIISLPEN"
     gene            55804..56640
                     /locus_tag="PPUBIRD1_RS00250"
                     /old_locus_tag="PPUBIRD1_0052"
     CDS             55804..56640
                     /locus_tag="PPUBIRD1_RS00250"
                     /old_locus_tag="PPUBIRD1_0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_012054147.1"
                     /db_xref="GI:501001005"
                     /translation="MAPRTSTKSETTAAEEDKNQRSTVQSLAKGFRVLEAFTAESDEL
                     TLSQIAAKAELDPGTTYRMLNTLVDLGYVSRIPESKRFSLTLKILNLGFHAIAHTDLR
                     SLVRPVLRGLVSETSEAASFAVLQGADVLYLERVRAGITRLGVDIRIGTTVPACQTAI
                     GQSILAFLPDHEVERIKELSSSTSFMSKSLSRPLSEVLEQIRKDGYIITESLFAEGLR
                     ILAVPVLDIDGYPVGAISIAAPAVRCTTEELERRALSVTIAAAKNIGRALQASGSINS
                     SL"
     gene            57087..57782
                     /locus_tag="PPUBIRD1_RS00255"
                     /old_locus_tag="PPUBIRD1_0053"
     CDS             57087..57782
                     /locus_tag="PPUBIRD1_RS00255"
                     /old_locus_tag="PPUBIRD1_0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit A"
                     /protein_id="WP_012054148.1"
                     /db_xref="GI:501001006"
                     /translation="MINKTFESIASAVEGIIDGSTIMVGGFGTAGMPSELIDGLIATG
                     ARDLTIISNNAGNGEIGLAALLKAGCVRKVVCSFPRQSDSYVFDELYRAGKIELEVVP
                     QGNLAERIRAAGSGIGAFFSPTGYGTLLAEGKETREIDGRMYVLEMPLHADFALIKAH
                     KGDRWGNLVYRKAARNFGPIMAMAAKTAIAQVDQIVELGELDQEHIITPGIFVQRVVA
                     VSGAAASSIINAA"
     gene            57791..58432
                     /locus_tag="PPUBIRD1_RS00260"
                     /old_locus_tag="PPUBIRD1_0054"
     CDS             57791..58432
                     /locus_tag="PPUBIRD1_RS00260"
                     /old_locus_tag="PPUBIRD1_0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012054149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoadipate CoA-transferase subunit B"
                     /protein_id="WP_012054149.1"
                     /db_xref="GI:501001007"
                     /translation="MSITKKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANFLGDKE
                     VFLHSENGLLGMGPSPAPEEEDDDLINASKEHVTMLPGGAFFHHADSFSMMRGGHLDI
                     AVLGAFQVSVKGDLANWHTGAEGSIPAVGGAMDLATGARQVFVMMNHLTKSGESKLVP
                     ECTYPPTGFGCVSRIYTDMAVLEVTSDGLRVVEICAEIDFEQLQALSGVPLIQ"
     gene            complement(58778..60613)
                     /locus_tag="PPUBIRD1_RS00265"
                     /old_locus_tag="PPUBIRD1_0055"
     CDS             complement(58778..60613)
                     /locus_tag="PPUBIRD1_RS00265"
                     /old_locus_tag="PPUBIRD1_0055"
                     /EC_number="2.6.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190289.1"
                     /note="Glucosamine--fructose-6-phosphate aminotransferase
                     [isomerizing]; Catalyzes the first step in hexosamine
                     metabolism, converting fructose-6P into glucosamine-6P
                     using glutamine as a nitrogen source; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /protein_id="WP_014589193.1"
                     /db_xref="GI:504402091"
                     /translation="MCGIVGAIAERNITAILIEGLKRLEYRGYDSAGLAVLTQNGELQ
                     RRRRIGKVSELEVAVADDPLAGQLGIAHTRWATHGAPTEGNAHPHFSGNDVAVVHNGI
                     IENHEELREELKGLGYVFTSQTDTEVIVHLIHHTLKSLPNLTDALKAAVKRLHGAYGL
                     ALISAKQPDRLVAARSGSPLVIGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRR
                     DQVSIWDQQGNKVQRETVQYHEGAEAADKGAYRHFMLKEIHEQPSVVQRTLEGRLGKD
                     NVLVQAFGPQAADLFAKVRNVQIVACGTSYHAGMVARYWLESLAGIPCQVEVASEFRY
                     RKVVVQPDTLFVSISQSGETADTLAALRNAKELGFLGSLAICNVGISSLVRESDLTLL
                     TLAGPEIGVASTKAFTTQLVSLMLLTLALGQVRGTLEAGAEAELVEELRRLPTRLGEA
                     LAMDATVEKIAELFADKHHTLFLGRGAQYPVAMEGALKLKEISYIHAEAYPAGELKHG
                     PLALVDNDMPVVTVAPNNELLEKLKSNLQEVRARGGELVVFADEHAGMTNGEGTHVIK
                     VPHIADALAPILYTIPLQLLSYYVAVLKGTDVDQPRNLAKSVTVE"
     gene            complement(60617..61393)
                     /locus_tag="PPUBIRD1_RS00270"
                     /old_locus_tag="PPUBIRD1_0056"
     CDS             complement(60617..61393)
                     /locus_tag="PPUBIRD1_RS00270"
                     /old_locus_tag="PPUBIRD1_0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014589194.1"
                     /db_xref="GI:504402092"
                     /translation="MSKRNTPQRRHNILALLSEQGEVSVDALAKRFATSEVTIRKDLA
                     ALETNGLLLRRYGGAVPVPQELLGEPAQPVSSYKKAIARAAVGRIREHARIIIDSGST
                     TAAMIPELGRQPGLVVMTNSLNVARAICDLEHEPVLLMTGGTWDPHSESFQGQVAEQV
                     LRSYDFDQLFIGADGIDLGRGTTTFNELLGLSRVMAEVAREVIVMVESDKVGRKIPNL
                     ELPWGSVHTLITDERLPAAAREQIQARGVNLICAAISQEQ"
     gene            complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_RS00275"
                     /old_locus_tag="PPUBIRD1_0057"
     CDS             complement(61590..62957)
                     /gene="glmU"
                     /locus_tag="PPUBIRD1_RS00275"
                     /old_locus_tag="PPUBIRD1_0057"
                     /EC_number="2.7.7.23"
                     /EC_number="2.3.1.157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750111.1"
                     /note="UDP-N-acetylglucosamine pyrophosphorylase; forms a
                     homotrimer; catalyzes the acetylation of
                     glucosamine-1-phosphate and uridylation of
                     N-acetylglucosamine-1-phosphate to produce UDP-GlcNAc;
                     function in cell wall synthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase"
                     /protein_id="WP_014589195.1"
                     /db_xref="GI:504402093"
                     /translation="MSLDIVILAAGQGTRMRSALPKVLHPVAGNSMLGHVIHSARQLQ
                     PQGIHVVIGHGAELVRERLAADDLNFVMQDKQLGTGHAVAQALPALTADTVLVLYGDV
                     PLIEVETLQRLLAKANDQQLGLLTVTLDDPTGYGRIVRDEQGKVTAIVEHKDASDAQK
                     AIKEGNTGILALPAARLADWMGRLSNNNAQGEYYLTDVIAMAVADGLVVATEQPHDAM
                     EVQGANDRRQLSELERHYQLREGRRLMAQGVTLRDPARFDVRGEVSVGRDVLIDINVI
                     LEGKVVIEDDVQIGPNCVIKNTTLRKGAVVKANSHLEGAVMGEGSDAGPFARLRPGSV
                     LDAKAHVGNFVELKNTHLGEGAKAGHLTYLGDAEIGARTNIGAGTITCNYDGANKFKT
                     VMGEDVFIGSNNSLVAPVEIKAGATTAAGSTITQAVDAGDLAVARARQRNISGWKRPE
                     KIKKS"
     gene            complement(63076..63495)
                     /locus_tag="PPUBIRD1_RS00280"
                     /old_locus_tag="PPUBIRD1_0058"
     CDS             complement(63076..63495)
                     /locus_tag="PPUBIRD1_RS00280"
                     /old_locus_tag="PPUBIRD1_0058"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003260039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase epsilon chain"
                     /protein_id="WP_016489909.1"
                     /db_xref="GI:512732033"
                     /translation="MAMTVHCDIVSAEGEIFSGLVEMVVAHGNLGDLGIAPGHAPLIT
                     NLKPGPITLTKQGGAQEVFYISGGFLEVQPNMVKVLADTVQRAADLDEAQAQEALKAA
                     ENALNLKGADFDYGAAAARLAEAAAQLRTVQQMRKGK"
     gene            complement(63539..64915)
                     /locus_tag="PPUBIRD1_RS00285"
                     /old_locus_tag="PPUBIRD1_0059"
     CDS             complement(63539..64915)
                     /locus_tag="PPUBIRD1_RS00285"
                     /old_locus_tag="PPUBIRD1_0059"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit beta"
                     /protein_id="WP_003253197.1"
                     /db_xref="GI:489346062"
                     /translation="MSSGRIVQIIGAVIDVEFPRDVVPSVYNALKVQGAETTLEVQQQ
                     LGDGVVRTIAMGSTEGLKRGLDVVDTGAAISVPVGKATLGRIMDVLGNPIDEAGPIGE
                     EERRGIHQPAPSFADQAGGNDLLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMME
                     LIRNIAMEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVALVYGQMNEPPGNRLRV
                     ALTGLTMAEKFRDEGNDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGV
                     LQERITSTKEGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASLGIYPAVD
                     PLDSTSRQLDPNVIGNEHYETARGVQYVLQRYKELKDIIAILGMDELSEADKQLVARA
                     RKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIAGFSGILKGDYDHLPEQAFYMVGSIDE
                     AIEKAKKL"
     gene            complement(64943..65803)
                     /locus_tag="PPUBIRD1_RS00290"
                     /old_locus_tag="PPUBIRD1_0060"
     CDS             complement(64943..65803)
                     /locus_tag="PPUBIRD1_RS00290"
                     /old_locus_tag="PPUBIRD1_0060"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002555983.1"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. The gamma chain is a
                     regulatory subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase gamma chain"
                     /protein_id="WP_003253195.1"
                     /db_xref="GI:489346060"
                     /translation="MAGAKEIRSKIASIKSTQKITSAMEKVAVSKMRKAQMRMAASRP
                     YAERIRQVIGHLANANPEYRHPFMIERPVKRAGYIVVSSDRGLCGGLNTNLFKALVKD
                     MSANREQGVEIDLCVIGSKGATFFRIFGGNVVAAISHLGEEPSINDLIGSVKVMLDAY
                     LDGRIDRLSVVSNKFINTMTQKPTVEQLVPLVATPDQDLKHHWDYLYEPDAKELLDGL
                     MVRYVESQVYQAVVENNAAEQAARMIAMKNATDNAGDLIKELQLIYNKARQAAITQEI
                     SEIVGGAAAV"
     gene            complement(65852..67396)
                     /locus_tag="PPUBIRD1_RS00295"
                     /old_locus_tag="PPUBIRD1_0061"
     CDS             complement(65852..67396)
                     /locus_tag="PPUBIRD1_RS00295"
                     /old_locus_tag="PPUBIRD1_0061"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003115400.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the alpha chain is a
                     catalytic subunit; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F0F1 ATP synthase subunit alpha"
                     /protein_id="WP_003253193.1"
                     /db_xref="GI:489346058"
                     /translation="MQQLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHG
                     LADVMYGEMIEFPGGVYGMALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGK
                     ELLGRVVDALGNPIDGKGPLGNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPV
                     GRGQRELIIGDRQIGKTAMAIDAIINQKDSGIFCVYVAVGQKRSTVANIVRKLEENGA
                     LANTIVVVASASESAALQFLAPYAGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISL
                     LLRRPPGREAYPGDVFYLHSRLLERASRVSEEYVEKFTNGAVTGKTGSLTALPIIETQ
                     AGDVSAFVPTNVISITDGQIFLESAMFNSGIRPAVNAGVSVSRVGGAAQTKIIKKLSG
                     GIRTALAQYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPMSIADMALSLY
                     AAERGFLIDVEVSKIGSFEQALIAFFNRDHAELMAKINVKGDFNDEIDAGLKAGIEKF
                     KATQTW"
     gene            complement(67418..67954)
                     /locus_tag="PPUBIRD1_RS00300"
                     /old_locus_tag="PPUBIRD1_0062"
     CDS             complement(67418..67954)
                     /locus_tag="PPUBIRD1_RS00300"
                     /old_locus_tag="PPUBIRD1_0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014861150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit delta"
                     /protein_id="WP_003253191.1"
                     /db_xref="GI:489346056"
                     /translation="MAELTTLARPYAKAAFEHAQAHQQLANWSAMLGLAAAVSQDDTM
                     QRLLKAPRLTSAEKAATFIDVCGDKFNAQAQNFIHVAAENDRLLLLPEIAALFDLYKA
                     EQEKSVDVEVTSAFALNQEQQDKLAKVLSARLGQEVRLHASEDASLIGGVVIRAGDLV
                     IDGSVRGKIAKLAEALKS"
     gene            complement(67967..68437)
                     /locus_tag="PPUBIRD1_RS00305"
                     /old_locus_tag="PPUBIRD1_0063"
     CDS             complement(67967..68437)
                     /locus_tag="PPUBIRD1_RS00305"
                     /old_locus_tag="PPUBIRD1_0063"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013717981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit b"
                     /protein_id="WP_010955888.1"
                     /db_xref="GI:499258348"
                     /translation="MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGL
                     DAANRAARDLELAQEKAGQQLREAKAQAAEIIEQSKKRAAQLVDEAREQARVEADRVK
                     AQALAEIEQELNSAKDALRAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI"
     gene            complement(68494..68751)
                     /locus_tag="PPUBIRD1_RS00310"
     CDS             complement(68494..68751)
                     /locus_tag="PPUBIRD1_RS00310"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88BW9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit c"
                     /protein_id="WP_003097235.1"
                     /db_xref="GI:489187836"
                     /translation="METVVGLTAIAVALLIGLGALGTAIGFGLLGGKFLEGAARQPEM
                     VPMLQVKMFIVAGLLDAVTMIGVGIALFFTFANPFVGQIAG"
     gene            complement(68896..69765)
                     /locus_tag="PPUBIRD1_RS00315"
                     /old_locus_tag="PPUBIRD1_0064"
     CDS             complement(68896..69765)
                     /locus_tag="PPUBIRD1_RS00315"
                     /old_locus_tag="PPUBIRD1_0064"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B0KRB4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit a"
                     /protein_id="WP_010955889.1"
                     /db_xref="GI:499258349"
                     /translation="MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAF
                     HLDTLGWSVALGLIFLLIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSP
                     VIAPLALTIFVWVFLMNAVDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAF
                     CVFALIIFYSIKVKGLGGFIGELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISL
                     ALRLFGNMYAGELVFILIAVMFGSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMML
                     TIVYLSMAHEDNH"
     gene            complement(69782..70189)
                     /locus_tag="PPUBIRD1_RS00320"
                     /old_locus_tag="PPUBIRD1_0065"
     CDS             complement(69782..70189)
                     /locus_tag="PPUBIRD1_RS00320"
                     /old_locus_tag="PPUBIRD1_0065"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase protein I"
                     /protein_id="WP_010955890.1"
                     /db_xref="GI:499258350"
                     /translation="MEIRTPNRLPFHRWAVFPVLLAQFVVLLLATLVLWQWKGSVSGY
                     SGLCGGLIAWLPNVYFAWKAFRFSGARAAQAIVKSFYAGEAGKMILTAVLFALTFAGV
                     KPLAPLAVFGVFVLTLLVSWFAPLLMNKRLSRP"
     gene            complement(70339..71211)
                     /locus_tag="PPUBIRD1_RS00325"
                     /old_locus_tag="PPUBIRD1_0066"
     CDS             complement(70339..71211)
                     /locus_tag="PPUBIRD1_RS00325"
                     /old_locus_tag="PPUBIRD1_0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012274912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome-partitioning protein ParB"
                     /protein_id="WP_003253185.1"
                     /db_xref="GI:489346050"
                     /translation="MAVKKRGLGRGLDALLSGPSVSALEEQAVKIDQKELQHLPVELV
                     QRGKYQPRRDMDPEALEELAHSIRNHGVMQPIVVRPIGDNRYEIIAGERRWRATQQAG
                     LDTIPAMVREVPDEAAIAMALIENIQREDLNPLEEAMALQRLQQEFELTQQQVADAVG
                     KSRVTVANLLRLITLPDAIKTMLAHGDLEMGHARALLGLDENRQEEGARHVVARGLTV
                     RQTEALVRQWLSDKPDPVEPSKPDPDIARLEQRLAERLGSAVQIRHGNKGKGQLVIRY
                     NSLDELQGVLAHIR"
     gene            complement(71221..72012)
                     /locus_tag="PPUBIRD1_RS00330"
                     /old_locus_tag="PPUBIRD1_0067"
     CDS             complement(71221..72012)
                     /locus_tag="PPUBIRD1_RS00330"
                     /old_locus_tag="PPUBIRD1_0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_019436532.1"
                     /db_xref="GI:518266324"
                     /translation="MAKVFAIANQKGGVGKTTTCINLAASLAATKRRVLLIDLDPQGN
                     ATMGSGVDKHELEHSVYDLLIGECDLAQAMHYSEHGGFQLLPANRDLTAAEVVLLEMQ
                     VKESRLRNALAPIRDNYDYILIDCPPSLSMLTLNALVASDGVIIPMQCEYYALEGLSD
                     LVDNIKRIAERLNPELKIEGLLRTMYDPRLSLNNDVSAQLKEHFGPQLYDTVIPRNIR
                     LAEAPSFGMPALAYDKQSRGALAYLALAGELVRRQRRPSRTAQTT"
     gene            complement(72031..72681)
                     /locus_tag="PPUBIRD1_RS00335"
                     /old_locus_tag="PPUBIRD1_0068"
     CDS             complement(72031..72681)
                     /locus_tag="PPUBIRD1_RS00335"
                     /old_locus_tag="PPUBIRD1_0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A124.1"
                     /note="Ribosomal RNA small subunit methyltransferase G;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_014589198.1"
                     /db_xref="GI:504402096"
                     /translation="MSSLVTPQHAEELSTGARQLGVELTAEQHEKLLGYLALLIKWNK
                     AYNLTAVRDPDEMVSRHLLDSLSVMSFIHNGRDNWLDVGSGGGMPGIPLAILHPHKRV
                     TVLDANGKKTRFLTQVKMELRLDNLMVIHSRVEAFQPAQPFDGIISRAFSSMENFTNW
                     TRHLGDTGTQWLAMKGLHPADELVALPADFTVESEQALTVPGCQGQRHLLILRRKA"
     gene            complement(72678..74570)
                     /gene="gidA"
                     /locus_tag="PPUBIRD1_RS00340"
                     /old_locus_tag="PPUBIRD1_0069"
     CDS             complement(72678..74570)
                     /gene="gidA"
                     /locus_tag="PPUBIRD1_RS00340"
                     /old_locus_tag="PPUBIRD1_0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017848940.1"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme mnmG; GidA; glucose-inhibited cell
                     division protein A; involved in the
                     5-carboxymethylaminomethyl modification (mnm(5)s(2)U) of
                     the wobble uridine base in some tRNAs; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein"
                     /protein_id="WP_014589199.1"
                     /db_xref="GI:504402097"
                     /translation="MDFPSRFDVIVIGGGHAGTEAALASARMGVKTLLLTHNVETLGH
                     MSCNPAIGGIGKSHLVKEIDALGGAMALATDKSGIQFRVLNNRKGPAVRATRAQADRA
                     IYKAVVREILENQPNLWIFQQSCDDLIVEQDQVKGVVTQMGLRFFAESVVLTTGTFLG
                     GLIHIGLQNHSGGRAGDPPSIALAHRMRELPLRVGRLKTGTPPRIDGRSVDFSVMTEQ
                     PGDTPIPVMSFMGNAEMHPRQVSCWITHTNARTHEIIASNLDRSPMYSGVIEGVGPRY
                     CPSIEDKIHRFADKESHQVFIEPEGLNTHELYPNGISTSLPFDVQLELVRSIRGMENA
                     HIVRPGYAIEYDYFDPRDLKYSLETKVIGGLFFAGQINGTTGYEEAGAQGLLAGTNAA
                     LRAQGRDSWCPRRDEAYIGVLVDDLITLGTQEPYRMFTSRAEYRLILREDNADLRLTE
                     KGRELGLIDDQRWAAFCAKRDGIEREEQRLKSTWVRPNTEQGQAIVDKFGTPLSHEYS
                     LLNLLARPEIDYAGLIEATGGEAIDPQVAEQVEIRTKYAGYIDRQQDEIARLRASEDT
                     RLPVDIDYTTISGLSKEIQGKLSQTRPETLGQASRIPGVTPAAISLLLIHLKKRGAGR
                     ELEQSA"
     gene            complement(75203..76573)
                     /locus_tag="PPUBIRD1_RS00345"
                     /old_locus_tag="PPUBIRD1_0070"
     CDS             complement(75203..76573)
                     /locus_tag="PPUBIRD1_RS00345"
                     /old_locus_tag="PPUBIRD1_0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase MnmE"
                     /protein_id="WP_010951424.1"
                     /db_xref="GI:499253884"
                     /translation="MNTVRETIAAIATAQGRGGVGIVRLSGPLAAKAGLLITGRTLTP
                     RHAHYGPFRDDEGLVLDEGIALFFPGPNSFTGEDVLELQGHGGPVVLDMLLQRCVQVG
                     CRLARPGEFSERAFLNDKLDLAQAEAIADLIEASSSQAARNALRSLQGEFSRRVHSLT
                     EALIALRIYVEAAIDFPEEEIDFLADGHVLSMLDAVRSELSTVQREAGQGALLRDGMT
                     VVIAGRPNAGKSSLLNQLAGREAAIVTDIAGTTRDILREHIHIDGMPLHVVDTAGLRD
                     TDDHVEKIGVERALKAIGEADRVLLVVDSTAPEASDPFALWPEFLAQRPDPAKVTLIR
                     NKADLSGERVALEQCDDGHVTITLSAKGDDTGLQLLRDHLKGCMGYEQTAESGFSARR
                     RHLDALRQASEHLEHGRAQLTLAGAGELLAEDLRQAQHALGEITGAFSSDDLLGRIFS
                     SFCIGK"
     gene            complement(76662..78344)
                     /locus_tag="PPUBIRD1_RS00350"
                     /old_locus_tag="PPUBIRD1_0071"
     CDS             complement(76662..78344)
                     /locus_tag="PPUBIRD1_RS00350"
                     /old_locus_tag="PPUBIRD1_0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5WBB7.1"
                     /note="functions to insert inner membrane proteins into
                     the IM in Escherichia coli; interacts with transmembrane
                     segments; functions in both Sec-dependent and -independent
                     membrane insertion; similar to Oxa1p in mitochondria;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein insertase YidC"
                     /protein_id="WP_010951425.1"
                     /db_xref="GI:499253885"
                     /translation="MDIKRTILIAALAVVSYVMVLKWNDDYGQAALPTQNTAASTVAP
                     GLPDGVPAGNNGASADVPSANAESSPAELAPVALSKDLIRVKTDVLELAIDPVGGDIV
                     QLNLPKYPRRQDHPNIPFQLFDNGGERVYLAQSGLTGTDGPDARASGRPLYAAEQKSY
                     QLADGQEQLVVDLKFSDNGVNYIKRFSFKRGEYDLNVSYLIDNQSGQAWNGNMFAQLK
                     RDASGDPSSSTATGTATYLGAALWTASEPYKKVSMKDIDKGSLKENVSGGWVAWLQHY
                     FVTAWIPAKSDNNVVQTRKDSQGNYIIGYTGPVISVPAGGKVETSALLYAGPKIQSKL
                     KELSPGLELTVDYGFLWFIAQPIFWLLQHIHSLLGNWGWSIIVLTMLIKGLFFPLSAA
                     SYRSMARMRAVAPKLAALKERFGDDRQKMSQAMMELYKKEKINPLGGCLPILVQMPVF
                     LALYWVLLESVEMRQAPWILWITDLSIKDPFFILPIIMGATMFIQQRLNPTPPDPMQA
                     KVMKMMPIIFTFFFLWFPAGLVLYWVVNNCLSISQQWYITRRIEAATKKAAA"
     gene            complement(78585..78989)
                     /gene="rnpA"
                     /locus_tag="PPUBIRD1_RS00355"
                     /old_locus_tag="PPUBIRD1_0072"
     CDS             complement(78585..78989)
                     /gene="rnpA"
                     /locus_tag="PPUBIRD1_RS00355"
                     /old_locus_tag="PPUBIRD1_0072"
                     /EC_number="3.1.26.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A167.1"
                     /note="protein component of RNaseP which catalyzes the
                     removal of the 5'-leader sequence from pre-tRNA to produce
                     the mature 5'terminus; this enzyme also cleaves other RNA
                     substrates; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="WP_003253166.1"
                     /db_xref="GI:489346031"
                     /translation="MVSQDFSREKRLLTPRHFKAVFDSPTGKVPGKNLLILARENGLD
                     HPRLGLVIGKKSVKLAVQRNRLKRLMRDSFRLNQQLLAGLDIVIVARKGLGEIENPEL
                     HQHFGKLWKRLARSRPTPAVTANSAGVDSQDA"
     gene            79733..81253
                     /locus_tag="PPUBIRD1_RS00360"
                     /old_locus_tag="PPUBIRD1_0074"
     CDS             79733..81253
                     /locus_tag="PPUBIRD1_RS00360"
                     /old_locus_tag="PPUBIRD1_0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_010951427.1"
                     /db_xref="GI:499253887"
                     /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPN
                     RFVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASL
                     AQTQAHKTAPAAAVEPVAVAAAEPVLVETSSRDSFDAMAEPAAAPPSGGGRAEQRTVQ
                     VEGALKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKT
                     HLMHAVGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDI
                     QFFARKERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVE
                     PPELETRVAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRD
                     ITIELIRESLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAM
                     ALSKELTNHSLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
     gene            81294..82397
                     /locus_tag="PPUBIRD1_RS00365"
                     /old_locus_tag="PPUBIRD1_0075"
     CDS             81294..82397
                     /locus_tag="PPUBIRD1_RS00365"
                     /old_locus_tag="PPUBIRD1_0075"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002551317.1"
                     /note="binds the polymerase to DNA and acts as a sliding
                     clamp; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_003253156.1"
                     /db_xref="GI:489346021"
                     /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSL
                     TGTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAG
                     RSRFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLL
                     EVSRNTLRAVSTDGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIV
                     LGQHHIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSN
                     EKYRGIRLQLAAGQLKIQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTT
                     EQVRLILSDSNSSALLQEAGNDDSSYVVMPMRL"
     gene            82413..83516
                     /locus_tag="PPUBIRD1_RS00370"
                     /old_locus_tag="PPUBIRD1_0076"
     CDS             82413..83516
                     /locus_tag="PPUBIRD1_RS00370"
                     /old_locus_tag="PPUBIRD1_0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RW7.1"
                     /note="DNA replication and repair protein recF; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecF"
                     /protein_id="WP_014589201.1"
                     /db_xref="GI:504402099"
                     /translation="MSLRRIMVTAVRNLHPVTLLPSPRINILYGANGSGKTSVLEAVH
                     LLGLARSFRSTRLNPVIQYEQAACTVFGEVQLTEGGTSNLGVSRERQGEFTIRIDGQN
                     ARSAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALR
                     QRNSWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGL
                     TLSYYRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQ
                     KLVVCALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELHCQVFITCV
                     DHELLREGWQTETPVALFHVEQGRITQTHDHRE"
     gene            83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_RS00375"
                     /old_locus_tag="PPUBIRD1_0077"
     CDS             83521..85941
                     /gene="gyrB"
                     /locus_tag="PPUBIRD1_RS00375"
                     /old_locus_tag="PPUBIRD1_0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092201.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_003253152.1"
                     /db_xref="GI:489346017"
                     /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFE
                     VVDNSIDEALAGHCDDITVIIHPDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHA
                     GGKFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVG
                     DSETTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFK
                     YEGGLRAFVEYLNTNKTPVNSQVFHFNVQRDDGVGVEVALQWNDSFNENLLCFTNNIP
                     QRDGGTHLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKF
                     SSQTKDKLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKARE
                     MTRRKGALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKG
                     KILNVEKARFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHI
                     RTLLLTFFFRQLPELVERGYIYIAQPPLYKVKRGKQEQYIKDDEAMEEYMTQSALEDA
                     SLHLDESAPAVSGVQLEALVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQLGD
                     HAVMQAWLAQFQARLNSSQKSGLAYNASLREDKERNVWLPEVEITSHGLASYITFNRD
                     FFGSNDYRTVVNIGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQR
                     YKGLGEMNPDQLWETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNA
                     LSVSNLDF"
     gene            complement(86006..86413)
                     /locus_tag="PPUBIRD1_RS00380"
     CDS             complement(86006..86413)
                     /locus_tag="PPUBIRD1_RS00380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019438064.1"
                     /db_xref="GI:518267856"
                     /translation="MKKALTVICAALMLSTPLASFAQPGPPDRHDGGPSHQGNPPHGQ
                     PQHQGRHDNGRGPAYRDPNFRPQQGMPIPHKQWQRGHAVDPHYRGDRYWVTDWQARHL
                     YAPPRDHRWLYVNGDYVLVAIASGVIVNILAGY"
     gene            complement(86544..87836)
                     /locus_tag="PPUBIRD1_RS00385"
                     /old_locus_tag="PPUBIRD1_0080"
     CDS             complement(86544..87836)
                     /locus_tag="PPUBIRD1_RS00385"
                     /old_locus_tag="PPUBIRD1_0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_014589203.1"
                     /db_xref="GI:504402101"
                     /translation="MPEAHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGR
                     HDQAPLGEKCHRVSHHYAVPCDQAGEHCPMRKAWDSKVPERVLHIHHTPRGPEHVDVE
                     LRPILDEQGKVVAFVERLTTITLASAQPQEQGLVGRAPTFKAALASLQRAAPAQIPVL
                     LQGESGTGKELFARAVHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQR
                     KIGLAEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLISATH
                     KPLKQMVADGSFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMVGQPTPRLSE
                     DALQQLALHPFPGNIRELRNILERARLFADDGVIRPEHLPEDTGLTGAPKGSGRRNDL
                     GELAQALELFKGSRSELASHLGMSERTLYRRLKALGLN"
     gene            88059..88943
                     /locus_tag="PPUBIRD1_RS00390"
                     /old_locus_tag="PPUBIRD1_0081"
     CDS             88059..88943
                     /locus_tag="PPUBIRD1_RS00390"
                     /old_locus_tag="PPUBIRD1_0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase"
                     /protein_id="WP_010951461.1"
                     /db_xref="GI:499253921"
                     /translation="MIIGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYDPK
                     SGRTCSASADRLIERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQ
                     VQKVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIED
                     AGEIAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGG
                     RDMQYVTTVAEQRAHNIHIHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMRSGQL
                     PPPEANGVSYLKIPLNKL"
     gene            88984..90252
                     /locus_tag="PPUBIRD1_RS00395"
                     /old_locus_tag="PPUBIRD1_0082"
     CDS             88984..90252
                     /locus_tag="PPUBIRD1_RS00395"
                     /old_locus_tag="PPUBIRD1_0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_014589205.1"
                     /db_xref="GI:504402103"
                     /translation="MPALLSPANTDHHKVVIVGAGAAGIATASSLTSRDPSLDVALID
                     PAEVHYYQPGWTMVGAGVFKAPSTARTMASTIPRGVRWVKARVKGFDPLAQLVILDDG
                     RAISYEQLIVCPGLKLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRAL
                     FSQPPMPIKCAGAPQKALYLSCDHWLRHGHLGAVKASFYNAGAVLFGVADYVPALMKY
                     IEKYAVDLNFSHRLVAVDGPGKRATFLRTLPDGSSETRIEAFDMLHVVPPQVAPDFIR
                     ESPLADSSGWVDVDPHTLRHRKYTNVHALGDVANTSNAKTAAAARKQAPVVANNVLVA
                     LGRLATLAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPNWLLDGRKPTRLAWLLK
                     AQALPPLYWQGMLKGREWLARPQLVAEGGQ"
     gene            90249..91067
                     /locus_tag="PPUBIRD1_RS00400"
                     /old_locus_tag="PPUBIRD1_0083"
     CDS             90249..91067
                     /locus_tag="PPUBIRD1_RS00400"
                     /old_locus_tag="PPUBIRD1_0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589206.1"
                     /db_xref="GI:504402104"
                     /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVE
                     AAPVGLLAVGLAAAVGAVLGLRQGLVRYRAALFIALVGVAAAPFGLMLAHRLPNAPLQ
                     VVFAGVLVYACLRIWRKAAKELRGEANDAHRFIEPCVLNPLQGRLRWTLPCARALAFT
                     GALSGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGV
                     MHWQVGAPFAVGAVLGLLLARPLAARLAGPRLQQMFAVAGWAAALLLAGKALLG"
     gene            complement(91056..91943)
                     /locus_tag="PPUBIRD1_RS00405"
                     /old_locus_tag="PPUBIRD1_0084"
     CDS             complement(91056..91943)
                     /locus_tag="PPUBIRD1_RS00405"
                     /old_locus_tag="PPUBIRD1_0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589207.1"
                     /db_xref="GI:504402105"
                     /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSL
                     GTALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIG
                     IMFFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDY
                     RLALYASQDYLDRAPPLRHREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVVFRST
                     SVIAQQAAARAGLGIAVLPNYMARHDPTLVRVLPGETIQRSYWICTRRELHKSVRLRV
                     VWDYLLALCAAEQSELLAE"
     gene            92178..93824
                     /locus_tag="PPUBIRD1_RS00410"
                     /old_locus_tag="PPUBIRD1_0085"
     CDS             92178..93824
                     /locus_tag="PPUBIRD1_RS00410"
                     /old_locus_tag="PPUBIRD1_0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase"
                     /protein_id="WP_014589208.1"
                     /db_xref="GI:504402106"
                     /translation="MPSADSVFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDN
                     YPWIHIPVGYLYCIGNPRTDWCFKTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRG
                     QAADYDHWAAQGNDGWAWKDVLPLFKASENHFAGASEYHGAEGEWRVERQRYSWPILD
                     AFRDAAEQSGIGKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPIKDRANLTVLT
                     GVQVDQVLLDNTRARAVKALWQGAWHEFAARREIILCAGAVGSPGILQRSGIGPRQLL
                     ESLGIGVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRS
                     GPLAMAPSQLGVFVRSSPEQATANLQYHVQPLSLERFGEPLHQFPAFTASVCNLRPAS
                     RGRIDICSTDMNSTPLIDPNYLSAAQDLRVAADAIRLTRRIVQAPALAAFEPKEYLPG
                     PALQSEEELFEAAGKIGTTIFHPVGTCRMGNGAMDVVDNQLRVHGIPGLRVADASIMP
                     QITSGNTCSPTLMIAEKAAQLILKGAATQTYLNEDALPTP"
     gene            93922..95541
                     /locus_tag="PPUBIRD1_RS00415"
                     /old_locus_tag="PPUBIRD1_0086"
     CDS             93922..95541
                     /locus_tag="PPUBIRD1_RS00415"
                     /old_locus_tag="PPUBIRD1_0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016712787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014589209.1"
                     /db_xref="GI:504402107"
                     /translation="MSDYIQEQGAAASSSSRREERKIIFASSLGTVFEWYDFFLYGAL
                     AAVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVL
                     MGLSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPPGKRGL
                     HTGFIQSTATLGLLLSLLVVLGSRYVSGDQFETWGWRLPFLLSIVLLAISTWIRMSMH
                     ESPAFVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFM
                     TQMLKMDSAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFK
                     ALSYYANPQIDAASRQAPIVVTADPQGCTFQFDPVGKARFDSPCDKVKTFLVKQGLPY
                     SSVSVAGSEVVVNIGDKTINGFDETAMRAAIEQAGYPAKAEPAQVNQVMVVVLIVAMI
                     LIATMTYGPLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFY
                     GLWYPVLVTGISLVVGIFCLRETKDVDIDKV"
     gene            complement(95716..96501)
                     /locus_tag="PPUBIRD1_RS00420"
                     /old_locus_tag="PPUBIRD1_0087"
     CDS             complement(95716..96501)
                     /locus_tag="PPUBIRD1_RS00420"
                     /old_locus_tag="PPUBIRD1_0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol acyltransferase"
                     /protein_id="WP_019438060.1"
                     /db_xref="GI:518267852"
                     /translation="MVQATMSILQAIRIFLFYLLLGTSSLLWCSLSFFVAPFLSFPKR
                     YKFINVYWCRCALFLVRTILGIDYKITGAENVPAEPCVILSNHQSTWETFFLSQYFSP
                     LSQVLKRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPE
                     GTRVPFGTLGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPM
                     YANGTGPRAIAELNDRAAAWNEATQRAMGSLPPAAEKPQEQMA"
     gene            complement(96548..97075)
                     /locus_tag="PPUBIRD1_RS00425"
                     /old_locus_tag="PPUBIRD1_0088"
     CDS             complement(96548..97075)
                     /locus_tag="PPUBIRD1_RS00425"
                     /old_locus_tag="PPUBIRD1_0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019471030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D,D-heptose 1,7-bisphosphate phosphatase"
                     /protein_id="WP_014589211.1"
                     /db_xref="GI:504402109"
                     /translation="MKLLILDRDGVINYDSDAYIKTLEEWVPIPGSVDAIAQLSKAGW
                     TVAVATNQSGIARGYYPLATLDAMHARLRALVAEQGGEVGHIVYCPHGPDEGCDCRKP
                     KPGMLRAIAEHYQIGLEGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPET
                     TLIFDDLAAIARELI"
     gene            complement(97079..99133)
                     /locus_tag="PPUBIRD1_RS00430"
                     /old_locus_tag="PPUBIRD1_0089"
     CDS             complement(97079..99133)
                     /locus_tag="PPUBIRD1_RS00430"
                     /old_locus_tag="PPUBIRD1_0089"
                     /EC_number="6.1.1.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003260006.1"
                     /note="Glycyl-tRNA synthetase beta subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase"
                     /protein_id="WP_014589212.1"
                     /db_xref="GI:504402110"
                     /translation="MSAQDFLVELGTEELPPKALASLGDAFLAGIEKGLQAAGLNYTG
                     KQVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGVEL
                     AEIDQSGPKLRFSQHIPGKATVGLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWL
                     VMLLGDQVVDCTILSQKAGRESRGHRFHHPENVLITTPANYVEDLRKAYVLADFAERR
                     ELISKRTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTM
                     QDNQKYFCLLDNEGKLLPRFITVANVESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKK
                     QPLETFNERLKNVVFQAQLGTVYDKAERVSRLAAFIAPLIGGDAQRAGRAGLLSKCDL
                     ATEMVGEFPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQTLTGAAVAIA
                     DKLDTLVGIFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEFAVKQFGA
                     KVKAPGLAEQVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFR
                     KLPEAEALAAVNKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMA
                     AARQYSESLARLAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISL
                     LG"
     gene            complement(99130..100077)
                     /locus_tag="PPUBIRD1_RS00435"
                     /old_locus_tag="PPUBIRD1_0090"
     CDS             complement(99130..100077)
                     /locus_tag="PPUBIRD1_RS00435"
                     /old_locus_tag="PPUBIRD1_0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014754939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine--tRNA ligase alpha subunit"
                     /protein_id="WP_003253126.1"
                     /db_xref="GI:489345991"
                     /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHT
                     ATFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLG
                     SLKAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYP
                     VTGEITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANV
                     DKLFELFDFYESEANRLIKLELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRV
                     RTLARDVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
     gene            100161..100712
                     /locus_tag="PPUBIRD1_RS00440"
                     /old_locus_tag="PPUBIRD1_0091"
     CDS             100161..100712
                     /locus_tag="PPUBIRD1_RS00440"
                     /old_locus_tag="PPUBIRD1_0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003260004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_019438059.1"
                     /db_xref="GI:518267851"
                     /translation="MPRCFWCTDDPLYQAYHDQEWGMPQRDPALLFEMLLLEGFQAGL
                     SWITVLRKRERYRQVMYGFDPVKLAAMSDERIEELMQDAGIIRNRLKLKAARRNAQAW
                     LAVDNPAEWLWSFIGGSPKINHFKQRSDVPAVTDEAKAMSKALQKAGFTFVGPTICYA
                     FMQATGMVMDHTTDCDRYAALLR"
     gene            100754..101641
                     /locus_tag="PPUBIRD1_RS00445"
                     /old_locus_tag="PPUBIRD1_0092"
     CDS             100754..101641
                     /locus_tag="PPUBIRD1_RS00445"
                     /old_locus_tag="PPUBIRD1_0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269871.1"
                     /note="Acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(lauroyl)-lipid IVA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl acyltransferase"
                     /protein_id="WP_003253121.1"
                     /db_xref="GI:489345986"
                     /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKIPNSSRN
                     VVRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLE
                     VLEQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQM
                     GNRVAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNML
                     AGGKAVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQ
                     YMWSMKRFKKRPAGEPRWY"
     gene            complement(101740..102054)
                     /locus_tag="PPUBIRD1_RS00450"
                     /old_locus_tag="PPUBIRD1_0093"
     CDS             complement(101740..102054)
                     /locus_tag="PPUBIRD1_RS00450"
                     /old_locus_tag="PPUBIRD1_0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589214.1"
                     /db_xref="GI:504402112"
                     /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVE
                     QDPKYSAAWKLLGKAYQLQGDLAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKA
                     AG"
     gene            complement(102066..103439)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_RS00455"
                     /old_locus_tag="PPUBIRD1_0094"
                     /gene_synonym="sapG"
     CDS             complement(102066..103439)
                     /gene="trkA"
                     /locus_tag="PPUBIRD1_RS00455"
                     /old_locus_tag="PPUBIRD1_0094"
                     /gene_synonym="sapG"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016489939.1"
                     /note="involved in potassium uptake; found to be
                     peripherally associated with the inner membrane in
                     Escherichia coli; contains an NAD-binding domain; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter peripheral membrane
                     protein"
                     /protein_id="WP_010951472.1"
                     /db_xref="GI:499253932"
                     /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLD
                     IRTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRES
                     SYLTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAY
                     YGGPLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIR
                     AVMGELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMSPARCRHLSDTLEST
                     VVLQGSASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAY
                     VDLVQGGDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSK
                     VVGKAIEDITLPPGTTIGAIIRDEEVMIAHDDTMIESGDHVILFVVDKKHIRDVEKLF
                     HVGLSFF"
     gene            complement(103463..104773)
                     /locus_tag="PPUBIRD1_RS00460"
                     /old_locus_tag="PPUBIRD1_0095"
     CDS             complement(103463..104773)
                     /locus_tag="PPUBIRD1_RS00460"
                     /old_locus_tag="PPUBIRD1_0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RR3.1"
                     /note="Ribosomal RNA small subunit methyltransferase B;
                     catalyzes the methylation of cytosine at position 967
                     (m5C967) of 16S rRNA; SAM-dependent methyltransferase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_014589215.1"
                     /db_xref="GI:504402113"
                     /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLA
                     FGTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCA
                     DKLKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKALKAFWPEQWEA
                     ICAANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLP
                     GFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAHVVAIDL
                     EAKRLTRVRENLDRLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPD
                     IKLTRQADDIPALATLQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIKAFLARTP
                     GARELDLATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
     gene            complement(104770..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_RS00465"
                     /old_locus_tag="PPUBIRD1_0096"
     CDS             complement(104770..105702)
                     /gene="fmt"
                     /locus_tag="PPUBIRD1_RS00465"
                     /old_locus_tag="PPUBIRD1_0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RR2.1"
                     /note="Methionyl-tRNA formyltransferase; modifies the free
                     amino group of the aminoacyl moiety of
                     methionyl-tRNA(fMet) which is important in translation
                     initiation; inactivation of this gene in Escherichia coli
                     severely impairs growth; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_014589216.1"
                     /db_xref="GI:504402114"
                     /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLM
                     PSAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPSLG
                     CINSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISADDT
                     GGTLHDRLAKMGPPAVVRAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTRPAV
                     ELERLIRAFNPWPVCHSTLDGESVKVLAANLSTGQGAPGEILSASKDGLVVACGDQAL
                     SLTRLQLPGGKALSFSDLFNSRREKFAAGKVLGQ"
     gene            complement(105763..106269)
                     /locus_tag="PPUBIRD1_RS00470"
                     /old_locus_tag="PPUBIRD1_0097"
     CDS             complement(105763..106269)
                     /locus_tag="PPUBIRD1_RS00470"
                     /old_locus_tag="PPUBIRD1_0097"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009682343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Peptide deformylase 1"
                     /protein_id="WP_003253111.1"
                     /db_xref="GI:489345976"
                     /translation="MAILNILEFPDPRLRTLAKPVTEFDDALRQLIDDMFETMYEAPG
                     IGLAATQVNVHKQVVVMDLSEDRSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENV
                     DRPLRVRVKAQDRDGKPFELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKL
                     EKQHRQQA"
     gene            106476..107573
                     /locus_tag="PPUBIRD1_RS00475"
                     /old_locus_tag="PPUBIRD1_0098"
     CDS             106476..107573
                     /locus_tag="PPUBIRD1_RS00475"
                     /old_locus_tag="PPUBIRD1_0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253109.1"
                     /note="DNA protecting protein DprA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="WP_014589217.1"
                     /db_xref="GI:504402115"
                     /translation="MPSHHSSPCPPAELEARLRLHRLPEAGLRRFRTLLEAFGSASSA
                     LSAPASAWRALGIPQATIDARRSAEVRDGALAAMAWLERPGQHLLMWDGPGYPALLAE
                     IDDAPPLLFVAGEPALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAV
                     GVDGAAHRAALQAGGGTIAVLGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPLDAGPL
                     PGNFPRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGC
                     HQLIRDGALLVETVEQILESLQGWQNLPPAVMDRFDHPLLALLHAAPQTSESLAHCSE
                     QPLADVLAQLTELELEGRVSNEAGRWFARAG"
     gene            107616..108173
                     /locus_tag="PPUBIRD1_RS00480"
                     /old_locus_tag="PPUBIRD1_0099"
     CDS             107616..108173
                     /locus_tag="PPUBIRD1_RS00480"
                     /old_locus_tag="PPUBIRD1_0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RQ9.1"
                     /note="Putative ribosome maturation factor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonylcarbamoyl-AMP synthase"
                     /protein_id="WP_014589218.1"
                     /db_xref="GI:504402116"
                     /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLL
                     ALKSRPVDKGLILVADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWV
                     TGQHDTVALRVSDHPVVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVL
                     GGALGGRKNPSVIRDLATGEVVRPG"
     gene            108621..108938
                     /locus_tag="PPUBIRD1_RS00485"
                     /old_locus_tag="PPUBIRD1_0100"
     CDS             108621..108938
                     /locus_tag="PPUBIRD1_RS00485"
                     /old_locus_tag="PPUBIRD1_0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589219.1"
                     /db_xref="GI:504402117"
                     /translation="MMKKIVPDPPLQCTSTRPFGRCDAGHDPLFTVNPNISAEDALVH
                     VALYLRSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPPTNRP
                     SQA"
     gene            complement(109066..110043)
                     /locus_tag="PPUBIRD1_RS00490"
                     /old_locus_tag="PPUBIRD1_0101"
     CDS             complement(109066..110043)
                     /locus_tag="PPUBIRD1_RS00490"
                     /old_locus_tag="PPUBIRD1_0101"
                     /EC_number="1.6.5.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="WP_014589220.1"
                     /db_xref="GI:504402118"
                     /translation="MAKRIQFSQHGGPEVLQFVEFEPTPPGPQQVRVRNHAIGLNFID
                     TYFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVSRLKVGDRVAHAGGPLGAYSEVHTLP
                     EANLVKLPDTISFEQAAAVMLKGLTVQYLLKQTYEVKAGDVILFHAAAGGVGSLACQW
                     AKALGAKLIGTVSSAEKAERAKALGAWATIDYSREDVVKRVLELTDGKKCPVVYDGVG
                     ADTWLTSLDCLRPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENT
                     QAMADDLFAMIASGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
     gene            110178..111089
                     /locus_tag="PPUBIRD1_RS00495"
                     /old_locus_tag="PPUBIRD1_0102"
     CDS             110178..111089
                     /locus_tag="PPUBIRD1_RS00495"
                     /old_locus_tag="PPUBIRD1_0102"
                     /EC_number="1.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5VWK4.1"
                     /note="Coproporphyrinogen-III oxidase, aerobic; catalyzes
                     the conversion of the propionic acid groups of rings I and
                     III to vinyl groups during heme synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen III oxidase"
                     /protein_id="WP_014589221.1"
                     /db_xref="GI:504402119"
                     /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGG
                     GRTRVIGEGKVIEKGGVNFSHVFGSGLPPSASAHRPELAGRGFEALGVSLVIHPHNPH
                     VPTSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCIHWHRVAEQACAPFGADV
                     YPRYKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAFVDAYLPIV
                     QRRKNTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWG
                     YDWKAEPGSEEARLTEYFLQDRDWLGQ"
     gene            111114..111938
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_RS00500"
                     /old_locus_tag="PPUBIRD1_0103"
     CDS             111114..111938
                     /gene="aroE"
                     /locus_tag="PPUBIRD1_RS00500"
                     /old_locus_tag="PPUBIRD1_0103"
                     /EC_number="1.1.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253098.1"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="WP_014589222.1"
                     /db_xref="GI:504402120"
                     /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFS
                     DCARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDG
                     AGLVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVVANRTVEKAEQLA
                     REFDELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGK
                     EPTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
     gene            complement(111977..113542)
                     /locus_tag="PPUBIRD1_RS00505"
                     /old_locus_tag="PPUBIRD1_0104"
     CDS             complement(111977..113542)
                     /locus_tag="PPUBIRD1_RS00505"
                     /old_locus_tag="PPUBIRD1_0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_014589223.1"
                     /db_xref="GI:504402121"
                     /translation="MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYA
                     LIAGLPAEYGLYAAIVPVLIACLWGSSWYLICGPTAAISIVLYASISPLAVAGSADYI
                     TLVLLLTFLGGIFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMAL
                     PSQSTALKTVQDLASHAGEVDLPSLLLGLATVVIGVAFKLWRPRWPSLLISLILVSLL
                     AWLLPGFFGHVPRVAAFTGQLPPFSPLPLLDVELMLHLLPSAVAVGMLGLVTSLSIAR
                     SLSARSEQLINPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFS
                     ALWVALFAVSGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTT
                     AATLLLELQTAIYAGVLASLFFYLKRTSRPRIQQSREGDADVLRVGGSIFFGAAHYLQ
                     VRLQRCQGPHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQK
                     LEGVELCPIRFEE"
     gene            complement(113687..114610)
                     /locus_tag="PPUBIRD1_RS00510"
                     /old_locus_tag="PPUBIRD1_0105"
     CDS             complement(113687..114610)
                     /locus_tag="PPUBIRD1_RS00510"
                     /old_locus_tag="PPUBIRD1_0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589224.1"
                     /db_xref="GI:504402122"
                     /translation="MHKFSAAVFVLALSTTTAHAADSDAQCSTVKMADPGWSDIASTN
                     AVARLLLESLGYQVKIDSLAVPIIYGGLKDGQVDAFLGNWMPAHQGFHDKFIANGDVQ
                     QLSRNLEGTEFTLAVPDYVWNAGVKDFADLQKHAGQFDKKLYGIGSGAPANLSLKAII
                     DKNEFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEK
                     WFGSKGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENSIMAEVVDKKISFDEAAKAW
                     VKAHPERLDGWLAGVTTKADGDALEAVKAKL"
     gene            complement(114625..116142)
                     /locus_tag="PPUBIRD1_RS00515"
                     /old_locus_tag="PPUBIRD1_0106"
     CDS             complement(114625..116142)
                     /locus_tag="PPUBIRD1_RS00515"
                     /old_locus_tag="PPUBIRD1_0106"
                     /EC_number="3.1.6.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017147851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="choline-sulfatase"
                     /protein_id="WP_014589225.1"
                     /db_xref="GI:504402123"
                     /translation="MTRPNILFIMADQMAAPLLPIYGPSPIKMPHLGRLAEQAVVFDS
                     AYCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMH
                     FCGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLD
                     FDEEVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIAKRYWDRYEGVDIPMPRA
                     EFGQAALDPHSQRLLKVYDLWNKPLPVDKVRDARRAYFGACSYIDDNIGQLLQTLEEC
                     NLADDTLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLIHAPKRFAAGRVTASVSTC
                     DLLPTLVELAGGAVDKDLQLDGRSLLGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGP
                     YKFVYSEDDPCLLYDLSRDPHERENLTDSPDHQVLLQTFVDEAQQRWDIPSLRQQVLA
                     SQRRRRLVAEALAIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
     gene            116251..117150
                     /locus_tag="PPUBIRD1_RS00520"
                     /old_locus_tag="PPUBIRD1_0107"
     CDS             116251..117150
                     /locus_tag="PPUBIRD1_RS00520"
                     /old_locus_tag="PPUBIRD1_0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014859482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589226.1"
                     /db_xref="GI:504402124"
                     /translation="MFEHLAGLSLDTLRVFEAAARLRGFTAAALELGTTQPAVSQQVK
                     RLEAQLGTRLFDRIYRGIELTEAGQVLFEQVHQGLQAMDDGIAQSGGRGQREVLQVAT
                     DFAFAAFWLMPRLQRFHEAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESR
                     WLFDEEVFPVCSPHLIHGKALSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVDSPP
                     PAGQLRFDNYTLLIQAAIAGQGVAIGWAHLVDGLVEQGLLCRPLEGSLRSERGYYAVL
                     PPRKRRGALIERFVDWLEQERSL"
     gene            complement(117262..117879)
                     /locus_tag="PPUBIRD1_RS00525"
                     /old_locus_tag="PPUBIRD1_0108"
     CDS             complement(117262..117879)
                     /locus_tag="PPUBIRD1_RS00525"
                     /old_locus_tag="PPUBIRD1_0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-flavin reductase"
                     /protein_id="WP_014589227.1"
                     /db_xref="GI:504402125"
                     /translation="MKNAETPVFKLVLFGPESSLGNALMVELLSRQHEVTAVVDDLNR
                     HSPRPGLHFKIGGLGDAHQAEQGAAGGSAVIALLPALAPGDLPGQARLSEALVAGLAR
                     TTIRRLLLVGDFDVLDEPGKYSEVERECVAQVVDGLQRSALHWTLINAPQELAGLSME
                     HFRSTEGTLEPGLAEPLRRLARIAAGMVDMLELDLHRGEHLNFVV"
     gene            117932..118264
                     /locus_tag="PPUBIRD1_RS00530"
                     /old_locus_tag="PPUBIRD1_0109"
     CDS             117932..118264
                     /locus_tag="PPUBIRD1_RS00530"
                     /old_locus_tag="PPUBIRD1_0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DOPA 4,5-dioxygenase"
                     /protein_id="WP_014589228.1"
                     /db_xref="GI:504402126"
                     /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPV
                     GPHPDWSCQLAFGPEVVGVVLPWLALYRKGLVVFMHPETGDELADHRDHAIWMGAVRP
                     LNLAVFGG"
     gene            complement(118382..119191)
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_RS00535"
                     /old_locus_tag="PPUBIRD1_0110"
     CDS             complement(118382..119191)
                     /gene="trpA"
                     /locus_tag="PPUBIRD1_RS00535"
                     /old_locus_tag="PPUBIRD1_0110"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484236.1"
                     /note="Tryptophan synthase alpha chain; catalyzes the
                     formation of indole and glyceraldehyde 3-phosphate from
                     indoleglycerol phosphate in tryptophan biosynthesis;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit alpha"
                     /protein_id="WP_014589229.1"
                     /db_xref="GI:504402127"
                     /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAG
                     ADVIELGMPFTDPMADGVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGY
                     YNPIHRFGVDTFVAQAKEAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDD
                     ARLPRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPE
                     QAANIARLADGVVVGSALVDKIAQAKSADQAVSDVLSLCSALAEGVRGARR"
     gene            complement(119188..120405)
                     /locus_tag="PPUBIRD1_RS00540"
                     /old_locus_tag="PPUBIRD1_0111"
     CDS             complement(119188..120405)
                     /locus_tag="PPUBIRD1_RS00540"
                     /old_locus_tag="PPUBIRD1_0111"
                     /EC_number="4.2.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5VWL3.1"
                     /note="catalyzes the formation of L-tryptophan from
                     L-serine and 1-(indol-3-yl)glycerol 3-phosphate; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase beta chain"
                     /protein_id="WP_004575268.1"
                     /db_xref="GI:490712427"
                     /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKA
                     DPKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQ
                     VLLAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLL
                     GAEIVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGK
                     ETRAQLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHA
                     ASLNGGVPGVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVS
                     ITDDEALDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQ
                     TVMNHMAAQEKHA"
     gene            120516..121412
                     /locus_tag="PPUBIRD1_RS00545"
                     /old_locus_tag="PPUBIRD1_0112"
     CDS             120516..121412
                     /locus_tag="PPUBIRD1_RS00545"
                     /old_locus_tag="PPUBIRD1_0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589230.1"
                     /db_xref="GI:504402128"
                     /translation="MAHDLPPLNALRAFEAAARLNSVSQAAEALHVTHGAVSRQIKVL
                     EEHLGVALFVKDGRGIKLTDAGMRLRDASGEAFDRLRSVCSELSRDVSEAPFVLGCSG
                     SLLARWFIPRLGRLQADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHV
                     LAEECIGPVLSPHFAGFQRLQGAPAKALLGEALLHTTSRPQAWPTWAVQQGLDPAAIH
                     YGQAFEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTQAALALWVPRR
                     AADGRAEQLAQWLRAELARQSA"
     gene            complement(121409..121732)
                     /locus_tag="PPUBIRD1_RS00550"
                     /old_locus_tag="PPUBIRD1_0113"
     CDS             complement(121409..121732)
                     /locus_tag="PPUBIRD1_RS00550"
                     /old_locus_tag="PPUBIRD1_0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004575266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589231.1"
                     /db_xref="GI:504402129"
                     /translation="MHRNSLRKTSLESMEAEIESLLKSLENLKHDASEESQKSVKAIR
                     SNAESALRHSRSLLSDAYEEVKQRTRQTGKATRDYAQEHPYTTAGVAIGALGLLAAYL
                     ICKRN"
     gene            121883..122098
                     /locus_tag="PPUBIRD1_RS00555"
                     /old_locus_tag="PPUBIRD1_0114"
     CDS             121883..122098
                     /locus_tag="PPUBIRD1_RS00555"
                     /old_locus_tag="PPUBIRD1_0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011531496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253076.1"
                     /db_xref="GI:489345940"
                     /translation="MTDHHTYKKIELVGSSPTSIEEAINNALAEAGKSIKHLEWFEVV
                     DTRGHIRDNKAAHFQVTLKVGFRIANS"
     gene            122199..122420
                     /locus_tag="PPUBIRD1_RS00560"
                     /old_locus_tag="PPUBIRD1_0115"
     CDS             122199..122420
                     /locus_tag="PPUBIRD1_RS00560"
                     /old_locus_tag="PPUBIRD1_0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253075.1"
                     /db_xref="GI:489345939"
                     /translation="MNKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYK
                     LEIVKKGDPAGKVIGSCEAGTKEIVYRRG"
     gene            complement(122493..123497)
                     /locus_tag="PPUBIRD1_RS00565"
                     /old_locus_tag="PPUBIRD1_0116"
     CDS             complement(122493..123497)
                     /locus_tag="PPUBIRD1_RS00565"
                     /old_locus_tag="PPUBIRD1_0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589232.1"
                     /db_xref="GI:504402130"
                     /translation="MTQLRDLKISTLDLVPVRADAGPAQSLRNSLDLAQHVERFGYNR
                     FWVAEHHNMDGIASSATSVLIGYLAGGTSRIRVGSGGVMLPNHAPLVIAEQFGTLASL
                     YPGRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVP
                     GYDTDVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRYMHEAIRVYRNHFKPSTTLDK
                     PYVMLGIPMVVAQTDEKAEYLATSVYQRILALIRGQSLMQKPPVESMEGLWLPHERET
                     VGSFLGLAMIGSPQKVKAKVEVLLEQTGADELIFTCDLYEHADRIRSYELMAQALKTE
                     "
     gene            123650..124075
                     /locus_tag="PPUBIRD1_RS00570"
                     /old_locus_tag="PPUBIRD1_0117"
     CDS             123650..124075
                     /locus_tag="PPUBIRD1_RS00570"
                     /old_locus_tag="PPUBIRD1_0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_003253070.1"
                     /db_xref="GI:489345934"
                     /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGT
                     NPEELIGAAHAGCFSMALSMMLGEAGLTAERIDTAAEVTLDKQADGFAITAVHLVLRA
                     KVPGASEAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
     gene            124151..124384
                     /locus_tag="PPUBIRD1_RS00575"
                     /old_locus_tag="PPUBIRD1_0118"
     CDS             124151..124384
                     /locus_tag="PPUBIRD1_RS00575"
                     /old_locus_tag="PPUBIRD1_0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253067.1"
                     /db_xref="GI:489345931"
                     /translation="MIRVAIAVLASLVATSALAAVKPCEELKTEIEAKIQAQGVSSYT
                     LEIVPNSEVKDQNMVVGTCDGGTKKIIYQKNDR"
     gene            complement(124420..124833)
                     /locus_tag="PPUBIRD1_RS00580"
                     /old_locus_tag="PPUBIRD1_0119"
     CDS             complement(124420..124833)
                     /locus_tag="PPUBIRD1_RS00580"
                     /old_locus_tag="PPUBIRD1_0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_010951495.1"
                     /db_xref="GI:499253955"
                     /translation="MRQPMMLIALSTLGACASPLPPVDPKQAWVDLYTMTPGRVIMAD
                     RLDGKRLDDGRYFQVTPGKHELVVRFDYEIYSGGLMSQPRDRTCYLTVRFDNFKAGER
                     YRLEARAPVMEPQVLLYDANRKVVVNEPSEVFCIP"
     gene            complement(124889..125302)
                     /locus_tag="PPUBIRD1_RS00585"
                     /old_locus_tag="PPUBIRD1_0120"
     CDS             complement(124889..125302)
                     /locus_tag="PPUBIRD1_RS00585"
                     /old_locus_tag="PPUBIRD1_0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589233.1"
                     /db_xref="GI:504402131"
                     /translation="MRALLVAGSLLLISACSTLPDPDPNQAWIDLTRYDNTSLDAVQV
                     DERDWGDSRYFEVQPGSHELTVRYQFPVNPSNIGPVEEPLWRDCQVKLTFKDFSAGQR
                     YQLQAGSIGFRPWIKLYDHQQKLLGQGLPAGCQRT"
     gene            125388..126461
                     /locus_tag="PPUBIRD1_RS00590"
                     /old_locus_tag="PPUBIRD1_0121"
     CDS             125388..126461
                     /locus_tag="PPUBIRD1_RS00590"
                     /old_locus_tag="PPUBIRD1_0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_014589234.1"
                     /db_xref="GI:504402132"
                     /translation="MQRSGLGALDRIFTRLVPLVAALLLNGCSNVAYYGQLAQGQWQL
                     LRARQPVEQVLADPATPAPLRAHLQQAEQARAFASQQLKLPDNRSYRVYADLGRRYVV
                     WNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVEAYS
                     TLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYMQDDTEFNESFASFVEQEGTRQW
                     RAARGLAAVGGDQGKQRDQFIRLVLASRERLQAIYAGPLDDAHKRRAKQAEFERLRRE
                     YRQVRDGQWGGDKRYDAWMYGPMNNAKLLPFGLYDQWVPAFAALFREVGGDWVRFYER
                     VAHLGRLPIEERKAALQRLMVSL"
     gene            complement(126571..127221)
                     /locus_tag="PPUBIRD1_RS00595"
                     /old_locus_tag="PPUBIRD1_0122"
     CDS             complement(126571..127221)
                     /locus_tag="PPUBIRD1_RS00595"
                     /old_locus_tag="PPUBIRD1_0122"
                     /EC_number="3.1.3.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004575264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleotidase"
                     /protein_id="WP_014589235.1"
                     /db_xref="GI:504402133"
                     /translation="MHQQNILFDLDGTLTDPRLGITRSIQYALAKLGIDEPDLARLEH
                     FIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYENLVFEGVPELLEALNGQGR
                     TLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTNKVELIRHLLDEEGLDPAQ
                     TLMIGDRKHDLIGARSNGLQAVAVGYGFGSREELMAEEPAFHFATVADLHQAFSKA"
     gene            complement(127343..127891)
                     /locus_tag="PPUBIRD1_RS00600"
                     /old_locus_tag="PPUBIRD1_0123"
     CDS             complement(127343..127891)
                     /locus_tag="PPUBIRD1_RS00600"
                     /old_locus_tag="PPUBIRD1_0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydrase"
                     /protein_id="WP_014589236.1"
                     /db_xref="GI:504402134"
                     /translation="MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVR
                     GDMHRIRIGARTSVQDGSVLHITHAGPFNTDGFPLIIGDEVTIGHKVMLHGCTLGNRI
                     LVGMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFS
                     YSAGNYVKLKDQHLAEGYDQPE"
     gene            127958..130045
                     /locus_tag="PPUBIRD1_RS00605"
                     /old_locus_tag="PPUBIRD1_0124"
     CDS             127958..130045
                     /locus_tag="PPUBIRD1_RS00605"
                     /old_locus_tag="PPUBIRD1_0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptidase A"
                     /protein_id="WP_019436839.1"
                     /db_xref="GI:518266631"
                     /translation="MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAIL
                     ADNRKAIAEILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYE
                     SCLPALSAYSTELGQNRALFEAYQALIDSPEAAGFDVAQKTILEHALRDFRLSGIDLP
                     ADKQQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQ
                     AKGLDGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMRE
                     ILDLRQELAELLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAY
                     AAEQGCPELASWDAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEI
                     AELKGFDSWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQL
                     QSPVANLVCNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAW
                     DAVELPSQFMENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLE
                     FSLFDFELHASHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYS
                     YKWAEVLSADAFSRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDA
                     LLRHSGLTEDAAA"
     gene            130042..130323
                     /locus_tag="PPUBIRD1_RS00610"
                     /old_locus_tag="PPUBIRD1_0125"
     CDS             130042..130323
                     /locus_tag="PPUBIRD1_RS00610"
                     /old_locus_tag="PPUBIRD1_0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_010951500.1"
                     /db_xref="GI:499253960"
                     /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNEDGVPHRECVAC
                     GFTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAE"
     gene            130447..132441
                     /locus_tag="PPUBIRD1_RS00615"
                     /old_locus_tag="PPUBIRD1_0126"
     CDS             130447..132441
                     /locus_tag="PPUBIRD1_RS00615"
                     /old_locus_tag="PPUBIRD1_0126"
                     /EC_number="3.4.24.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M3"
                     /protein_id="WP_014589238.1"
                     /db_xref="GI:504402136"
                     /translation="MDNPLLQNSHIPVDYSSITLENMQAAFDHVLLAHEKGVERIILD
                     QRAMPTWDDMVLAVDELDSRLLAVLYGASPLVGRDMDWANAITDVYGRATARFEQKFA
                     NSGLHDLYERLAKSDIGKQLDAGKRATLRWHLDKFVASGALLDTAGKARLADLQAQIG
                     TARKAFRSNIYRPGLSITDEAELSGIPQRVRDELAARAKEAGKQGWLIACDTVTTSEV
                     LKHADSRQLRERVYRAFHARGVSHDPQQDNRSHLQRLAQLLEEKALLLGFPSHLEQSL
                     QVKSAGSVAHVCGFLHDLADHVRPAMLQWRSQVEGRAAEQGLGKPQPWDFEYLQRASR
                     SEFPTAALRDYFPLNTVVSALQQLAQKLFGVVLQPKALAAWDDSVQPFEVWQDSAFIG
                     FLYLDAVQHAGKQPDAVFTTYVRNRRVDAEGIYHAASVVVFSDVPQAPPGFQPLLDHL
                     SLRKLFHEFGHALHHLLVRTTNHVMSNVTELGTDGVELFGKLFERWVWDADYLVAISA
                     HARDGSQLTRKQADKCLQQLRQRGVEEIARHLSLALFDMDLHATPNDGRSFEQRLGNA
                     RERCGYWPLADFEHPAHAFDHLVDGYDAGYYAYLWSDVHAFDLFTRFEAEGLLNRATG
                     RALQEALFAPGASRPLREGIEAFLGRQSNQAAYLRWHGLK"
     gene            132512..133570
                     /locus_tag="PPUBIRD1_RS00620"
                     /old_locus_tag="PPUBIRD1_0127"
     CDS             132512..133570
                     /locus_tag="PPUBIRD1_RS00620"
                     /old_locus_tag="PPUBIRD1_0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_014589239.1"
                     /db_xref="GI:504402137"
                     /translation="MIPPAPQKGRGTAHNPHNRFASGRSVAEDDGWYQEVPQTQGTEV
                     RIETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLI
                     AKTNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTI
                     VTKGSLVLRDLDLLAEMARQRLARVMISLTTLDDDLKRVLEPRAASPGARLRAIRVLR
                     EAGVPVGVLCSPMIPMINDSELERLLEAAKEAGAQSAAYMMLRLPLEVAPLFEQWLQD
                     HYPQRAAHVLSLIRQSRGGELYDSRFGVRMRGEGVFAELLAQRFARAMKRLDFEGRDA
                     QALDCSAFCPPGGQMALF"
     gene            133874..134593
                     /locus_tag="PPUBIRD1_RS00625"
                     /old_locus_tag="PPUBIRD1_0128"
     CDS             133874..134593
                     /locus_tag="PPUBIRD1_RS00625"
                     /old_locus_tag="PPUBIRD1_0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonate dehydratase"
                     /protein_id="WP_003253046.1"
                     /db_xref="GI:489345910"
                     /translation="MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELF
                     KKLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAI
                     EYAVMALKVHHIIICGHSDCGAMRAVLNPQSLTKMPTVGAWLRHAEVARTVVENNCSC
                     GSEHETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAAS
                     DSFLPLAAGEPVPCATPRGRY"
     gene            134786..136318
                     /locus_tag="PPUBIRD1_RS00630"
                     /old_locus_tag="PPUBIRD1_0129"
     CDS             134786..136318
                     /locus_tag="PPUBIRD1_RS00630"
                     /old_locus_tag="PPUBIRD1_0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate transporter"
                     /protein_id="WP_014589240.1"
                     /db_xref="GI:504402138"
                     /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLI
                     TGIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGR
                     LRLGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLEFPATLSAAL
                     PQESTGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVN
                     RVQVPADLSEAIDWLSPADLMQLADPALLVAAFALAFIASAETLLSAAAVDRMHSGQR
                     SDFDRELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVV
                     ALSSVLQQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLL
                     TGVLLGFALTLLKLAFKAARLKINLVSLDKDGHMELRLSGAATFLKVPALTQVLDTVP
                     PGTTLHVPLGNLSYIDHSCLELLEDWSRSNSANGSRLLIEQRRLKRRIEGRLRTTAGV
                     GA"
     gene            complement(136466..137107)
                     /locus_tag="PPUBIRD1_RS00635"
                     /old_locus_tag="PPUBIRD1_0130"
     CDS             complement(136466..137107)
                     /locus_tag="PPUBIRD1_RS00635"
                     /old_locus_tag="PPUBIRD1_0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003253042.1"
                     /db_xref="GI:489345906"
                     /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQD
                     AQGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHV
                     GLDCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEV
                     VHHSVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
     gene            137477..138604
                     /locus_tag="PPUBIRD1_RS00640"
                     /old_locus_tag="PPUBIRD1_0131"
     CDS             137477..138604
                     /locus_tag="PPUBIRD1_RS00640"
                     /old_locus_tag="PPUBIRD1_0131"
                     /EC_number="1.9.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253039.1"
                     /note="cytochrome c oxidase, subunit II; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B559 subunit alpha"
                     /protein_id="WP_014589241.1"
                     /db_xref="GI:504402139"
                     /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHM
                     TIFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVVMAI
                     PATKTLIDIYDASESDIDVQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDE
                     HYLLEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWARIEKPG
                     IYRGQCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVE
                     RGDKVYHTACVACHQAEGQGLPPMFPALKGSKIATGPKEDHLSIVFHGKPGTAMAAFG
                     KQLSEVDIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
     gene            138648..140237
                     /locus_tag="PPUBIRD1_RS00645"
                     /old_locus_tag="PPUBIRD1_0132"
     CDS             138648..140237
                     /locus_tag="PPUBIRD1_RS00645"
                     /old_locus_tag="PPUBIRD1_0132"
                     /EC_number="1.9.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497403.1"
                     /note="cytochrome c oxidase, subunit I; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome oxidase subunit I"
                     /protein_id="WP_014589242.1"
                     /db_xref="GI:504402140"
                     /translation="MSAVIDDHAHGHDHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFI
                     MFLLGGSFAMVIRAELFQPGLQIVEPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIP
                     LMVGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASV
                     TFFIFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPV
                     LAGVVTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIP
                     AFSRKPLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGV
                     KVFNWVSTMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAH
                     FHYVLVPGAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFVGMNMAFFPMHFVGLA
                     GMPRRIPDYNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEG
                     LEWSIPSPAPYHTFQTPPEVK"
     gene            140247..140813
                     /locus_tag="PPUBIRD1_RS00650"
                     /old_locus_tag="PPUBIRD1_0133"
     CDS             140247..140813
                     /locus_tag="PPUBIRD1_RS00650"
                     /old_locus_tag="PPUBIRD1_0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589243.1"
                     /note="cytochrome C oxidase assembly protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_014589243.1"
                     /db_xref="GI:504402141"
                     /translation="MNGLSVKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKT
                     GGQYEGSQISDPTRAVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFIAHNPTD
                     RPMSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHL
                     TLAYTLFDITARHPPVAHVAAQDVQGAR"
     gene            140830..141717
                     /locus_tag="PPUBIRD1_RS00655"
                     /old_locus_tag="PPUBIRD1_0134"
     CDS             140830..141717
                     /locus_tag="PPUBIRD1_RS00655"
                     /old_locus_tag="PPUBIRD1_0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_011953141.1"
                     /db_xref="GI:500573427"
                     /translation="MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDS
                     HGPLIFFVGALFLAYMLFGWFGAVVKESHAGLYSPQLDRSFRWGMSWFIFSEVMFFLA
                     FFGALFYVRVLAGPWLGGEGAKGVTHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWH
                     LPLINTILLVSSSVTITIAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYT
                     KLGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASW
                     YWHFVDVVWVGLFIFVYVL"
     gene            complement(141750..141953)
                     /locus_tag="PPUBIRD1_RS00660"
     CDS             complement(141750..141953)
                     /locus_tag="PPUBIRD1_RS00660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_020191169.1"
                     /db_xref="GI:519035294"
                     /translation="MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTIRVTL
                     AALTIGLVAWGLISGQLVSHAPF"
     gene            142005..142742
                     /locus_tag="PPUBIRD1_RS00665"
                     /old_locus_tag="PPUBIRD1_0135"
     CDS             142005..142742
                     /locus_tag="PPUBIRD1_RS00665"
                     /old_locus_tag="PPUBIRD1_0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589244.1"
                     /db_xref="GI:504402142"
                     /translation="MRPFRPGWVPTLAVLALLPGLIALGCWQLGRAEEKRVLLATYAE
                     RRIEAPIATAQLLSKEDNAFRRVHLYGRFDAEHSVLLDNRMRDGKPGVELLQPFHDQA
                     SGLWLLINRGWLPWLDRRVPVHFETPAQALALDASVYVAPGSTFQLHPDPIGGQWPHL
                     LTAIDAALLWQQLDREGFAQELRLEPGPASYRLDWPVVAMSPEKHVGYAVQWFALATA
                     LVLLYLYFGWHQNKEKRHGHRHSTGRA"
     gene            142711..143292
                     /locus_tag="PPUBIRD1_RS00670"
                     /old_locus_tag="PPUBIRD1_0136"
     CDS             142711..143292
                     /locus_tag="PPUBIRD1_RS00670"
                     /old_locus_tag="PPUBIRD1_0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589245.1"
                     /db_xref="GI:504402143"
                     /translation="MATATPLDVPERSKPRARGRLQLLLILLVVLGPMVLATSMYKLK
                     FWVPEGRSYHGAMIGNGESRADLGVAGQGERWQLLVSAPQACTEDCQRLVYLARQIQI
                     GLGRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVVEPGPQLWIV
                     DPHGNLVLRYDGKVNGKHVLDDLRHLLKLSNIG"
     gene            143302..144381
                     /locus_tag="PPUBIRD1_RS00675"
                     /old_locus_tag="PPUBIRD1_0137"
     CDS             143302..144381
                     /locus_tag="PPUBIRD1_RS00675"
                     /old_locus_tag="PPUBIRD1_0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004575260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B561"
                     /protein_id="WP_014589246.1"
                     /db_xref="GI:504402144"
                     /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGF
                     ISVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARD
                     GQPYRLPMLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRA
                     FAPLPKLPLSLRRIAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGRWWPAADFS
                     NGFHLTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLAR
                     LVLLALALQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDKVQVGVG
                     HGWRLRPVVGVGISHHMRNDSWRRF"
     gene            144366..145259
                     /locus_tag="PPUBIRD1_RS00680"
                     /old_locus_tag="PPUBIRD1_0138"
     CDS             144366..145259
                     /locus_tag="PPUBIRD1_RS00680"
                     /old_locus_tag="PPUBIRD1_0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016712834.1"
                     /note="converts protoheme IX and farnesyl diphosphate to
                     heme O; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protoheme IX farnesyltransferase"
                     /protein_id="WP_014589247.1"
                     /db_xref="GI:504402145"
                     /translation="MATLLSVRRARWRDYLELTKPKVVVLMLITSLAGMFLATRAGVS
                     WSVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALAL
                     ALLGMVLLLVFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGW
                     VAVSGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHI
                     LLYTLILLAVSLLPYAIHMSGPLYLACALGLGLRFLRWAWVLYRSSRPHAAIGTFKYS
                     IGYLFALFIALLLDHYLLLSL"
     gene            145256..145888
                     /locus_tag="PPUBIRD1_RS00685"
                     /old_locus_tag="PPUBIRD1_0139"
     CDS             145256..145888
                     /locus_tag="PPUBIRD1_RS00685"
                     /old_locus_tag="PPUBIRD1_0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009683600.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-binding protein"
                     /protein_id="WP_003253019.1"
                     /db_xref="GI:489345883"
                     /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGII
                     LLPQSRAVADVTMTNQDGQPVQMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSEL
                     PKDAVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFI
                     PADTSKPGYTVDHSGNLAIVGPDGRQRGFIRAPFNNQKLGAQLPGLVKRD"
     gene            complement(145982..146752)
                     /locus_tag="PPUBIRD1_RS00690"
                     /old_locus_tag="PPUBIRD1_0140"
     CDS             complement(145982..146752)
                     /locus_tag="PPUBIRD1_RS00690"
                     /old_locus_tag="PPUBIRD1_0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589248.1"
                     /db_xref="GI:504402146"
                     /translation="MKKLLAVAAAVAAFSAQADTLTVAATPVPHAEILNFVKPQLAKE
                     GVELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTQLVSVAGVHIEPLG
                     VYSTKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAEN
                     PKNVKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVA
                     RPDNKDSDDMKKLAAALHSPEVKQFIIDKYKGAVVPAF"
     gene            complement(146817..147488)
                     /locus_tag="PPUBIRD1_RS00695"
                     /old_locus_tag="PPUBIRD1_0141"
     CDS             complement(146817..147488)
                     /locus_tag="PPUBIRD1_RS00695"
                     /old_locus_tag="PPUBIRD1_0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010951513.1"
                     /db_xref="GI:499253973"
                     /translation="MDALNFFANVDWAEIWLATVDTMIMLFGSLFFTVLLGLPLGVLL
                     FLCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPL
                     VVGATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTA
                     ITLVSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVV
                     HFSRK"
     gene            complement(147488..148495)
                     /locus_tag="PPUBIRD1_RS00700"
                     /old_locus_tag="PPUBIRD1_0142"
     CDS             complement(147488..148495)
                     /locus_tag="PPUBIRD1_RS00700"
                     /old_locus_tag="PPUBIRD1_0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016978781.1"
                     /note="Methionine import ATP-binding protein metN1;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine import ATP-binding protein MetN 1"
                     /protein_id="WP_014589249.1"
                     /db_xref="GI:504402147"
                     /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGK
                     STMLRLINRLEEPSGGTIVVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADN
                     VALPLALAGELSRSEIDKRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNP
                     KILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAG
                     QIVEQGSVAEVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYA
                     PLLGTVARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVL
                     R"
     gene            148723..150858
                     /gene="katE"
                     /locus_tag="PPUBIRD1_RS00705"
                     /old_locus_tag="PPUBIRD1_0143"
     CDS             148723..150858
                     /gene="katE"
                     /locus_tag="PPUBIRD1_RS00705"
                     /old_locus_tag="PPUBIRD1_0143"
                     /EC_number="1.11.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437496.1"
                     /note="Catalase HPII; Catalase HPII; monofunctional
                     catalase that decomposes hydrogen peroxide into water and
                     oxygen; serves to protect cells from the toxic effects of
                     hydrogen peroxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroperoxidase II"
                     /protein_id="WP_014589250.1"
                     /db_xref="GI:504402148"
                     /translation="MPSKKTDAPKHSEAAGTQTPDRANTNVKLQSLEADRSDATGQAL
                     RTNQGVRIADNQNSLKAGDRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFF
                     QSYGNHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNF
                     DLVGNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVM
                     WAMSDRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPRQGVHSLLWDEAQKLAG
                     KDTDFQRRDLWEAIETGDYPEWELGVQIVPEADEHKFDFDLLDPTKIIPEELVPVTPL
                     GKMVLNRNPDNFFAEVEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNF
                     HQIPINRPVAPNHNNQRDALHQHVVHKGRASYEPNSIDGGWPKETPPAAQDGGFESYQ
                     ERIDAHKIRQRSESFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREHIRAREV
                     NEILANIDLKLAAAVAANLGLPAPKAGTVQVKGSQLAQSPALSQMNHPGSVGIKGRKI
                     AVLVADGVDAASVDKLVKALEAHSARPMLLGPTSAPVKAADGKQLPVAASMEGMPSIM
                     FDGIIVPAGKASTDALAASGLAKHFVLEGYKHLKALVLTKELAKALGLKEDKGLLLGD
                     EQKAVDAFVKAVEGHRVWEREAAAEAVPA"
     gene            complement(150919..151626)
                     /locus_tag="PPUBIRD1_RS00710"
                     /old_locus_tag="PPUBIRD1_0144"
     CDS             complement(150919..151626)
                     /locus_tag="PPUBIRD1_RS00710"
                     /old_locus_tag="PPUBIRD1_0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003256959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589251.1"
                     /db_xref="GI:504402149"
                     /translation="MKPFASRYLLVAAFSLILAACSNAPVEQATAPAQADAWQQLQQN
                     IASNELATAEDQLAALQAQSPDDARLEQYQRQLAEAYLQRSQIVLQKGDVNAAATALA
                     RARALMPQAPAVTGGDAVTQARKAELEKAEAALKAAEAKPEARIIDPTAPSTVVALKT
                     TDSRALRRQLDDIAADVVSYQCEVVFQVPRTEDAPWLKTLLEKRVRKIDSGFELKQKH
                     EIQRSLPAQVVLVPHQQ"
     gene            complement(151753..152536)
                     /locus_tag="PPUBIRD1_RS00715"
                     /old_locus_tag="PPUBIRD1_0145"
                     /note="membrane protein; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(152529..153302)
                     /locus_tag="PPUBIRD1_RS00720"
                     /old_locus_tag="PPUBIRD1_0146"
     CDS             complement(152529..153302)
                     /locus_tag="PPUBIRD1_RS00720"
                     /old_locus_tag="PPUBIRD1_0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc import ATP-binding protein ZnuC"
                     /protein_id="WP_003253004.1"
                     /db_xref="GI:489345868"
                     /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGK
                     TTLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRAAA
                     LSALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTEL
                     YNLITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELF
                     GKTAPSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
     gene            complement(153299..153784)
                     /locus_tag="PPUBIRD1_RS00725"
                     /old_locus_tag="PPUBIRD1_0147"
     CDS             complement(153299..153784)
                     /locus_tag="PPUBIRD1_RS00725"
                     /old_locus_tag="PPUBIRD1_0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003253002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_003253002.1"
                     /db_xref="GI:489345866"
                     /translation="MSITPLANRPHDHSHCVHSALAEADALCTRQGLRLTALRRRVLE
                     LVWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSH
                     PEHVHQGQFLICRACHVAIELEQSSISEAIINSAKGVGFTVETQTVEVVGLCGNCRSA
                     A"
     gene            153851..154759
                     /locus_tag="PPUBIRD1_RS00730"
                     /old_locus_tag="PPUBIRD1_0148"
     CDS             153851..154759
                     /locus_tag="PPUBIRD1_RS00730"
                     /old_locus_tag="PPUBIRD1_0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_041166811.1"
                     /db_xref="GI:752477535"
                     /translation="MSRFLALFVAFIALSAQADVRVLTTIKPLQQIAAAVQEGVGSPD
                     VLLPPGASPHHYALRPSDVRRVGDADLLYWIGPDMENFLARVLGSRSKATVAVQSLPG
                     MKLRHFGEDSHSHNEEDHDDHDHDHRPGSLDAHLWLSSVNARVIAAKMAADLAHVDPA
                     NAARYQSNLKAFDERLDALDGRIKARVTGIAGKPYFVFHEAFDYFEAEYGLKHAGVFS
                     VASEVQPGAQHVAAMRKRLQEVGKTCVFSEPPLRPRLAETLTAGLPVRLAELDALGGT
                     DPVDGKGYERLLEKLGGDLAGCLEQL"
     gene            complement(154869..155819)
                     /locus_tag="PPUBIRD1_RS00735"
                     /old_locus_tag="PPUBIRD1_0149"
     CDS             complement(154869..155819)
                     /locus_tag="PPUBIRD1_RS00735"
                     /old_locus_tag="PPUBIRD1_0149"
                     /EC_number="2.7.1.39"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009683590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_014589254.1"
                     /db_xref="GI:504402152"
                     /translation="MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLE
                     QGEFVLTLIERGPSEDMPFFIELLDTLHGADMPVPYAIRDRDGNGLRELCGKPALLQP
                     RLSGKHIKAPNNQHCAQVGELLAHIHLATREHIIERRTDRGLDWMLASGAELLPRLTA
                     EQAALLQPALEEISAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPM
                     LYDIAITVNDWCLDEQGAVDVPRAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWL
                     SRLIAAESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
     gene            complement(155889..156176)
                     /locus_tag="PPUBIRD1_RS00740"
                     /old_locus_tag="PPUBIRD1_0150"
     CDS             complement(155889..156176)
                     /locus_tag="PPUBIRD1_RS00740"
                     /old_locus_tag="PPUBIRD1_0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951520.1"
                     /db_xref="GI:499253980"
                     /translation="MRTLNRLLLLGLLATMPVVTLAADDAPSADPEVTIRTEGDKTIQ
                     EYRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
     gene            156252..158999
                     /locus_tag="PPUBIRD1_RS00745"
                     /old_locus_tag="PPUBIRD1_0151"
     CDS             156252..158999
                     /locus_tag="PPUBIRD1_RS00745"
                     /old_locus_tag="PPUBIRD1_0151"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484274.1"
                     /note="has 3'-5' exonuclease, 5'-3' exonuclease and
                     5'-3'polymerase activities, primarily functions to fill
                     gaps during DNA replication and repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_014589255.1"
                     /db_xref="GI:504402153"
                     /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLK
                     SLRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQIEPLHASVKALGYP
                     LLCVEGVEADDVIGTLARSSAALGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVA
                     GVHEKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDK
                     VPTLAIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVEALVCGEPDREALLAL
                     YTEMEFKSWVAEVQRDAAKAGDDVAPAVEPAAKVEPKYETILDQARFDAWLEKLRQAP
                     LFAFDTETTGLDAQQAQLVGLSFAVEPHEAAYVPLAHDYEGAPAQLDREAVLLALKPL
                     LEDPAKAKVGQNAKYDINILANGSPAIEMRGVAYDTMLESYVLNSTATRHDMDSLAQK
                     YLDHTTIAFEDIAGKGAKQLTFNQINLDKAGPYAAEDADITLRLHDALQARLAQTPSV
                     QPVLMDIEMPLVPVLARIERQGALVDAELLKVQSGELGVKMAELELRAYELAGETFNL
                     GSPKQLGTILYDKLGMPVLSKTAKGQPSTAEAVLDELALQGYPLPEVLMQYRSLSKLK
                     STYTDKLPGQINPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIA
                     SPGYKLLAADYSQIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALEDVTTDQ
                     RRSAKAINFGLIYGMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAE
                     QGFVETLFGRRLYLPDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVKVDNWLSE
                     SGLDARVILQVHDELVLEVREDLVQQVKDEIRQHMSQAAQLDVPLLVEAGVGANWDEA
                     H"
     gene            complement(159545..160177)
                     /locus_tag="PPUBIRD1_RS00750"
                     /old_locus_tag="PPUBIRD1_0152"
     CDS             complement(159545..160177)
                     /locus_tag="PPUBIRD1_RS00750"
                     /old_locus_tag="PPUBIRD1_0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RK5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein EngB"
                     /protein_id="WP_010951522.1"
                     /db_xref="GI:499253982"
                     /translation="MQVKNPILGLCQKAKFALSAAKVEQCPDDQGYEVAFAGRSNAGK
                     SSALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKH
                     LEAYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGK
                     NTLLKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLADWMELEDKPVV"
     gene            160379..160681
                     /locus_tag="PPUBIRD1_RS00755"
                     /old_locus_tag="PPUBIRD1_0153"
     CDS             160379..160681
                     /locus_tag="PPUBIRD1_RS00755"
                     /old_locus_tag="PPUBIRD1_0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016712845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_003252992.1"
                     /db_xref="GI:489345856"
                     /translation="MAKWLLAVGMFLPFFSAQATQDPEVLYNRTCAACHTGQLPQAPR
                     RGDRAAWEPRLAQGMDVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
     gene            160713..161330
                     /locus_tag="PPUBIRD1_RS00760"
                     /old_locus_tag="PPUBIRD1_0154"
     CDS             160713..161330
                     /locus_tag="PPUBIRD1_RS00760"
                     /old_locus_tag="PPUBIRD1_0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003256951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_003252989.1"
                     /db_xref="GI:489345853"
                     /translation="MNKLVVSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNP
                     DGNSLAPNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLAAFSDQDLADIAAYFSS
                     QKGSVGAADPKLVERGRALFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQY
                     VAKQLTDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
     gene            161482..162114
                     /locus_tag="PPUBIRD1_RS00765"
                     /old_locus_tag="PPUBIRD1_0155"
     CDS             161482..162114
                     /locus_tag="PPUBIRD1_RS00765"
                     /old_locus_tag="PPUBIRD1_0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019099201.1"
                     /note="DSBA oxidoreductase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_014589257.1"
                     /db_xref="GI:504402155"
                     /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYIELSNPVPVSVP
                     GKIEVVELFWYGCPHCYHFEPTINPWAEKLPKDVNFKRVPAMFGGPWDAHGQMFLTLE
                     AMGVEHKVHAAVFDAIQNQHKRLTDKNDMADFLATQGVDKDKFLATFDSFAIQGQVKQ
                     AKELAKKYEITGVPSMVVNGKYRFDLGTAGGPEGVLNVADQLIDKERAAK"
     gene            162127..162981
                     /locus_tag="PPUBIRD1_RS00770"
                     /old_locus_tag="PPUBIRD1_0156"
     CDS             162127..162981
                     /locus_tag="PPUBIRD1_RS00770"
                     /old_locus_tag="PPUBIRD1_0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_014589258.1"
                     /db_xref="GI:504402156"
                     /translation="MPRFRATRGIGLHEPQVNEHHLQAPGLPEDGRLRLLSFNIQVGI
                     STERYRHYLTRSWQHLLPHNGRAVNLQKIGRLLGDFDLVALQEADGGSLRSGYVNQVE
                     HLAHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQLLEDHPLPGPAGRGAILVRFGE
                     GEDALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDL
                     GLVAPQVEATFPSWRPQRCLDHILLSSSLTLERVEVLAQPISDHLPVAVEIRLPDALT
                     VDTLPVLS"
     gene            163009..164946
                     /locus_tag="PPUBIRD1_RS00775"
                     /old_locus_tag="PPUBIRD1_0157"
     CDS             163009..164946
                     /locus_tag="PPUBIRD1_RS00775"
                     /old_locus_tag="PPUBIRD1_0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_014589259.1"
                     /db_xref="GI:504402157"
                     /translation="MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAA
                     EGSDKVVDECMKEMRDVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMHQVSDALTA
                     LVGQLQSLPLPSDISRPLKKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKSGE
                     EARPGFLQRLFGSREEDAQAGAALAPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPA
                     PAAPAAEVAEAPELELEAFGPALIETAEMPPAPLPRDKSPLPEAAVSASEPLAEAEPL
                     QALEVTFGEDGPYALPYAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERV
                     ARGLNWYELIPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHAD
                     NSTAARELDSQLREHVDGLQSSMQGAADVDSLKHILENRLEGLLVTMDEHKHERDRRE
                     QELAGRLQGLSERVASMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSERVEREML
                     DWQENGGHLAMAILDLDHFKRINDNYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGE
                     EFVLLLPQTTPAVAAQVAEVLRATVEACPFHFKGERVVITTSIGLSAFRSGERSDQVL
                     KRADAALYRAKELGRNRVEHG"
     gene            165020..165808
                     /locus_tag="PPUBIRD1_RS00780"
                     /old_locus_tag="PPUBIRD1_0158"
     CDS             165020..165808
                     /locus_tag="PPUBIRD1_RS00780"
                     /old_locus_tag="PPUBIRD1_0158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014861523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011953154.1"
                     /db_xref="GI:500573607"
                     /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVL
                     HYTNASLERSLALLTQGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNS
                     SSIGIEIVNPGFTDTPNGRVWHPYSEAQIQSLIALLKDIVKRNNIEPRHIIGHSDIAP
                     LRKLDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSVGWYQQELARFGYQIE
                     QTGVLDVATRHVIAAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
     gene            166012..167610
                     /locus_tag="PPUBIRD1_RS00785"
                     /old_locus_tag="PPUBIRD1_0159"
     CDS             166012..167610
                     /locus_tag="PPUBIRD1_RS00785"
                     /old_locus_tag="PPUBIRD1_0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014589260.1"
                     /db_xref="GI:504402158"
                     /translation="MSAFIALLRQIFYRPWMLATLAALASAAVLLSASIGIALQQMKQ
                     SESEQMNAQGERFLERLEQVFGQLREGVDLLQAQPLRGCNPAMLAALQQVGLNSRFIY
                     EAAYVDGNVACSNRGDERAFVPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGKFL
                     VSTSRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSD
                     RLIYRMPTKSPDYQLVLIAPRASLPLKMNGMLWLLFPGSVLAACCIGWLVLQLILQRR
                     SMSSELQNALRRGELQVLYQPIIELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAEN
                     TGQIRQITDFVLQRVLEQLGQLLRSHPKLYISINLAACDVMVPRIGRVAARLLALHRV
                     APSQIAFEVTERGLIDVVVARDNLQALRAVGHQVLIDDFGTGYCSLAYLQTLPVDCLK
                     IDKAFIDALGHDAASSGVAPHIIRMAHDLHLRVIAEGIEFEDQAVLLNSEGVNYGQGW
                     LFARPLNARQFAELVTRGHLPRRV"
     gene            complement(167625..169406)
                     /locus_tag="PPUBIRD1_RS00790"
                     /old_locus_tag="PPUBIRD1_0160"
     CDS             complement(167625..169406)
                     /locus_tag="PPUBIRD1_RS00790"
                     /old_locus_tag="PPUBIRD1_0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_041166812.1"
                     /db_xref="GI:752477536"
                     /translation="MKWPPMKLRTRLFLSISALITVALLGLLLGLVSMLQMATVQQQL
                     VRDTTHALEVGLKLRQNLGEQLMLILNEDTAPESLRLLQESFQDLLNQGLEQGGERTG
                     FSKASSNYQAFLQTYRDSAAPARSMGVDQPLGAAFNQVRTDLIDSHKHALDLITRSEE
                     RTRDRALLVSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAKAADQLGKGDFDVTL
                     PVAQAAELNQLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQG
                     RLEHLNPVAQRQLGWNDSRVGSSLVEALQRPELEQQLRQVLRGGSLDRPPDDLNMEVD
                     EESRLLTYSLTPVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGM
                     HMAFGLLRERVKFPPEARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLELAPC
                     AIDDLLEHAQLRFAEQAAHKQIELIKELDPPLPRIQADVAQLDRVLDNLLHNAIRHTA
                     NGGRIRLHARRHAERVIISVEDNGEGISYGQQARIFEPFVQVGRKKGGAGLGLALCKE
                     IVQLHGGRMGVFSRPGQGTQFYMALPV"
     gene            complement(169403..170749)
                     /locus_tag="PPUBIRD1_RS00795"
                     /old_locus_tag="PPUBIRD1_0161"
     CDS             complement(169403..170749)
                     /locus_tag="PPUBIRD1_RS00795"
                     /old_locus_tag="PPUBIRD1_0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970325.1"
                     /note="Alginate biosynthesis transcriptional regulatory
                     protein algB; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_014589262.1"
                     /db_xref="GI:504402160"
                     /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQA
                     ETLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAG
                     AADYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMMAVLET
                     ARQVAITDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFG
                     HTRGAFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVT
                     RRADVRILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILILADRFLA
                     RFVKEYSRPARGFSDEARTALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGE
                     QPAGNAPRVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
     gene            170960..171781
                     /locus_tag="PPUBIRD1_RS00800"
                     /old_locus_tag="PPUBIRD1_0162"
     CDS             170960..171781
                     /locus_tag="PPUBIRD1_RS00800"
                     /old_locus_tag="PPUBIRD1_0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014589263.1"
                     /db_xref="GI:504402161"
                     /translation="MPFSLRTAVLAATLLPIFTPAFADPVQDARLEGALQTALSMNRM
                     LDSFRINVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENLLQLNTQLVERPL
                     ELRAYAQRLEDVTLAAVIRARLLWSRTTEKAPIEVQSSEGVVTLRGKVDSAEAKELAG
                     VVARTTDGVYLVNNLVSLDTAAMAKARETPAGALTGPQPSDSWIVDKIQSSYRFSRNL
                     DGLNLKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVATKVEG"
     gene            171956..172246
                     /locus_tag="PPUBIRD1_RS00805"
                     /old_locus_tag="PPUBIRD1_0163"
     CDS             171956..172246
                     /locus_tag="PPUBIRD1_RS00805"
                     /old_locus_tag="PPUBIRD1_0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589264.1"
                     /db_xref="GI:504402162"
                     /translation="MNRQSVNRSQSAALPLRQMLTLGMAMLLTLAAGLFYYSLQTARL
                     AEQVAAQTALLTQIQATRANTLVKAADWQPAGQAIASPATVEKFVPQERWVF"
     gene            172290..172451
                     /locus_tag="PPUBIRD1_RS00810"
     CDS             172290..172451
                     /locus_tag="PPUBIRD1_RS00810"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RJ4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003252966.1"
                     /db_xref="GI:489345829"
                     /translation="MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVA
                     SFFFGRGRG"
     gene            172454..172924
                     /locus_tag="PPUBIRD1_RS00815"
                     /old_locus_tag="PPUBIRD1_0165"
     CDS             172454..172924
                     /locus_tag="PPUBIRD1_RS00815"
                     /old_locus_tag="PPUBIRD1_0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951530.1"
                     /db_xref="GI:499253990"
                     /translation="MSRKLRSAVVAALLLGGSAAAMAANDGQVRVDQLLGSDPEYRET
                     WQDTLEGEERLPDWVVNLTGSSQQQMSAVTEDGDKYLVGPLCEKQDNCTYKRLIVAFS
                     WDKDDAYGMLVEVPEGLPSDKSPTRHAQYRWLGEPDDGMKAMLQEQLKRDPNWY"
     gene            173670..174998
                     /locus_tag="PPUBIRD1_RS00820"
                     /old_locus_tag="PPUBIRD1_0166"
     CDS             173670..174998
                     /locus_tag="PPUBIRD1_RS00820"
                     /old_locus_tag="PPUBIRD1_0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016712857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proton glutamate symport protein"
                     /protein_id="WP_010951531.1"
                     /db_xref="GI:499253991"
                     /translation="MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPA
                     GDIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVL
                     ANLFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEML
                     PIIFFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTV
                     ANFGFSSLLPLAKLVVLVYFAIAFFAFMVLGLVARLFGFSVIKIMRIMKDELILAYST
                     SSSETVLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDL
                     SWSQQLLLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIMDMAR
                     TALNVVGNALAALVIARWEGMYDAVKGEQYYASLMAEKQGAVVVGETAKR"
     gene            175146..176375
                     /locus_tag="PPUBIRD1_RS00825"
                     /old_locus_tag="PPUBIRD1_0167"
     CDS             175146..176375
                     /locus_tag="PPUBIRD1_RS00825"
                     /old_locus_tag="PPUBIRD1_0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589267.1"
                     /db_xref="GI:504402165"
                     /translation="MLNGLWLGFFLVAAVSAMAQWLVGGNAGIFAAMVESIFAMAKLS
                     VEVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHQALGLITMN
                     FAANGLGLDNAATPIGLKAMRALQELNPSSTTASNAQILFLVLNASSLTLLPVTVFMY
                     RAQQGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGF
                     MAFLGTLSAAALGSLSSLLGNLTLFGVIMLFLVVGALKRVKVYEAFVEGATEGFDVAK
                     NLLPYLVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSA
                     ARAMLIETMQTQGVDSFAALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLA
                     EFSGVVAAIFVCYWFFA"
     gene            complement(176357..176992)
                     /locus_tag="PPUBIRD1_RS00830"
                     /old_locus_tag="PPUBIRD1_0168"
     CDS             complement(176357..176992)
                     /locus_tag="PPUBIRD1_RS00830"
                     /old_locus_tag="PPUBIRD1_0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589268.1"
                     /db_xref="GI:504402166"
                     /translation="MNPSLRLLTLAASLSLASACSILPQSEPVDLYRLPVNQPSRTAP
                     PLDWSLRLNKPLASEVLAGPRIAVVPQGNVVSSYKGARWSDAAPVLLRNRLLDGFQRE
                     GQVQRLSADDSNLQADYELAGELQAFQSEYRTDGAVEVVIRYDARLVQGRNQRILASK
                     RFEIRQPLDDKQVSAVVAGFGQASDQLVGQVVNWTITQANQAQLKLQAKNQ"
     gene            complement(176989..177927)
                     /locus_tag="PPUBIRD1_RS00835"
                     /old_locus_tag="PPUBIRD1_0169"
     CDS             complement(176989..177927)
                     /locus_tag="PPUBIRD1_RS00835"
                     /old_locus_tag="PPUBIRD1_0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_010951534.1"
                     /db_xref="GI:499253994"
                     /translation="METRAHHVLIGLVTVLVVTGAMLFGLWLAKSSVDDAFKDYEVVF
                     NEAVSGLSPGSTVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTL
                     AGVTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINMLLHN
                     ANQMFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAIAQLVQVGKQASATLAETQAL
                     MRNANGLLDSEGKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAI
                     RELRETLNALKGISRQLEADPSGYLLGRDNNKEFQP"
     gene            complement(177931..178722)
                     /locus_tag="PPUBIRD1_RS00840"
                     /old_locus_tag="PPUBIRD1_0170"
     CDS             complement(177931..178722)
                     /locus_tag="PPUBIRD1_RS00840"
                     /old_locus_tag="PPUBIRD1_0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter ATP-binding protein"
                     /protein_id="WP_014589269.1"
                     /db_xref="GI:504402167"
                     /translation="MSGQDCVIEARGICNRFGRQVVHENLDLDLYRGEILAVVGGSGS
                     GKSVLLRSIIGLRRPNEGQIKVLGQDLTGLRDEQRSLVERRFGVLFQKGALFSSLTVT
                     ENVALPLIEHAGLSRSDAEHLAGVKLALAGLPISAADKYPASLSGGMIKRAALARALA
                     LDPDILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVL
                     SQKKVLVAGPLAEVEKTNDTWIQEYFHGPRGRAAEQAATRAGQER"
     gene            complement(178719..179852)
                     /locus_tag="PPUBIRD1_RS00845"
                     /old_locus_tag="PPUBIRD1_0171"
     CDS             complement(178719..179852)
                     /locus_tag="PPUBIRD1_RS00845"
                     /old_locus_tag="PPUBIRD1_0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041166813.1"
                     /db_xref="GI:752477537"
                     /translation="MEPMTTPSATLDASSQPACLRITGDWTLAHYASLKRESERLRSQ
                     CPADTVADLSQLGRLDTAGASLLAELLGSERLSRCTHALPEASQALLKNVYCSVQDYC
                     IPVKEPERNVLLLLLERIGRAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPV
                     VAHIEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVL
                     LTAILMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTF
                     VAMICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCL
                     EGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
     gene            complement(179984..181009)
                     /locus_tag="PPUBIRD1_RS00850"
                     /old_locus_tag="PPUBIRD1_0172"
     CDS             complement(179984..181009)
                     /locus_tag="PPUBIRD1_RS00850"
                     /old_locus_tag="PPUBIRD1_0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589271.1"
                     /db_xref="GI:504402169"
                     /translation="MPQIPHIVQRVIELLKRYPGIIALGGFLSGIGSFILVDRQAGLA
                     SWVAVLMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFI
                     TTTWNSGQLVFTGLLGAAGLVSIIDPLYYKWLAPRRWLFLALHTLTLFAALLTALPII
                     LHLTTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVLVTLSVGGGGWLLRSWVP
                     PATLWMTEVAVSTEVLNRQPGDSLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQ
                     KDGQEVDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVV
                     NDAPAGS"
     gene            complement(181103..182509)
                     /locus_tag="PPUBIRD1_RS00855"
                     /old_locus_tag="PPUBIRD1_0173"
     CDS             complement(181103..182509)
                     /locus_tag="PPUBIRD1_RS00855"
                     /old_locus_tag="PPUBIRD1_0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_014589272.1"
                     /db_xref="GI:504402170"
                     /translation="MRCLMFVCLLICSLPSFALDRSRVEGYLLPNGLQVILKNGYERD
                     HVAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDETGEGGLEERLQALGGEWNAYTS
                     SADTTFVIEAPARNQRKVLDLLLAVIRDTTIDAKALATAKRIIEREDGGHYGHLQRWL
                     DRQDIGHPANDQLATELGLKCPERSNLDDMTLAQVQALRDRWYAANNMTLIMVGGLDR
                     LLPAYLERSFGELPATEPEERRNLESITRQAQQRRNLTRGWLGDGVKLHWLFIEPVLD
                     NDHQATLDLLSHYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDK
                     AVKVMQALFDHLRKEGLDPDTFARIKEASIAKESWSTQGNSALADYYWGALNDYTDGR
                     FASPVRKLRQVSLEQANEALKDLLKEDGYVRIEKPLLGYDELYGLMALLVGLCLAAGL
                     LRWRRHGPERPSGATRQQ"
     gene            complement(182540..184198)
                     /locus_tag="PPUBIRD1_RS00860"
                     /old_locus_tag="PPUBIRD1_0174"
     CDS             complement(182540..184198)
                     /locus_tag="PPUBIRD1_RS00860"
                     /old_locus_tag="PPUBIRD1_0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_019436588.1"
                     /db_xref="GI:518266380"
                     /translation="MLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRIISQNMDKR
                     PLAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTALMARVLTF
                     DLSWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAPITHAQGV
                     KVLFASLTGDIMLDALVGAMFAMISYSSLAAVLLTATLAGAELISLPVAIGLVVGANI
                     GSGLLAFISTSMQNAAGRRVALGSLLYKLIGLVLIIPVLHPLVEWMDSLSFSPQELVI
                     GFHLLYNTLRCLIMLPTVKPMGRLCNVLLPERETGNGQVRPRHLDASALETPSLALAN
                     AARETLRLGDIVDSLLESMLGALRGTQTALPQQVRALGEDAEALYSAIKLYLAQMSRE
                     DLSEQDNRRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQVGLEELTGLQE
                     QLLANLRLGLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVVQSIETSS
                     LHLELIADMKRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARQP"
     gene            complement(184471..185241)
                     /locus_tag="PPUBIRD1_RS00865"
                     /old_locus_tag="PPUBIRD1_0175"
     CDS             complement(184471..185241)
                     /locus_tag="PPUBIRD1_RS00865"
                     /old_locus_tag="PPUBIRD1_0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019473450.1"
                     /note="integral membrane protein TerC; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589274.1"
                     /db_xref="GI:504402172"
                     /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQP
                     RTRIFGLALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSS
                     QEIYHGLEGEDENAEEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMVA
                     AIVVAVLVMMLCAGAISNFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFA
                     MAFSLGVEAINIRMRTAMARKDGKDHDPVKLRKDIPGQ"
     gene            complement(185311..186618)
                     /locus_tag="PPUBIRD1_RS00870"
                     /old_locus_tag="PPUBIRD1_0176"
     CDS             complement(185311..186618)
                     /locus_tag="PPUBIRD1_RS00870"
                     /old_locus_tag="PPUBIRD1_0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008098374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate transporter"
                     /protein_id="WP_010951541.1"
                     /db_xref="GI:499254001"
                     /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAK
                     IGPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTA
                     VLALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTA
                     RAASALHVDPSDIFVPMIPAMLFGVLAILAIAYMYGKRERARLGELHLPTDDIDHSEI
                     TVSQYPDARRPKLLYFNGALTAALMVALIAGLLPLPVLFMIAFSIAMIVNYPCLQQQK
                     DRIAAHAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAI
                     VSMPFTFFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYL
                     LVALAGIEFGDHQRFTLKWAVLVCLCIMLGALLMGIFPLFSSL"
     gene            complement(187326..189281)
                     /locus_tag="PPUBIRD1_RS00875"
                     /old_locus_tag="PPUBIRD1_0178"
     CDS             complement(187326..189281)
                     /locus_tag="PPUBIRD1_RS00875"
                     /old_locus_tag="PPUBIRD1_0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589276.1"
                     /db_xref="GI:504402174"
                     /translation="MKRVRAWLLGCALTLLGTPALADLQLELQASGLDPQQTQASQAL
                     LDEAMGKLPPHFKQQLDRHVRVSWSDNMPADAYGQASLISTLELNRRLLPSLADGSAA
                     AERTDRPHGTVREELLATVLHELTHLYDRARLWPSAENSLIARCKRQQGTLGKVGLPE
                     ECRGQAERRFTLSDDPRLLDLAGWQQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIA
                     VNMEYFLLDPSYSCRRPALYQYLREHFGWAPQQDTCAKGLPFINAGSDFARQPLGEID
                     PERVYEVDYLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFV
                     NDVQLSSWDGLVGNYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLNRDEIENLVRQA
                     AEMHWSYDGNYWFLSNNCAVESLKLLRSGTANPRLNDLDSIMPNGLLAVLKGRGLADT
                     SVLDNPREALRLGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLALNAEQRRSWFAK
                     ADLRTSAALLLLEQASLRRQLLLAQDEVKQRYLNAAALKDGSINKADATLKQMLANSG
                     FLSRPAELLDSKGYGLPQPEERKHLEQVSRERQAQLLRLSTSLDKEVRALLEPSRAKE
                     IAAVEANVKQIGEHLRALHKAAGGLQL"
     gene            complement(189278..189598)
                     /locus_tag="PPUBIRD1_RS00880"
                     /old_locus_tag="PPUBIRD1_0179"
     CDS             complement(189278..189598)
                     /locus_tag="PPUBIRD1_RS00880"
                     /old_locus_tag="PPUBIRD1_0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020192357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003252932.1"
                     /db_xref="GI:489345795"
                     /translation="MRKPLIAASLGMLLLADLAQAQTLVATSNIIVRAFGRSIDFTSD
                     TTTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFNTLRERVPEARGASDQVLAEA
                     ILAL"
     gene            complement(189635..189928)
                     /locus_tag="PPUBIRD1_RS00885"
                     /old_locus_tag="PPUBIRD1_0180"
     CDS             complement(189635..189928)
                     /locus_tag="PPUBIRD1_RS00885"
                     /old_locus_tag="PPUBIRD1_0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020192356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589277.1"
                     /db_xref="GI:504402175"
                     /translation="MRYLLPLLFAAAGMASAHAMDTTTQSLVITGYVTSQVTAAPFDR
                     KLVTQARDDAAAFVASGGLIRGARLEAALESLRHNCARHAVGDLELAQAILVQ"
     gene            complement(190016..190333)
                     /locus_tag="PPUBIRD1_RS00890"
                     /old_locus_tag="PPUBIRD1_0181"
     CDS             complement(190016..190333)
                     /locus_tag="PPUBIRD1_RS00890"
                     /old_locus_tag="PPUBIRD1_0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589278.1"
                     /db_xref="GI:504402176"
                     /translation="MNRKHLLGAALLLGLAGTANATSFVVTTDAVVGAVAASTDATSD
                     VSSSFRDDKIVQAARDDAASFVGTQGAIRGARLESAFVHIRSNMPALQASDAQLAQAI
                     LAL"
     gene            complement(190642..190857)
                     /locus_tag="PPUBIRD1_RS00895"
                     /old_locus_tag="PPUBIRD1_0182"
     CDS             complement(190642..190857)
                     /locus_tag="PPUBIRD1_RS00895"
                     /old_locus_tag="PPUBIRD1_0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003252924.1"
                     /db_xref="GI:489345787"
                     /translation="MERTLSSGLVFESNAQQSNTSLPLRALSTLLLWQRRMTSRRQLA
                     RLDSRLLADAGISESQRYEELSKPFWR"
     gene            complement(191231..192724)
                     /locus_tag="PPUBIRD1_RS00900"
                     /old_locus_tag="PPUBIRD1_0183"
     CDS             complement(191231..192724)
                     /locus_tag="PPUBIRD1_RS00900"
                     /old_locus_tag="PPUBIRD1_0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003256967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA hydrolase"
                     /protein_id="WP_003252922.1"
                     /db_xref="GI:489345785"
                     /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKA
                     VPHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQ
                     VMFIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQV
                     IVEINLSHNTNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISD
                     QPDSPSTVLPPDDETQGIADHLINFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLI
                     ESPFEDLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSTRRNADVFGNLERYKDKLVL
                     RPQEISNHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHL
                     AVFVTKSIAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDN
                     CVHPDYRAALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
     gene            complement(192911..194347)
                     /locus_tag="PPUBIRD1_RS00905"
                     /old_locus_tag="PPUBIRD1_0184"
     CDS             complement(192911..194347)
                     /locus_tag="PPUBIRD1_RS00905"
                     /old_locus_tag="PPUBIRD1_0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="WP_003252919.1"
                     /db_xref="GI:489345782"
                     /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLA
                     ILTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIG
                     LAAVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
                     KYKFRLFQGAPVQFAGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLVLAFIMGVLI
                     IIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAM
                     NRSFFNVILGGFGGDTDTGAAQGSQEQRPVKSGSADDATFLLSNADSVIIVPGYGLAV
                     ARAQHALKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINA
                     EFGQADVVLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLD
                     NELFYLDKTMMVFGDAKKVIEDMVKAVE"
     gene            complement(194350..194664)
                     /locus_tag="PPUBIRD1_RS00910"
                     /old_locus_tag="PPUBIRD1_0185"
     CDS             complement(194350..194664)
                     /locus_tag="PPUBIRD1_RS00910"
                     /old_locus_tag="PPUBIRD1_0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase"
                     /protein_id="WP_003252914.1"
                     /db_xref="GI:489345777"
                     /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNA
                     ISAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKTKNEA
                     KK"
     gene            complement(194676..195797)
                     /locus_tag="PPUBIRD1_RS00915"
                     /old_locus_tag="PPUBIRD1_0186"
     CDS             complement(194676..195797)
                     /locus_tag="PPUBIRD1_RS00915"
                     /old_locus_tag="PPUBIRD1_0186"
                     /EC_number="1.6.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014754986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="WP_014589279.1"
                     /db_xref="GI:504402177"
                     /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAA
                     IPDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLVGMLNPFNGELIG
                     KMAERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHHYPRFMPMLMTAAG
                     TVKAARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETD
                     EERECAEGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSAETV
                     AQMKPGSVVIDLAAAQGGNCPLTVADQVVQENGVTIVGPTNLPAQVSADASALYARNL
                     LDFMKLLFDKDGALIINLEDDIVAACLMCRDGQVVRKNG"
     gene            complement(196217..197134)
                     /locus_tag="PPUBIRD1_RS00920"
                     /old_locus_tag="PPUBIRD1_0187"
     CDS             complement(196217..197134)
                     /locus_tag="PPUBIRD1_RS00920"
                     /old_locus_tag="PPUBIRD1_0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589280.1"
                     /db_xref="GI:504402178"
                     /translation="MRRKIPSTAALICFEAAARNESFTKAAQELALTQGAVCRQIGGL
                     EAFLNVELFRRSRRGVRLTEAGLSYSRQVAAQLDAVERDTLSVMRQQGANVIELAVVP
                     TFGTQWLLPRLKDFQQCHPEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHQL
                     MGENPVPVCSPALLNDQGMLEARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGP
                     RYELFSMLAQAAMHDMGIALIPPFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKV
                     ESASLRAFRDWLVGQAQAYINSSGTNATN"
     gene            197295..198476
                     /locus_tag="PPUBIRD1_RS00925"
                     /old_locus_tag="PPUBIRD1_0188"
     CDS             197295..198476
                     /locus_tag="PPUBIRD1_RS00925"
                     /old_locus_tag="PPUBIRD1_0188"
                     /EC_number="1.3.99.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951547.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014589281.1"
                     /db_xref="GI:504402179"
                     /translation="MAGKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLE
                     AFRHEQTDPAIFREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMS
                     VQSSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDG
                     GYRLTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWQGLSAPAIHGKVGLRASI
                     TGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGAMGAAEACWHTARQYTLD
                     RQQFGRPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCG
                     KALDIARMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAF
                     Y"
     gene            198490..199710
                     /locus_tag="PPUBIRD1_RS00930"
                     /old_locus_tag="PPUBIRD1_0189"
     CDS             198490..199710
                     /locus_tag="PPUBIRD1_RS00930"
                     /old_locus_tag="PPUBIRD1_0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003252904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA transferase"
                     /protein_id="WP_014589282.1"
                     /db_xref="GI:504402180"
                     /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDT
                     RSWGPPFLKDVEGEDTSEAAYYLSANRNKRSVTIDFTQSEGQRLVRELAAKCDIVIEN
                     FKVGGLAAYGLDYQSLKAVNPQLIYCSITGFGQTGPYARRAGYDFMIQGLGGLMSLTG
                     RPEGEEGAGPVKVGVALTDILTGLYSTVAMLAALAHRDQTGVGQHVDMALLDVQVACL
                     ANQAMNYLTTGTPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQ
                     WAEDPRFATNKLRVANRAELIPLIRQATVFKTTAEWVAQLEAAGVPCGPINNLAQMFQ
                     DPQVLARGLALNIPHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTEAVLGEVLGL
                     DVGEVQRLRGAGVL"
     gene            200265..201811
                     /locus_tag="PPUBIRD1_RS00935"
                     /old_locus_tag="PPUBIRD1_r0001"
     rRNA            200265..201811
                     /locus_tag="PPUBIRD1_RS00935"
                     /old_locus_tag="PPUBIRD1_r0001"
                     /product="16S ribosomal RNA"
     gene            202087..205003
                     /locus_tag="PPUBIRD1_RS00940"
                     /old_locus_tag="PPUBIRD1_r0002"
     rRNA            202087..205003
                     /locus_tag="PPUBIRD1_RS00940"
                     /old_locus_tag="PPUBIRD1_r0002"
                     /product="23S ribosomal RNA"
     gene            205130..205245
                     /locus_tag="PPUBIRD1_RS00945"
                     /old_locus_tag="PPUBIRD1_r0003"
     rRNA            205130..205245
                     /locus_tag="PPUBIRD1_RS00945"
                     /old_locus_tag="PPUBIRD1_r0003"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            205695..207241
                     /locus_tag="PPUBIRD1_RS00950"
                     /old_locus_tag="PPUBIRD1_r0004"
     rRNA            205695..207241
                     /locus_tag="PPUBIRD1_RS00950"
                     /old_locus_tag="PPUBIRD1_r0004"
                     /product="16S ribosomal RNA"
     gene            207517..210433
                     /locus_tag="PPUBIRD1_RS00955"
                     /old_locus_tag="PPUBIRD1_r0005"
     rRNA            207517..210433
                     /locus_tag="PPUBIRD1_RS00955"
                     /old_locus_tag="PPUBIRD1_r0005"
                     /product="23S ribosomal RNA"
     gene            210560..210675
                     /locus_tag="PPUBIRD1_RS00960"
                     /old_locus_tag="PPUBIRD1_r0006"
     rRNA            210560..210675
                     /locus_tag="PPUBIRD1_RS00960"
                     /old_locus_tag="PPUBIRD1_r0006"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            210785..210900
                     /locus_tag="PPUBIRD1_RS00965"
                     /old_locus_tag="PPUBIRD1_r0007"
     rRNA            210785..210900
                     /locus_tag="PPUBIRD1_RS00965"
                     /old_locus_tag="PPUBIRD1_r0007"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(210967..213381)
                     /locus_tag="PPUBIRD1_RS00970"
                     /old_locus_tag="PPUBIRD1_0190"
     CDS             complement(210967..213381)
                     /locus_tag="PPUBIRD1_RS00970"
                     /old_locus_tag="PPUBIRD1_0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrioxamine B receptor"
                     /protein_id="WP_041166814.1"
                     /db_xref="GI:752477538"
                     /translation="MRHAIRAVLFGTALGLATVPQLSVAADTAEVSQHYAIPAGQLTD
                     VLNKIARQAGITLSSTPQLTDGLHSNGLQGQYTTDQALRQLLNGSGLEAVSQGGSNYV
                     LQAQRQNAALALPDTDIRSFSLGNALGSMEGYNATHSQVATKTSMPLVETSQSVSVVT
                     RQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAMRGFNDGSVDNIYVDGLKSMG
                     DNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVALTTKKPLFAPYHQVQATVG
                     TQGQRGVGFDFSGPVDDDQRIAYRLTGLADASETQFDHNKEERYAIAPAISVDFTEDT
                     SLTLQAYLQHDPDGGYHGGNPADGMLHKRNGLRLSDHFFEGEPSIDNYERTQQSFSYQ
                     FEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWADVDSNMLNRAYTGGDERLHSYIIDN
                     MLQAEFFTGAAKHTLLLGADYQRRKADVTWRYGTVDPLDAGNPQYGNGNLQVLGENRY
                     QRRLQQTGVYLQDLVELDQWRFSLGLRQDWVRVSEENRDSDSKVSDQRSRFTSRAGVL
                     YLFENGIAPYISYSESFNPNTVSDQQGRPLAPTEGTQWEAGIKYQPPGSDSLFTASVF
                     RIEQENLASKQPDEDFYRPVGEVRSQGLELEAHVQLTDSLKLLGGYTFTDIEYSKSMP
                     SLVSGNLDNKGNSPTQAPKQMLSLWADYNFRQGALDGLRLGGGVRYVGYSWVDAENSM
                     KVPSYTLFDASIGYDLGKVGLTGVDVRLNANNLTNESYITSCASLNYCYMGEERNVSA
                     TVSYQF"
     gene            complement(213547..214452)
                     /locus_tag="PPUBIRD1_RS00975"
                     /old_locus_tag="PPUBIRD1_0191"
     CDS             complement(213547..214452)
                     /locus_tag="PPUBIRD1_RS00975"
                     /old_locus_tag="PPUBIRD1_0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017147863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_019437303.1"
                     /db_xref="GI:518267095"
                     /translation="MLRLRESGHDPALQQQCEQWRSTHHENEQAWQRVVHLHQDLDLR
                     AIPGAGLALQTLETSQQRLRRRQALKLLGGVVMAGSASWLAKDLNTVSAWASDYATGT
                     GERRVFTLPDGSMMQLNTCSAVDLAFHDQRRLVRLKHGELMINCNPRHPLLVQTRDAL
                     LEGFEGRFVAYQDSDCTRVSVSYGKVAIHRPGTGQLQWIESGQNWRLDAQGAHRLAHM
                     DMDAMAWTEGLIVTQDMRLSNFLAQVSRYRHGYLSCSNDIADLRLSGVFRLEDPEQLL
                     RLLPQTLPVQLRRRTRWWVHVESMT"
     gene            complement(214508..215011)
                     /locus_tag="PPUBIRD1_RS00980"
                     /old_locus_tag="PPUBIRD1_0192"
     CDS             complement(214508..215011)
                     /locus_tag="PPUBIRD1_RS00980"
                     /old_locus_tag="PPUBIRD1_0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014859071.1"
                     /note="ECF subfamily RNA polymerase sigma factor; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_014589285.1"
                     /db_xref="GI:504402183"
                     /translation="MPSNDSVQTLYSDHHGWLHTWLRSKLGNAADAADLAQDTFVRLL
                     QRREQLQLNAPRAFLRTVARGLVIDHWRREELHRAYLEALAHVPEALVPSVETRELLL
                     ELLERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQMGISVRTVERYIADALYHCYV
                     LRYEDDC"
     gene            complement(215118..215807)
                     /locus_tag="PPUBIRD1_RS00985"
                     /old_locus_tag="PPUBIRD1_0193"
     CDS             complement(215118..215807)
                     /locus_tag="PPUBIRD1_RS00985"
                     /old_locus_tag="PPUBIRD1_0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014589286.1"
                     /db_xref="GI:504402184"
                     /translation="MAKKIKLSNVLASEQLLPHQARGVIEERLRSAILDGRLPPGTAV
                     RQQELATLYGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLE
                     SEALRQSIPLLDASDIASARGYIQQLENETSHTEIGRLNRLLHMALYSKAPNKKLLRL
                     IENELNEEERFLRFHLSSMGLGKLTQDDHNALVDAASDKLVDEAVAVLERHLNGGARV
                     IRNYLDTQLGH"
     gene            216079..216771
                     /locus_tag="PPUBIRD1_RS00990"
                     /old_locus_tag="PPUBIRD1_0194"
     CDS             216079..216771
                     /locus_tag="PPUBIRD1_RS00990"
                     /old_locus_tag="PPUBIRD1_0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012269968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic protein"
                     /protein_id="WP_041167117.1"
                     /db_xref="GI:752477841"
                     /translation="MAISWLLKTVVRYVGFAALLGSLLLSGLHADWDFSQISRKSQAL
                     YGPLGAGQGRIDAWQSLMATQKQGTELERLQVVNRFFNQQLRYVEDIDLWHEVDYWAT
                     PVQALIKGAGDCEDYAIAKYFSLRRMGIPSEKLRITYVKALRQNRAHMVLTYYSSPQA
                     QPLVLDSLMDAIKPASQRTDLLPVYAFNGEGLWLTGAAGNKKVGDTKRLSRWQDLLKK
                     MQAEGFPAEPVY"
     gene            216782..218728
                     /locus_tag="PPUBIRD1_RS00995"
                     /old_locus_tag="PPUBIRD1_0195"
     CDS             216782..218728
                     /locus_tag="PPUBIRD1_RS00995"
                     /old_locus_tag="PPUBIRD1_0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003256007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="WP_014589288.1"
                     /db_xref="GI:504402186"
                     /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQD
                     AATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERQAEPDPGGV
                     PLWFVRLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLSWLLLCGA
                     ASAVLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKL
                     KALFTEQAERSERLRAESYQDSLTGLSNRRYFEMQLNNRVSNLEDARAGYLLLLRVQG
                     LAGLNARLGGQRTDQLLQAVGEQLRRTCASYPETNDLISRSRGGEFAVLAPGMVHEEA
                     VHLAQALEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPT
                     PGWVCLEQGVAAVAADSQHAWHERLDQAFINGHFELFFQPVMECASSQRVLHHKVISR
                     LRDGHGEALPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADP
                     KALQRIFELLSQNAALGPRLVFEIGEEQLPEQAALEQLTRRLHGFGFGLALQRFGGRF
                     SMIGNLAHLGLAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGE
                     RLVLLEMGVGGIQGQLVGEPAPWR"
     gene            complement(218855..220231)
                     /locus_tag="PPUBIRD1_RS01000"
                     /old_locus_tag="PPUBIRD1_0196"
     CDS             complement(218855..220231)
                     /locus_tag="PPUBIRD1_RS01000"
                     /old_locus_tag="PPUBIRD1_0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_010951555.1"
                     /db_xref="GI:499254015"
                     /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVV
                     RLTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEG
                     QIVEVGQPLLRLDETRFASNVGETEADRLAMALRVERLSAEVEDRPLIIDEKLRKAAP
                     NQAASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRTQYANSLELLRKEISM
                     SEPLVATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFR
                     SEALTQLNEARTELNKATATSKALDDRVHRTLVTSPVRGIVKQLLVNTIGGVIQPGSD
                     IIEVVPLDDTLVIEAKILPKDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTI
                     TDEDKKTTYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKA
                     RSEALRER"
     gene            complement(220221..222377)
                     /locus_tag="PPUBIRD1_RS01005"
                     /old_locus_tag="PPUBIRD1_0197"
     CDS             complement(220221..222377)
                     /locus_tag="PPUBIRD1_RS01005"
                     /old_locus_tag="PPUBIRD1_0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009685659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_003256004.1"
                     /db_xref="GI:489348902"
                     /translation="MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTT
                     GLPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWE
                     NDDTARLLLSESDGGEVHVSREALLSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRD
                     TLLRSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYI
                     FDLILKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLR
                     DFLASLTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFPLALGIGYALQRPLMATME
                     RTMALASERQSSLIETLAGLDAVKVNNAESERQYMWEQTLGTLSRLELRVKVLSSLAM
                     NITLLIQQLAGVAMICVGVYLIIDGNLSMGGLVACYMLSGRALGPLGQLNGLLARYQQ
                     AKVTMVSTDHMMDLPQERNFEERPLSRKVLQGSVEFRGVDFTYPNQQNLALKNINLTI
                     RPGEKVGIIGRSGSGKSSLAKLIVGLYEADGGSLLVDGVDIRQIDVSELRHNIGYVPQ
                     DIQLLAGTLRDNLVSGARYIEDELILQAAELAGVHEFARLHPDGYELQVGERGQNLSG
                     GQRQNVALGRALLLNPQILLLDEPTSAMDNTGEERLKQRLQAVVEGKTVLLVTHRASL
                     LSLVDRLIVIDRGQIVADGPKAAVMDALKKGQISVA"
     gene            complement(222441..222656)
                     /locus_tag="PPUBIRD1_RS01010"
     CDS             complement(222441..222656)
                     /locus_tag="PPUBIRD1_RS01010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019437307.1"
                     /db_xref="GI:518267099"
                     /translation="MPWLSGRLCCNKPDDGWIKNETIIAPLSLVKMKHVELFTQHRFK
                     ANIGQLLQHQGVITLISTALQHQREPG"
     gene            223371..249419
                     /locus_tag="PPUBIRD1_RS01015"
                     /old_locus_tag="PPUBIRD1_0199"
     CDS             223371..249419
                     /locus_tag="PPUBIRD1_RS01015"
                     /old_locus_tag="PPUBIRD1_0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Surface adhesion protein, putative"
                     /protein_id="WP_014589289.1"
                     /db_xref="GI:504402187"
                     /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLAGEEVLTGPG
                     GAVTLELADGRLLDLGRDSQWSADAPDSSTDLSQAAAQAAPSVEELQQAIAAGVDPTT
                     ELEATAAGPSSAGGGALGGGHSFVMLEETAGRVDPTVGFPTDGLGFAGVPDNEEVGLL
                     DTNGNNLVTTPTDTTVATELTLGATPSISEAGGVIVYTATVGQAPTTNLVLTLSNGAV
                     IVIPAGQTSGSVNVAVPANDTPYIDGGQISATVTGSTGGGGLTVTLPQTPAVTQVTDT
                     IDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQVITVEAGKTQGSVDFQ
                     TPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTE
                     GGVITYTVTLSNPAQTPVTVNLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVT
                     IESATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQT
                     PVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNP
                     TPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEA
                     GKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTA
                     TLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDV
                     YNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITY
                     TVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATG
                     GNFEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTL
                     SNGQVITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTT
                     INDSVDATTATLTASPSVTEGGVITYTVILSNPAQTPVTVTLSNGQTITVEAGKTQGS
                     VDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTITDSVDTTTATLTASP
                     SVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGST
                     VSVTIESATGGNFEHLTPNPTPASTVINDSIDTVTVSIVSNGNVTEDQQPSFTVKVSQ
                     ALDRPLTVTLSNGDTVTIEAGKTEVEYKTSVQGDDVYLDAGSITLSVTDATVPGATFE
                     KLALGGPATVEISDTISEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFK
                     LTDGTTVVVAANSTTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTP
                     VSTEVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNA
                     QVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAAKVDVT
                     DTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANS
                     TTGSATVAAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPG
                     NEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPY
                     THDAQGDDVYQDAGQISLGINSAVDATGAAFENLELGGAASVQVTDTLDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNV
                     YVGTNAPVINAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDA
                     GQISLGINSAVDATGAAFENLELGGSASVQVTDTLDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAID
                     AVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVKVTITADQASVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGITSAVDV
                     DGHTFENLQLGGNASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAIDAVSGADAWKFENL
                     NLDKTPVSTTVTDEPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLIV
                     TLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGINSAVDATGAAFENLQLGGN
                     ASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTV
                     VVAANSTTGSATVAAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTTVTD
                     EPGTPGNEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHDAQGDDVYQDAGQISLGITSAVDVDGHTFENLQLGGNASVQVTDTLDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATA
                     TAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGNEGDIVK
                     VTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGD
                     DVYNDAGQISLGITSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATPSVTEGG
                     EITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTND
                     PVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAE
                     NVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLG
                     ITSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
                     GLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGA
                     DVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFT
                     VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDA
                     TGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNH
                     SALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQ
                     LTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPL
                     AHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFEN
                     LELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTL
                     SDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTP
                     VSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVT
                     LSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNA
                     SVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVI
                     TVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTD
                     EPGTPGNEGDLVKVTITADQTSVAENVKPIFTVHVNQPLAHDLVVTLSNNAQVTIKAG
                     ETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQLGGNASVQVTDTTDEVV
                     AKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTAT
                     VTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSN
                     EGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYT
                     HAAQGDDVYNDAGQISLGINSAVDATGATFENLALGGAAKVDVTDTTDEVVAKLTATP
                     SVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNV
                     YVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITAD
                     QTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDA
                     GQISLGITSAVDVDGRTFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTI
                     TLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSI
                     ATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTF
                     TVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVD
                     ATGATFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINN
                     HSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFE
                     QLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDL
                     VVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELG
                     GAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIDKHAALTFTLDDGK
                     TTITIPANGTTGTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTS
                     VTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTI
                     KAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLELGGAASVQVTDTLD
                     EVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVG
                     TATVTAPDNVYVGANDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEG
                     DLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHA
                     AQGDDVYNDAGQISLGITSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSV
                     TEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYV
                     GSNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQT
                     SVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQ
                     ISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTATPSVTEGGEITYTITL
                     TNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVVMSIAT
                     VGGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSLAENVK
                     PTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINS
                     AVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLP
                     INNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVG
                     KFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLA
                     HDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENL
                     ELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLS
                     DGKTVITVPANGTVGTATVTAPDNVYVGSNDPVVMSIATVGGADVGKFEQLTLDKTPV
                     STSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQ
                     VTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTD
                     TTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANG
                     TVGTATVTAPDNVYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPG
                     NEGDLVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVIIKAGETSAPY
                     THAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGNASVQVTDTTDEVVAKLTAT
                     PSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDN
                     VYVGTNDPVVMSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDPVKVTITA
                     DQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYND
                     AGQISLGINSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYT
                     ITLTNKDGLPIDKHAALTFTLDDGKTTITIPANGTTGTATVTAPDNVYVGTNDPVVMS
                     IATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPT
                     FTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAV
                     DVDGRTFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIN
                     NHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGANDPVVMSIATVEGADVGKF
                     EQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHD
                     LVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQL
                     GGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDG
                     KTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVST
                     SVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVT
                     IKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLQLGGAATVQVTDTT
                     DEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTV
                     GTATVTAPDNVYVGTNDPVVMSIATVGGADVGKFEQLTLDKTPVSTSVTDEPGTPGNE
                     GDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTH
                     AAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPS
                     VTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVY
                     VGTNDPVIKSIATVGGADVGKFEQLTLDKTPVSTAVTDEPGSGTPGTGNKGDVTTVGI
                     TGTTSLTEGETGQYTLTLSNASKSEVTITLSYSGTAQNGDDFTGVATVKIPANSTGTT
                     FNIATLNDKLVEGTENFVVKIETATGGNFENLQVDSSKSSVTTTILDNDHLPVSPGGA
                     VFGVEDTDYVFAWSDFKVTDADGNTNLSVTITSLPAAGNLQFFNGTAWVNVAVGQVVS
                     QADITAKNLKFVPALNQSGADNYGGNGVGNQKADYAQFKFKPNDGTNLGSEVTMKVDI
                     SPVADKPTLSFGSADIESKGLTKEVWTSLKGLGTGGNGITGEDLKTVFANSGSANSSS
                     TTTNVQSDGSVTAGTGSKTSGLIYLEAGKVYTFSGLADDSFVVTIGGKTVVTATWGAG
                     GGVSGTFTPNTSGYYPIEVYHANQSGPGSYDLNIQVGSGAVTDLSSSNVKMYQNVTEM
                     ANAGLGVSDLHTVNGQSYYDGYKLNEGPEGGSVKLVGISTALTDTDGSESLNVTLSGI
                     PKGTVLSDGAGHTVTVGTAPVDVTGWKLSSLTLTPPAYYKGSFDITVTSTATESLGGS
                     AITTGNIPVTVYGATYKASVGTSGNDTLTGSEGNDIFVADVSGLNVVQGKNYNIAFMV
                     DSSGSMSDKSIADAKTQLASVFNTLKASLGSDTSGTVNIFLVDFDTQVNKNVAVNLAD
                     PDALSKLQAVLNSMVGGYYGGGTNYEDAFKTTSNFFNSTMATSNKGAENLTYFITDGK
                     PTYYQSNESTNPSLWKNGKSLDDVVNVNNYKMGDTFSAWADATHKVEISSSGVVKVLT
                     YTENRRGELVLDSTKTVGTLHAQGDGTYEFSSLDGTGYADYWNYVYSAAGSTESFAVL
                     GGTNGLSKVQAIGLNSDVTLNDLKPYDSAGKPQTNIDPSDLAKAILGHSEATVPGADT
                     IDSGNGNDIIFGDLITLNGVVSEGYQALQTYVAQKSGVEVGAVTTSNVHQYITEHYTE
                     FDISGAKDGNDILSGGNGNDILFGQGGSDTLNGGKGNDILLGGTGNDTLIGGQGDDIL
                     IGGSGADTFVWKAGDVGNDVIKDFNKAEGDRIDLKDLLQGEKGSTIDNYLKLTTVEGT
                     TTLQVSSEGKLNAEGGIANADVTIKLEGVNWSNQTINSLISGADPTIIIHNKDS"
     gene            249565..249906
                     /locus_tag="PPUBIRD1_RS01020"
                     /old_locus_tag="PPUBIRD1_0200"
     CDS             249565..249906
                     /locus_tag="PPUBIRD1_RS01020"
                     /old_locus_tag="PPUBIRD1_0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophan synthase subunit beta"
                     /protein_id="WP_003255921.1"
                     /db_xref="GI:489348816"
                     /translation="MFYVQRNAAGQLLRVEAAAFDQFTEMLPSDHADIQEWFADDVVE
                     NSLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKALSSLNN
                     LIDEEEQGGLI"
     gene            249938..250099
                     /locus_tag="PPUBIRD1_RS01025"
                     /old_locus_tag="PPUBIRD1_0201"
     CDS             249938..250099
                     /locus_tag="PPUBIRD1_RS01025"
                     /old_locus_tag="PPUBIRD1_0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041166815.1"
                     /db_xref="GI:752477539"
                     /translation="MVVLQGNLVLAALPSIKLCAGLAVVILIGLLAEGLVFNNLEGLT
                     VLRWETPRG"
     gene            complement(251533..252093)
                     /locus_tag="PPUBIRD1_RS01030"
                     /old_locus_tag="PPUBIRD1_0202"
     CDS             complement(251533..252093)
                     /locus_tag="PPUBIRD1_RS01030"
                     /old_locus_tag="PPUBIRD1_0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019097414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_003255912.1"
                     /db_xref="GI:489348807"
                     /translation="MPFATTRATLSRQWALLRQLPSRSPGITSAELVWRLRDVGFTVS
                     KRTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLLTHLRGDALQPSQG
                     EGVELVARISDALARQLRDAPLSSDMQLTALEHGHRLRGTVSDGWPLRWWLLSHGDRV
                     VVEQPAGLREEIGRILSNAAAQYQNL"
     gene            252301..253095
                     /locus_tag="PPUBIRD1_RS01035"
                     /old_locus_tag="PPUBIRD1_0203"
     CDS             252301..253095
                     /locus_tag="PPUBIRD1_RS01035"
                     /old_locus_tag="PPUBIRD1_0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589291.1"
                     /db_xref="GI:504402189"
                     /translation="MSVASNIHSLLARLLPERVIAPPAPAGRRQRLFSGVGLPSQRSL
                     LVNRLDEANDLQAVYVDLRRQALQGSVSALNDLGWIWLNGKYWRADTVLAGHLLRMAA
                     LQGNAAAWFNLGQQHYFGKGIDPSYVQAAECYRQAFDRGMLHAAAALGDLYEEEVCDG
                     DLEWQVDLVQAYQWFLRGAEQGEARCRFEVGYRLMHGLHVEANLKAALYWLELAAAAG
                     VVQAAEELAVHFSSRDAVRYQEWRDRAVQMGSTLALTMKLEDQIHP"
     gene            253229..253681
                     /locus_tag="PPUBIRD1_RS01040"
                     /old_locus_tag="PPUBIRD1_0204"
     CDS             253229..253681
                     /locus_tag="PPUBIRD1_RS01040"
                     /old_locus_tag="PPUBIRD1_0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="WP_026031987.1"
                     /db_xref="GI:648250838"
                     /translation="MSLDFLRLQVSSGLVVAARHWRRICHTALTGYGISEACAAPLLM
                     IVRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLTAEGR
                     ALAEAIEAELVRLRRDVLGGIDQADLEAALRVLHAFEAAGLGSAGGVA"
     gene            253678..255765
                     /locus_tag="PPUBIRD1_RS01045"
                     /old_locus_tag="PPUBIRD1_0205"
     CDS             253678..255765
                     /locus_tag="PPUBIRD1_RS01045"
                     /old_locus_tag="PPUBIRD1_0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein"
                     /protein_id="WP_014589293.1"
                     /db_xref="GI:504402191"
                     /translation="MNGFFSSVPPARDWFYGVRTFGASMIALYIALLMQLPRPYWAMA
                     TVYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLF
                     LSLNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAI
                     FWPRRLAPVVVGATGNWFTEAIRYSDTYLARDASADKVGGMRGAMVTTFNSLELMIGQ
                     LAHEGAGPHTLKNARELRGRMIHLLPVIDALGDALVALEGRAPAQFAQLQPVLEAARE
                     WLKGTADSASVAHWAALHEQIGRLQPATAALDQRAELLLSNALYRLTEWADLWQDCCT
                     LQHALRTDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWN
                     DGASAVILAAVACSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLV
                     LAFAVPFICIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNSNLAGPAGL
                     LFAFIWTLVMRPFGVELAAKRMTRFAWRDIVEMTEPATLAEHRQVGVQMLDRLMQHLP
                     RLSQTGQDSGVALRDLRVGLNLLDLLAYMPRAGQQARERLNTVVEEVGAHYAACLRAG
                     ERLHAPAALLRNMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAE
                     QPQLPPGLDGAPL"
     gene            255762..255974
                     /locus_tag="PPUBIRD1_RS01050"
                     /old_locus_tag="PPUBIRD1_0206"
     CDS             255762..255974
                     /locus_tag="PPUBIRD1_RS01050"
                     /old_locus_tag="PPUBIRD1_0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255905.1"
                     /db_xref="GI:489348800"
                     /translation="MIGELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWH
                     RALFNVALYAVLLGAVDHFCRNLMLP"
     gene            255971..256846
                     /locus_tag="PPUBIRD1_RS01055"
                     /old_locus_tag="PPUBIRD1_0207"
     CDS             255971..256846
                     /locus_tag="PPUBIRD1_RS01055"
                     /old_locus_tag="PPUBIRD1_0207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019471695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_010951565.1"
                     /db_xref="GI:499254025"
                     /translation="MKKPLLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIR
                     ADVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFTLALRQAKATLGERQETLA
                     QASREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPV
                     DGYLNDRAPRNHEFVTAGRPVLSVVDSASYHVDGYFEETKLGGIHIGDAVDIRVMGDN
                     TRLRGHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMI
                     AGRTATVSIIEGQRP"
     gene            256843..258261
                     /locus_tag="PPUBIRD1_RS01060"
                     /old_locus_tag="PPUBIRD1_0208"
     CDS             256843..258261
                     /locus_tag="PPUBIRD1_RS01060"
                     /old_locus_tag="PPUBIRD1_0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_010951566.1"
                     /db_xref="GI:499254026"
                     /translation="MKQLILAGLCLSLGACMMVGPDYEVPGDAAVQRNDLNGPLRQDA
                     DSVVSAPVPEDWWQLYQDQRLNELVRQALSANTELRVAAANIAKARAQVEVAESQGGF
                     NGGVKLGAQRLQESGEAFLQPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANAD
                     AVQAAADTARITLVADVVKAYTQVCSANEEYHIARESLDLQEQSVKLNQRLRDAGRGD
                     ETQVTRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQ
                     LVPVGDGAALLKRRPDVRQAERQLAAATAYIGVATGALYPDISIGAQVGTIGILENLG
                     EPSTNRWGFGPQISWSIPTNGTRARIRMAEASTQAALAHFDGVVLNAIRETQTRLAQY
                     SALLDRRDALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRTYTDMRAQLAAANSQ
                     VAQGQIAVFLALGGGWKGTAKP"
     gene            258372..260315
                     /locus_tag="PPUBIRD1_RS01065"
                     /old_locus_tag="PPUBIRD1_0209"
     CDS             258372..260315
                     /locus_tag="PPUBIRD1_RS01065"
                     /old_locus_tag="PPUBIRD1_0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_014589294.1"
                     /db_xref="GI:504402192"
                     /translation="MFSFAFPSRLAMKTRSRLLAWLPAALLGPVLALCSTLALAESPA
                     NAAKAQHLLDYIGADYPPTVQDGKVIDEGEYREQQEFSAVLADLVKGLPANTEQAALE
                     QGVQALRQAIDQRQEGTAVAKQARQLGARLAVAYEVSQAPVITPDPARGAALYAQNCS
                     ICHGDTGAGDGPAGVGLEPAPANLRDVSRLDQLSLFDLYNTLALGIDGTEMPSFADQL
                     DDRQRWDVAAYIASFTAKPEAGKGDKTWNLADLARQTPAEVAVNEGTAAVEAFRAQRA
                     QPPQVKRGPAQLLEYTASTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNID
                     TQARKDTEKSLMAYRQSLQDGLPEAQAEQRLADAKTKLEQAAKLLGSDGLSWTLSYIS
                     GLLILLREGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWALAAYVID
                     VGGAQRELLEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYIKSSLVSGGGRFGFAVLA
                     FFSVYRELFEVILFYETLWLQAGPAGHQAVLAGGATALVLLVGLAWVILRGSAKLPLS
                     LFFSINAALLCALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAV
                     ALLAIVFLYGRSWLAEKRSAAVN"
     gene            complement(260378..260623)
                     /locus_tag="PPUBIRD1_RS01070"
                     /old_locus_tag="PPUBIRD1_0210"
     CDS             complement(260378..260623)
                     /locus_tag="PPUBIRD1_RS01070"
                     /old_locus_tag="PPUBIRD1_0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_003255900.1"
                     /db_xref="GI:489348795"
                     /translation="MPFTPDLIDEMEVLALFKHDSSQEGIKITSTASPALIAAAQRLH
                     EKGLTDQPDGGYLTSLGHDAVESVQLLQNILKAPQPA"
     gene            complement(260693..260995)
                     /locus_tag="PPUBIRD1_RS01075"
                     /old_locus_tag="PPUBIRD1_0211"
     CDS             complement(260693..260995)
                     /locus_tag="PPUBIRD1_RS01075"
                     /old_locus_tag="PPUBIRD1_0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951568.1"
                     /db_xref="GI:499254028"
                     /translation="MSEPTDIDNDDDEAFAEATLTQAIENQIESGEPPAAKATFNKLT
                     LVGYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGDDE"
     gene            261144..261806
                     /locus_tag="PPUBIRD1_RS01080"
                     /old_locus_tag="PPUBIRD1_0212"
     CDS             261144..261806
                     /locus_tag="PPUBIRD1_RS01080"
                     /old_locus_tag="PPUBIRD1_0212"
                     /EC_number="2.5.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009682192.1"
                     /note="glutathione S-transferase family protein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_014589295.1"
                     /db_xref="GI:504402193"
                     /translation="MLKLYGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALEVS
                     PRGKVPVLETEHGFLSETSVILDYIEQTQGGKALLPADPFGQAKVRELLKEIELYIEL
                     PARTCYAESFFGMSVDPLIKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCF
                     SVDLANAVGKKVLDIDFLVDFPQAKALLQLMGENPHMPRILADKEASMPAFMEMIRSG
                     KR"
     gene            complement(261931..263325)
                     /locus_tag="PPUBIRD1_RS01085"
                     /old_locus_tag="PPUBIRD1_0213"
     CDS             complement(261931..263325)
                     /locus_tag="PPUBIRD1_RS01085"
                     /old_locus_tag="PPUBIRD1_0213"
                     /EC_number="4.3.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951570.1"
                     /note="Argininosuccinate lyase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate lyase"
                     /protein_id="WP_014589296.1"
                     /db_xref="GI:504402194"
                     /translation="MSTEKTNQSWGGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSI
                     AHATMLAQVGVLSDAERDTIIDGLKTIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIG
                     ITGKKLHTGRSRNDQVATDIRLWLRDEIDLILAEITRLQQGLLEQAEREAETIMPGFT
                     HLQTAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIDRELTC
                     KLLGFEAVAGNSLDGVSDRDFAIEFCAAASVAMMHLSRFSEELVLWTSAQFQFIDLPD
                     RFCTGSSIMPQKKNPDVPELVRGKSGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLF
                     DAADTLRDSLRAFADMIPAIKPKHAIMREAALRGFSTATDLADYLVRRGLPFRDCHEI
                     VGHAVKYGVDTGKDLAEMSLDELRQFSDQIEQDVFAVLTLEGSVNARDHIGGTAPAQV
                     RAAVVRGKALLASR"
     gene            263623..264366
                     /locus_tag="PPUBIRD1_RS01090"
                     /old_locus_tag="PPUBIRD1_0215"
     CDS             263623..264366
                     /locus_tag="PPUBIRD1_RS01090"
                     /old_locus_tag="PPUBIRD1_0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_010951571.1"
                     /db_xref="GI:499254031"
                     /translation="MNVLIVDDEPQGRERLTRLLGELEGYTVLEPSATNGDEALALIE
                     SLKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCSGDDEYGAEAFKDSTLSHVTK
                     PFQAHALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPLPQVIYF
                     IADHKYVTLRHEAGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHF
                     QLYLKGLDGDALTVSRRHVAGVRKMMQTL"
     gene            264486..265427
                     /locus_tag="PPUBIRD1_RS01095"
                     /old_locus_tag="PPUBIRD1_0216"
     CDS             264486..265427
                     /locus_tag="PPUBIRD1_RS01095"
                     /old_locus_tag="PPUBIRD1_0216"
                     /EC_number="2.5.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008099463.1"
                     /note="Porphobilinogen deaminase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="WP_014589297.1"
                     /db_xref="GI:504402195"
                     /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHTGLQVTLVPMVSR
                     GDKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICERE
                     DPRDAFVSNTFDSLEALPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLD
                     AGEYDAIILAAAGLIRLGFEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAP
                     LHHVDTADRVMAERALNKRLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADA
                     RAPRAAAEALGVQVAEDLLGQGAEAILKEVYGEAGHP"
     gene            265424..266191
                     /locus_tag="PPUBIRD1_RS01100"
                     /old_locus_tag="PPUBIRD1_0217"
     CDS             265424..266191
                     /locus_tag="PPUBIRD1_RS01100"
                     /old_locus_tag="PPUBIRD1_0217"
                     /EC_number="4.2.1.75"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016714406.1"
                     /note="catalyzes the formation of uroporphyrinogen-III
                     from hydroxymethylbilane; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen-III synthase"
                     /protein_id="WP_014589298.1"
                     /db_xref="GI:504402196"
                     /translation="MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLEIEPITVQA
                     PQRLSLEGLHDFQAIIVVSKPAARLLLEHLAETSIQPPQRGWFTVGEATAGVLQGAGL
                     EVSFPPRGDDSEALLALPALRQALTELAPRVLIVRGVGGRELLAERLAEQGASVEYLE
                     LYRRCLPAYPAGTLMRRIEAERLNGLVVSSGQGFEHLQQMAGADWLRLAQLPLFVPSP
                     RVAEQAKAAGAQQVVDCRGASATALLAAVQRSAAPAS"
     gene            266237..267337
                     /locus_tag="PPUBIRD1_RS01105"
                     /old_locus_tag="PPUBIRD1_0218"
     CDS             266237..267337
                     /locus_tag="PPUBIRD1_RS01105"
                     /old_locus_tag="PPUBIRD1_0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="WP_003255892.1"
                     /db_xref="GI:489348787"
                     /translation="MSETVLSNNDQPSAQAPAEPVTTPPAKRSGSGLAALALLLGAAG
                     VAVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDR
                     RRLVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALV
                     EGADEILREQSDPGAFAAREQLARSLATLNSTQQPDRTGLFLKLAAQRELVQQLSAQS
                     PEFDSNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRL
                     ALSLTIEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLDSLNALADQPV
                     SVVTPDLSESLAAVQAYIQRRHLPAEAEGGKP"
     gene            267334..268572
                     /locus_tag="PPUBIRD1_RS01110"
                     /old_locus_tag="PPUBIRD1_0219"
     CDS             267334..268572
                     /locus_tag="PPUBIRD1_RS01110"
                     /old_locus_tag="PPUBIRD1_0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255891.1"
                     /note="HemY domain protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme biosynthesis protein HemY"
                     /protein_id="WP_014589299.1"
                     /db_xref="GI:504402197"
                     /translation="MKRVYLLAVLAIVVAAALGIAVAKHSGYVLISYGGFRYQSGLWA
                     ALAGILAVVLLLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRLAIEQGQLDLAEGRWA
                     SAQRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTH
                     AQLQMDRGENDGALETLLAMQERHPHNGQVLRLLQRLYVERGDWSALIRLLPDLRKGK
                     VLPAAELAALEQRAWGQNLSLATTRGEDALSARQSLERAWQQLTAAQRQEPQLVLAYA
                     EQLRQVGAQNEAEQVLRTALKRDYESHLARLYGLVRGDDPVRQLQTAEGWLKAHPQDA
                     SLLLTLGRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQE
                     GLGLLDERLLALPLPEGVRA"
     gene            268795..269301
                     /locus_tag="PPUBIRD1_RS01115"
                     /old_locus_tag="PPUBIRD1_0220"
     CDS             268795..269301
                     /locus_tag="PPUBIRD1_RS01115"
                     /old_locus_tag="PPUBIRD1_0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589300.1"
                     /note="Disulfide bond formation protein B 2; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_014589300.1"
                     /db_xref="GI:504402198"
                     /translation="MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRL
                     LLGGYALLCFAAVLQAPGTRGILRYARLALGCSLAGALLAARHVWLQGAEGVNEVCPV
                     PIGRVFEQSWGEAARQLLLGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAY
                     RFRTLARA"
     gene            269533..270003
                     /locus_tag="PPUBIRD1_RS01120"
                     /old_locus_tag="PPUBIRD1_0221"
     CDS             269533..270003
                     /locus_tag="PPUBIRD1_RS01120"
                     /old_locus_tag="PPUBIRD1_0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255887.1"
                     /note="anti-RNA polymerase sigma 70 factor; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589301.1"
                     /db_xref="GI:504402199"
                     /translation="MLDSCQNAQERWGGVHKLIDRWLEERQELVQAFRALRDVRPAFA
                     DKDTNGDFCALLVDYVSAWHFEVCEQLVSEAKAFGDEKALKLAEEINPRINDSTQIAL
                     AFNDHCAKGECKDTERFAEKLAKLGGLLHERFELEDCLIEVLHNAHKEEGAVQA"
     gene            complement(270012..270650)
                     /locus_tag="PPUBIRD1_RS01125"
                     /old_locus_tag="PPUBIRD1_0222"
     CDS             complement(270012..270650)
                     /locus_tag="PPUBIRD1_RS01125"
                     /old_locus_tag="PPUBIRD1_0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_041166816.1"
                     /db_xref="GI:752477540"
                     /translation="MPRNLVLGLCLMAPLALADNDDHDLAYSLGASLGERLRQEMPGL
                     QLDALVEGLKQSYQGQPLKLDKTRMQAVLQQLEAQEGDAATQKLQAAETRFMANERGR
                     YGVHELTEGVLYSELQAGTGAQPKAGGKVQVRYVGRLPDGSIFDQNQTPQWFNLDSVI
                     EGWQVALPKMHTGAKWRLVIPSAQAYGAEGAGDLIAPYTPLIFEIELLAVGD"
     gene            complement(270862..271224)
                     /locus_tag="PPUBIRD1_RS01130"
     CDS             complement(270862..271224)
                     /locus_tag="PPUBIRD1_RS01130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015637446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166817.1"
                     /db_xref="GI:752477541"
                     /translation="MIKGLACSFAYFTYTLSQLEAVLSIAFELLNVRASLSLTLLERL
                     EQFFKFTDGFLRLVLRLGFTCLGRVLQFQATVVQFFLRLATLLFQLRQQFFRISQRLR
                     AGLFQVFEQAARKLLEQV"
     gene            complement(<271434..271691)
                     /locus_tag="PPUBIRD1_RS01135"
     CDS             complement(<271434..271691)
                     /locus_tag="PPUBIRD1_RS01135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020424485.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167118.1"
                     /db_xref="GI:752477842"
                     /translation="MVAAAGVAGLASAGLAAGLAAVRAGALAAAGFAAGLAAGALAAG
                     LAAGLAAAVALAAGLAAAVALAAGFAAGLAAAVTLAAGLAAG"
     gene            complement(271743..272222)
                     /locus_tag="PPUBIRD1_RS01140"
                     /old_locus_tag="PPUBIRD1_0224"
     CDS             complement(271743..272222)
                     /locus_tag="PPUBIRD1_RS01140"
                     /old_locus_tag="PPUBIRD1_0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589304.1"
                     /db_xref="GI:504402202"
                     /translation="MHTDLWNYALALYARPGVEAACLELQALGGDVCLLLCATWLQAR
                     GVAVLGERAHALQELAEPWQRDVVTPLRSLRQQWRTPASADAQLAALREQVKGLELQA
                     EKALLERLQERSQQWPAGSHEPTDDWLARLAPDQALHHDALVQLRVAAAALQDAEGT"
     gene            272273..274183
                     /locus_tag="PPUBIRD1_RS01145"
                     /old_locus_tag="PPUBIRD1_0225"
     CDS             272273..274183
                     /locus_tag="PPUBIRD1_RS01145"
                     /old_locus_tag="PPUBIRD1_0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_041166818.1"
                     /db_xref="GI:752477542"
                     /translation="MIRLSNLTLQRGPQRLLEGAEMTLHAGHKAGLIGANGAGKSSLF
                     ALLRGELSPDAGDCQLPGDWRIAHMRQEVDTLDRLAVDYVLDGDVRLRKVQAELAAAE
                     QAHDGTALARLHSELESADGYTADARARKLLAGLGFTNDQMDRRVGDFSGGWRMRLNL
                     AQALMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLH
                     VEQRKLNLYKGGYTAFERTRAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQA
                     QSRIKALERMEELSAAHVDSPFDFVFRESQKISSPLLSLSEGRLGYGDKAILDKVKLQ
                     LTPGARIGLLGPNGAGKSTLIKNLAGELEPLSGRLVRGENLAVGYFAQHQLDSLDDKA
                     SPLLHLQRIAPAEREQTLRDFLGGFDFHGARCDEPVVNFSGGEKARLALALIAWERPN
                     LLLLDEPTNHLDLEMRLALTMALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVDTF
                     DGDLEDYSRWLVEYRQRSAPASTAPVNPDKTDKKAQRQAAAALRQQLAPHKKAADKLE
                     TELNQVHAQLAEIETALGDGGLYDAARKDELRDLLARQTRLKQREGELEEAWMEALET
                     LESMQAELEALS"
     gene            274183..274770
                     /locus_tag="PPUBIRD1_RS01150"
                     /old_locus_tag="PPUBIRD1_0226"
     CDS             274183..274770
                     /locus_tag="PPUBIRD1_RS01150"
                     /old_locus_tag="PPUBIRD1_0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589306.1"
                     /db_xref="GI:504402204"
                     /translation="MEELRSLLPGQWMDTFWLGLQILLILAAAFILQRIVARGLSRLG
                     QRYPLPPELLVPVRGGLRWLIMGSALLFVLERMGVSATVLWTALSGFVAVAAVAFFAM
                     WSVLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEVPEAGG
                     ALVQVPNSQFFQKSVRRWRGAEVQALHKDTAAEAD"
     gene            274969..275601
                     /locus_tag="PPUBIRD1_RS01155"
                     /old_locus_tag="PPUBIRD1_0227"
     CDS             274969..275601
                     /locus_tag="PPUBIRD1_RS01155"
                     /old_locus_tag="PPUBIRD1_0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine transporter RhtB"
                     /protein_id="WP_010951582.1"
                     /db_xref="GI:499254042"
                     /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNAL
                     GLQLGLIMQIAIIAAGVGAVLAASATAFQVIKWFGVGYLVYLAYKQWRALPMDMSDES
                     GVRPIGKPLSLVFRGFLVNISNPKALVFMLAVLPQFLNPHAPLLPQYVAITVTMVTVD
                     LLVMAGYTGLASHVLRMLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPV"
     gene            complement(275650..276402)
                     /locus_tag="PPUBIRD1_RS01160"
                     /old_locus_tag="PPUBIRD1_0228"
     CDS             complement(275650..276402)
                     /locus_tag="PPUBIRD1_RS01160"
                     /old_locus_tag="PPUBIRD1_0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589307.1"
                     /db_xref="GI:504402205"
                     /translation="MFMQFGFGAVLIVLAMLVLSAFRILREYERGVVFQLGRFWQVKG
                     PGLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQV
                     EDFLVATSQLAQTTLRAVLGKHELDELLAEREQLNLDIRQVLDAQTDAWGIKVANVEI
                     KHVDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLSKEPGAMQLRY
                     MQTLGMIAGDKSSTIVFPLPIDLLKGLVDKEK"
     gene            complement(276405..277751)
                     /locus_tag="PPUBIRD1_RS01165"
                     /old_locus_tag="PPUBIRD1_0229"
     CDS             complement(276405..277751)
                     /locus_tag="PPUBIRD1_RS01165"
                     /old_locus_tag="PPUBIRD1_0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_014589308.1"
                     /db_xref="GI:504402206"
                     /translation="MIARCWRLLLLLLLLGITPGGQAAPGAVWVLNIDDAIGPASADY
                     LVRSLSQAQAQGAQLVVIRMDTPGGLDSAMRQMIKAILASPVPVASYVAPSGARAASA
                     GTYILYASHVAAMAPGTNLGAATPVRIGGAPGTPSDDKAKGGDDETLARKQVNDAAAY
                     IRGLAQMRGRNADWAEQAVREAVSLSASEALRLNVIDQVADDLSDLLRKLDGKTLQVA
                     GQPRQLQTAGASVVEHLPDWRTRVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGG
                     VVGGICLLLALYALQLLPVSFAGVALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGA
                     LILIDTDAPGFGIPLALIGTLALLSALLIGGVLGMALKARQRALVSGDAGLVGSLVTV
                     TQVMASDPFCGVVLAQGEPWQARCATPLQTGQNVRVTARHGVMLEVSAAAPATQGE"
     gene            277850..278308
                     /locus_tag="PPUBIRD1_RS01170"
                     /old_locus_tag="PPUBIRD1_0230"
     CDS             277850..278308
                     /locus_tag="PPUBIRD1_RS01170"
                     /old_locus_tag="PPUBIRD1_0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019473110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="WP_003255874.1"
                     /db_xref="GI:489348769"
                     /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVA
                     KSVMLDDRHGNYIMAVLPANRHLDMTKVRMSGAWHLTRESGLPSLFNDCERGAVPALG
                     DAYQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
     gene            278370..278612
                     /locus_tag="PPUBIRD1_RS01175"
                     /old_locus_tag="PPUBIRD1_0231"
     CDS             278370..278612
                     /locus_tag="PPUBIRD1_RS01175"
                     /old_locus_tag="PPUBIRD1_0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012312217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589309.1"
                     /db_xref="GI:504402207"
                     /translation="MEAPIHPFADLFKQLGLPDDPTSIDQFITSHSPLKNEIKLVDAP
                     FWNDSQRAFLKDSIIEDSDWAVPFDQLNEALRRPRK"
     gene            278682..279320
                     /locus_tag="PPUBIRD1_RS01180"
                     /old_locus_tag="PPUBIRD1_0232"
     CDS             278682..279320
                     /locus_tag="PPUBIRD1_RS01180"
                     /old_locus_tag="PPUBIRD1_0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255871.1"
                     /db_xref="GI:489348766"
                     /translation="MKDPYAPGFWCSVTILGTLTASYFYGIRQTQQMNQAVHFLYAAA
                     AVTVAVALVALTWIAWQQLRLNKREVVQGRTLLTIWNTKVALRRVETVFDRYFWGSYW
                     HSGRTFEEVMGELRGTPLEQSLDALKRQCRVLDREIHDRHHHWLANARDLSSVAQAMA
                     RERYQLDLGEPTHSGHGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
     gene            complement(279327..279764)
                     /locus_tag="PPUBIRD1_RS01185"
                     /old_locus_tag="PPUBIRD1_0233"
     CDS             complement(279327..279764)
                     /locus_tag="PPUBIRD1_RS01185"
                     /old_locus_tag="PPUBIRD1_0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014589311.1"
                     /db_xref="GI:504402209"
                     /translation="MKNVEQILKTKSQHQTVYTIGPDDSVLDALKLLAEKNVGALPVV
                     EGGQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVEPKQKLDFCMNLMTDRH
                     LRHLPVVDNGRLLGLLSIGDLVKETIDEQASLIKQMEQYIRGE"
     gene            complement(279934..281664)
                     /locus_tag="PPUBIRD1_RS01190"
                     /old_locus_tag="PPUBIRD1_0234"
     CDS             complement(279934..281664)
                     /locus_tag="PPUBIRD1_RS01190"
                     /old_locus_tag="PPUBIRD1_0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptidase"
                     /protein_id="WP_014589312.1"
                     /db_xref="GI:504402210"
                     /translation="MQLKKLTATTLLLASIGLFTQPAQANLTQQQSAAIVKAFDGSDP
                     SDFKQFLGKLKGSDLGKANNLEATVDAYLANKPLAAGQQDEINRLLGLYTRIKYGKAA
                     TETLRELVAIPTFNVEGTPQYENPEFLKIADKIKALADRFGLAFRNIDNRVYEISLGS
                     GKEVIGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGIVVAMY
                     ALKVAKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPDYNLALDGGYPVVIAEK
                     GYGTVMASFTKRPASGKGAEIVNLTGGLATNQIPTTSVATLISDNPAQLTKHLQQAGA
                     KYVKQHGSDFSIDAKADGKQVLLTVTGVSAHSSEPESGINPVARMLDFINGLGQQVPL
                     KHNHFTDAARYAADNWGLDYLGNKLGVAFKDPFMGPLTTSLTFVGVDDKGLKLAVNLR
                     IPKGKPIATIKDELADKLGKWTRQSNTSVAFDYSLDEPMYRNPEGEWVKALLAVATEN
                     LGMKHEFGTSAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVEQFMLDLQVVSEM
                     VARIGQMPKL"
     gene            complement(281827..281903)
                     /locus_tag="PPUBIRD1_RS01195"
                     /old_locus_tag="PPUBIRD1_t0064"
     tRNA            complement(281827..281903)
                     /locus_tag="PPUBIRD1_RS01195"
                     /old_locus_tag="PPUBIRD1_t0064"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(281867..281869),aa:Arg,seq:ccg)
     gene            282379..283821
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_RS01200"
                     /old_locus_tag="PPUBIRD1_0236"
     CDS             282379..283821
                     /gene="gabD"
                     /locus_tag="PPUBIRD1_RS01200"
                     /old_locus_tag="PPUBIRD1_0236"
                     /EC_number="1.2.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484375.1"
                     /note="catalyzes the formation of succinate from succinate
                     semialdehyde; NADP dependent; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="WP_003255867.1"
                     /db_xref="GI:489348762"
                     /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPK
                     MGTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPL
                     AEAKGEIAYAASFIEWFAEEAKRIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPA
                     AMITRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGG
                     ELTGNSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFIVFDDADLDKAVEG
                     AIISKYRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEEGTTTGPLIDG
                     KAVAKVQEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPL
                     FRFKDEAEVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPF
                     GGIKASGLGREGSKYGIEDYLEIKYLCISV"
     gene            284004..285281
                     /locus_tag="PPUBIRD1_RS01205"
                     /old_locus_tag="PPUBIRD1_0237"
     CDS             284004..285281
                     /locus_tag="PPUBIRD1_RS01205"
                     /old_locus_tag="PPUBIRD1_0237"
                     /EC_number="2.6.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255866.1"
                     /note="catalyzes the formation of succinate semialdehyde
                     and glutamate from 4-aminobutanoate and 2-oxoglutarate;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-aminovalerate aminotransferase DavT"
                     /protein_id="WP_003255866.1"
                     /db_xref="GI:489348761"
                     /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGREL
                     IDFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDF
                     DKKTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGM
                     GLMPGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPA
                     PKELMKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFP
                     LAGVCGKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTA
                     GLREIQKKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGT
                     YGNVLRILVPLTAEDALLDKGLAIIEECFAEIA"
     gene            285419..286678
                     /locus_tag="PPUBIRD1_RS01210"
                     /old_locus_tag="PPUBIRD1_0238"
     CDS             285419..286678
                     /locus_tag="PPUBIRD1_RS01210"
                     /old_locus_tag="PPUBIRD1_0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hisitidine kinase"
                     /protein_id="WP_014589314.1"
                     /db_xref="GI:504402212"
                     /translation="MSAAAPTPPSVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGS
                     QALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGVPFILMSNRNDSASVREALPL
                     HPTAYLSKPLNLDNLRKRLQELLLAVGEEIACPIPALQAGASLPAYLEQRRATADGGP
                     LLADVQVAINRALNPQGLNLRVLEEEVRNDPQVTAVLIAAANSAALHRDAPVQTLLQA
                     LNKLGSTQSMNLILGMTLKRSARLSDPLLAEHATRYWDLSLHTAEYGRTLARMLELDE
                     GRCYCAGLLHCLGDLAVLRCLQEWRLAGGDLDERNVQQSLEEFGAAFGSALRTRWRLP
                     LALRELIAAIYQLGGGVYSREILAMNLAGQLSRLPAEQGLEKVASGKTARLLKLGLPE
                     LRRLRKVENPEVKPQEDPPVAGAEVSS"
     gene            complement(286769..287797)
                     /locus_tag="PPUBIRD1_RS01215"
                     /old_locus_tag="PPUBIRD1_0239"
     CDS             complement(286769..287797)
                     /locus_tag="PPUBIRD1_RS01215"
                     /old_locus_tag="PPUBIRD1_0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019473676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589315.1"
                     /db_xref="GI:504402213"
                     /translation="MLAARFHVETCSVHMAKNIPTIFPGTPPPEAAQTLLALLHAQGE
                     VARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWR
                     DSIYPDDLEFAERSLAQVLLKGAVEDREYRILNADGQLRWLSDKCYINQQHDGDRVII
                     VGIAEDITEKKQLEGELQRLATTDVLTQSSNRRHFFECAQQAFDSARADGTPLAFLLL
                     DIDDFKRINDSYGHQEGDQVLQHIADSGKAVLRRGDLFGRIGGEEFAAVFPGCNAQVA
                     EQIAERLQRQIQHLSFSHGQQTYGVTVSQGLTGLTDEDVALDSLYARADAAMYQAKRQ
                     GKNQIVRG"
     gene            complement(287897..289081)
                     /locus_tag="PPUBIRD1_RS01220"
                     /old_locus_tag="PPUBIRD1_0240"
     CDS             complement(287897..289081)
                     /locus_tag="PPUBIRD1_RS01220"
                     /old_locus_tag="PPUBIRD1_0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019473677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_014589316.1"
                     /db_xref="GI:504402214"
                     /translation="MWYNGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALEL
                     NGALKHFFRFWLWLTTAQNTREWTAVHRKHHAKCETPDDPHSPVYKGLGTVLRKGAEL
                     YREEARNPETLRIYGKNCPDDWIERNLYSRYKLGGIALMAVIDLLLFGTLGITIWAVQ
                     MMWIPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIVIGGEELHNNHHTYPNSAKL
                     SVKRWEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKASLDMDTAMAILNNRFQIMA
                     QYRKLVIGPLVKQELARVDASVRHRFRRAKRLLSRETSLLEDRHHVRIESMLAHSQAL
                     KTIYEKRLALQQIWARTSANGHDMLAAMKDWVHEAETSGIQALRDFAAQLKTYSLRPT
                     GA"
     gene            289228..291123
                     /locus_tag="PPUBIRD1_RS01225"
                     /old_locus_tag="PPUBIRD1_0241"
     CDS             289228..291123
                     /locus_tag="PPUBIRD1_RS01225"
                     /old_locus_tag="PPUBIRD1_0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589317.1"
                     /db_xref="GI:504402215"
                     /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHSMTDDPLALTVGR
                     QINVVVWVLLSALLIYVSRVRLLNFIGHGARLRCEDRERLRMAAAVFDSTLEGVLVTD
                     RQGLIVHVNRAFMRITGYQQDEVIGQRPSKFKSGHHGLAFYQEVFATLAEKGEWSGEI
                     WNRRKSGEIYPQWQTICAIRDDEGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGL
                     PNRLLFTDRVEQALAAAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLG
                     EVLGNGVTLARLGGDEFGVLVENCQQVGQAGKLAQCIIERMREPFQFEGNRLFISASV
                     GISLYPSDALGAEQLLRNADSALYKAKSNGRACYALYTEELTAHAQHRVETAAELRRA
                     LEQDELRVYFQPVHDLASGRQVGVETLVRWQHPRRGLVPPGEFIPIAERTGLIAEIDT
                     WVLQQACRQMVQWQAQGRQLTFVGVNISSRLFGQHELYRQVAEVLHDTGLAPALLELE
                     VTESAVMEDPEVALEQLHRLRELGVTLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVA
                     GLPVDEDDIAIVRVIIALARSMGMQVHAEGIEQAEQASFLLQEECQLGQGYWFGRPVP
                     AEDLRWD"
     gene            complement(291151..291795)
                     /locus_tag="PPUBIRD1_RS01230"
                     /old_locus_tag="PPUBIRD1_0242"
     CDS             complement(291151..291795)
                     /locus_tag="PPUBIRD1_RS01230"
                     /old_locus_tag="PPUBIRD1_0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal ABC transporter permease"
                     /protein_id="WP_014589318.1"
                     /db_xref="GI:504402216"
                     /translation="MWIDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIF
                     EARLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFA
                     RIAEVSLREVDHGLVEAAQAMGCRRRHIIWHVLLPEALPGIVGGFTITLVTLINSSAM
                     AGAIGAGGLGDIAYRYGYQRFDSQIMLTVIAMLVALVALIQLGGDRLAKGLNKR"
     gene            complement(291785..292894)
                     /locus_tag="PPUBIRD1_RS01235"
                     /old_locus_tag="PPUBIRD1_0243"
     CDS             complement(291785..292894)
                     /locus_tag="PPUBIRD1_RS01235"
                     /old_locus_tag="PPUBIRD1_0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589319.1"
                     /note="Methionine import ATP-binding protein metN2;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_014589319.1"
                     /db_xref="GI:504402217"
                     /translation="MSQANALRAPTPQALPPLAREQALRPEVNEAHVRFIGLGKTYPG
                     QAQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEKPSQGRVLIDQVDIALFD
                     EDHLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVPKAERQRKVRELLELVGLQ
                     EKHHVYPAQLSGGQKQRVGIARALVHSPEILLCDEATSALDPETTASILELLRDINQR
                     LGLTIVLITHEMAVIRDICHRVVVLERGAVVEQGEVWRVFGSPRHEVTRTLLAHLQAK
                     LPAALQASLQARPASGNSAVVLKLTVLGEPELSALFNDLGGRVRLLQGGVETIGEHAL
                     GQLILSVQHSPHDTHQLLERARRWAEDVEVLGHVD"
     gene            complement(292896..293696)
                     /locus_tag="PPUBIRD1_RS01240"
                     /old_locus_tag="PPUBIRD1_0244"
     CDS             complement(292896..293696)
                     /locus_tag="PPUBIRD1_RS01240"
                     /old_locus_tag="PPUBIRD1_0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589320.1"
                     /db_xref="GI:504402218"
                     /translation="MLEKLFRPVAAIAITLGLCAGALAAEPLKIGTTSAFAIPLEAAV
                     EEAHKRGLEVKLIEFSDWIAPNVSLNSGDIDANYFQHIPFLENAKAAAGFNLVPYAPG
                     IINNVGLYSKKYKSFAELPEGASVAIANDPINSGRGLLLLAKAGLITLKPGVGYKATE
                     DDIVANPKKLKILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKE
                     YVIQFVIRPQSKDDPRLAKFVDIYQHSPAVRAALNKAHGKLYQAGWEG"
     gene            complement(293689..295074)
                     /locus_tag="PPUBIRD1_RS01245"
                     /old_locus_tag="PPUBIRD1_0245"
     CDS             complement(293689..295074)
                     /locus_tag="PPUBIRD1_RS01245"
                     /old_locus_tag="PPUBIRD1_0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951604.1"
                     /note="Dibenzothiophene desulfurization enzyme A; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5,N10-methylene tetrahydromethanopterin
                     reductase"
                     /protein_id="WP_014589321.1"
                     /db_xref="GI:504402219"
                     /translation="MAKQILLNAFNMNCIGHINHGLWTHPRDTSTQYKTLDYWTNLAR
                     LLERGLFDGLFIADIVGTYDIYGQSLDVTLKESIQLPVNDPLLLVSAMAAVTRHLGFG
                     LTANLTYEAPYLFARRLSTLDHLSNGRVGWNIVTGYLDSAARAMGLAQQPEHDRRYDQ
                     ADEYLQVLYKLLEGSWADDAVVADREHRVYASPDKVRKVQHQGEFYKVEGYHLCEPSP
                     QRTPVLFQAGSSQRGLAFAGNHAECVFISGQDKAATRAQVDKVRAATQAAGRDPQAVK
                     VFMGITVIVAATEQLAQAKHAEYLRHASAEAGVAHFAASTGIDFAAYELDQPIAFSQG
                     NAIQSATRQLQDNAWTRRRLLQQHALGGRYVTLVGAPEQVAEQLIAWIDETGLDGFNL
                     TRTVTPESFEDFIELVIPQLQQRGRYKTAYTEGTLREKLFQADRPHLPADHPGSAYRF
                     TPAPTGALHHA"
     gene            complement(295074..296255)
                     /locus_tag="PPUBIRD1_RS01250"
                     /old_locus_tag="PPUBIRD1_0246"
     CDS             complement(295074..296255)
                     /locus_tag="PPUBIRD1_RS01250"
                     /old_locus_tag="PPUBIRD1_0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576379.1"
                     /note="Dibenzothiophene desulfurization enzyme C; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014589322.1"
                     /db_xref="GI:504402220"
                     /translation="MTIAIITSDAQALAVAEDIAQQLRRDSALRDRERRLPLAELELF
                     TRSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSP
                     EQQQRLYAEVLAGRRFGNALAELGTKTAHERTTRLSRDGDGFRINGRKFYSTGAIYAQ
                     RIPTSVVDEQGIQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVP
                     FQSVFERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPL
                     TLKSFGHLAVRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLT
                     AGTTLFELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAVGNYYLNDANPPRRGT
                     I"
     gene            complement(296398..297639)
                     /locus_tag="PPUBIRD1_RS01255"
                     /old_locus_tag="PPUBIRD1_0247"
     CDS             complement(296398..297639)
                     /locus_tag="PPUBIRD1_RS01255"
                     /old_locus_tag="PPUBIRD1_0247"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014861473.1"
                     /note="Dibenzothiophene desulfurization enzyme C; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_014589323.1"
                     /db_xref="GI:504402221"
                     /translation="MPSQANTQFHSDLDSSPPLLPAKVLRNDAEALQAARELAKVARE
                     QAARRDQQRKLPWAEIELFTRSGLGSISVPKAYGGPDVSFATVAEVFRLISAADPALG
                     QIPQNQFGMLQLLRLTASEAQQALIFRSVLDGWRIGNAGPERGTRDTLTLKARITRAG
                     DSYRISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGSPGLRIVDDWSGFGQRTT
                     ASGTVLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVR
                     EKSRPWIEANVERASDDPYVIADIGRLKLELHAAEALLRKAARVLDEVNAAPIDADAA
                     ARASIAVAEAKVLTTEIALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRW
                     KYHAVGAYHLNGTLPARHSWI"
     gene            complement(297953..298711)
                     /locus_tag="PPUBIRD1_RS01260"
                     /old_locus_tag="PPUBIRD1_0249"
     CDS             complement(297953..298711)
                     /locus_tag="PPUBIRD1_RS01260"
                     /old_locus_tag="PPUBIRD1_0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019096908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_003255850.1"
                     /db_xref="GI:489348745"
                     /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFL
                     RCLNLLETPDAGQIQIGAISIDANRPLGGQQGAIRRLRQQAGFVFQNFNLFPHRTALE
                     NVIEGPVIVKKTPREQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAME
                     PEVILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKG
                     VIVEQGEAKALFAAPKEERTRQFLRKFLGTAASE"
     gene            complement(298714..299382)
                     /locus_tag="PPUBIRD1_RS01265"
                     /old_locus_tag="PPUBIRD1_0250"
     CDS             complement(298714..299382)
                     /locus_tag="PPUBIRD1_RS01265"
                     /old_locus_tag="PPUBIRD1_0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016714445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_003255849.1"
                     /db_xref="GI:489348744"
                     /translation="MIAESLQLVVDSAPFLLKGAGYTVLLSVGGMFFGLVLGFALALM
                     RLSKILPLNWLARVYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAA
                     YICEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKD
                     TALAATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQH
                     DQEH"
     gene            complement(299379..300173)
                     /locus_tag="PPUBIRD1_RS01270"
                     /old_locus_tag="PPUBIRD1_0251"
     CDS             complement(299379..300173)
                     /locus_tag="PPUBIRD1_RS01270"
                     /old_locus_tag="PPUBIRD1_0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003257420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystine transporter subunit"
                     /protein_id="WP_014589324.1"
                     /db_xref="GI:504402222"
                     /translation="MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGL
                     EGTYPPFSFQDENGKLTGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVV
                     NQVTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYE
                     QWVKKDVPQADVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTQLAGDAFS
                     RLESGVAMRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
     gene            300483..301415
                     /locus_tag="PPUBIRD1_RS01275"
                     /old_locus_tag="PPUBIRD1_0252"
     CDS             300483..301415
                     /locus_tag="PPUBIRD1_RS01275"
                     /old_locus_tag="PPUBIRD1_0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine O-acetyltransferase"
                     /protein_id="WP_003255846.1"
                     /db_xref="GI:489348741"
                     /translation="MSEQPSSAHWQLQSIVTGLRGAREQWRTRNGRSIGEQGGRELPS
                     REAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLAQARLELRYAAR
                     QSKAELAGVDARALSLIQGFAAALPELRVLLDTDVLAAYHGDPAARSVDEVLLCYPGI
                     LAIIHHRLAHHLYKAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGE
                     TAIIGERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIG
                     KGSTIGGNVWLTRSVPAESNITQANLQLDCQDKN"
     gene            301686..303688
                     /locus_tag="PPUBIRD1_RS01280"
                     /old_locus_tag="PPUBIRD1_0254"
                     /note="choline transporter; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(303813..304646)
                     /locus_tag="PPUBIRD1_RS01285"
                     /old_locus_tag="PPUBIRD1_0256"
     CDS             complement(303813..304646)
                     /locus_tag="PPUBIRD1_RS01285"
                     /old_locus_tag="PPUBIRD1_0256"
                     /EC_number="1.14.11.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine dioxygenase"
                     /protein_id="WP_014589327.1"
                     /db_xref="GI:504402225"
                     /translation="MSLTITPLSPALGAQISGVDLSRDISAEERDAIEQALLQHQVLF
                     LRDQPINPEQQARFAARFGDLHIHPIYPNVPDTPQVLVLDTAVTDVRDNAVWHTDVTF
                     LPTPALGAVLSAKQLPAYGGDTLWASGIAAFEALSAPLREMLDGLTATHDFTKSFPLE
                     RFGTTPQDLARWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRINELSELESDA
                     LLRLLFAHATRPEFSIRWRWQEHDVAFWDNRVTQHFAVDDYRPNRRVMHRATILGDAP
                     F"
     gene            complement(304695..305534)
                     /locus_tag="PPUBIRD1_RS01290"
                     /old_locus_tag="PPUBIRD1_0257"
     CDS             complement(304695..305534)
                     /locus_tag="PPUBIRD1_RS01290"
                     /old_locus_tag="PPUBIRD1_0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750186.1"
                     /note="Taurine transport system permease protein; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter permease"
                     /protein_id="WP_014589328.1"
                     /db_xref="GI:504402226"
                     /translation="MSSLDLPVAGKHDAQTRPAATLRRPLSTRWISTLTLASLLLVWW
                     LVTAAGWVEPLFLPSPGDILSKAWTLLTQGYMDASLWQHLGASLGRIGLALVAATLTA
                     IPVGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAP
                     IAIATATGVRTVDPAKLRAAQSLGATKAQLIRHVILPSALPDILTGIRIGLGVGWSTL
                     VAAELIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHG
                     QIH"
     gene            complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_RS01295"
                     /old_locus_tag="PPUBIRD1_0258"
     CDS             complement(305531..306319)
                     /gene="tauB"
                     /locus_tag="PPUBIRD1_RS01295"
                     /old_locus_tag="PPUBIRD1_0258"
                     /EC_number="3.6.3.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88RA1.1"
                     /note="Taurine import ATP-binding protein tauB; Part of
                     the ABC transporter complex tauABC involved in taurine
                     import; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine import ATP-binding protein TauB"
                     /protein_id="WP_014589329.1"
                     /db_xref="GI:504402227"
                     /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGK
                     TSLLNLIAGFVAPSGGHITLDGVPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELA
                     GVPRAQREAKAREMLTLVDLNGFGERRIWQLSGGQKQRVGLARALAADPRLLLMDEPF
                     GALDAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQ
                     LNFGQRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQERA"
     gene            complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_RS01300"
                     /old_locus_tag="PPUBIRD1_0259"
     CDS             complement(306333..307304)
                     /gene="tauA"
                     /locus_tag="PPUBIRD1_RS01300"
                     /old_locus_tag="PPUBIRD1_0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497544.1"
                     /note="with TauB and TauC is responsible for taurine
                     uptake; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="taurine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003255840.1"
                     /db_xref="GI:489348735"
                     /translation="MIPHAPLRLFAALTLASTSWLAQAADLTVAYQTTVDPAKVAQVD
                     GDYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIAT
                     QIGAGEALVARDSIKSPQDLIGKKVAVPFVSTGHYSLLAALKSWNIDPSKVQILNLAP
                     PAIIAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFAEK
                     HPDVVKAFAKVTLDAYADYRKDPKAWLADKGNVDKLVKLSGAKASDIPVLLEGNVYPL
                     AADQANALGAPTTQALTDTANFLKQQGKVEAVLPDYSPYVSAKFLPN"
     gene            307779..309119
                     /locus_tag="PPUBIRD1_RS01305"
                     /old_locus_tag="PPUBIRD1_0260"
     CDS             307779..309119
                     /locus_tag="PPUBIRD1_RS01305"
                     /old_locus_tag="PPUBIRD1_0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane porin"
                     /protein_id="WP_014589330.1"
                     /db_xref="GI:504402228"
                     /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNR
                     EDHAKPGAERPDQRESGQGFKLDYISGFTQGTVGFGVDAQALWGIHLDGGEGYHKSGF
                     FPDDGKGSAAQWARFGANAKARFSKTEAHFGSALAPNLPILVSNDGRLLPQTFEGGTI
                     QSKEIDNLTINAGQLTHAMGRASSNRTGLSVAGSNAESNKFRYGGLDYKLTPDLTLQY
                     YYSNLEDFYKQHFLGATHVFKIADDQSFKTDLRYFDSSSDGKNGNDSAYNFNNNGGYA
                     KNTGEIDNKTWSAMFTYTLGGHALMLGHQQVGDDGGFVWLNQGSLSNDSGTSEGAGGS
                     SFYLFTDSMINQFARAGENTTFGQYSYDFAALGVPGLKASVAYLRGDDIRNKSGSGTY
                     NEWERDARIDYTLQEGALKGLGFSLRQGVYRGAGESSSDQDQARFIVNYTYSFL"
     gene            309285..309923
                     /locus_tag="PPUBIRD1_RS01310"
                     /old_locus_tag="PPUBIRD1_0261"
     CDS             309285..309923
                     /locus_tag="PPUBIRD1_RS01310"
                     /old_locus_tag="PPUBIRD1_0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxidase"
                     /protein_id="WP_003255836.1"
                     /db_xref="GI:489348731"
                     /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPV
                     CTTELGLTAKLKDEFAKRGVKAIALSVDPVDSHHKWIDDINETQNTVVNFPIIADADR
                     KVSDLYDLIHPNASDTLTVRSLFIIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLT
                     DNHKVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
     gene            310143..310736
                     /locus_tag="PPUBIRD1_RS01315"
                     /old_locus_tag="PPUBIRD1_0262"
     CDS             310143..310736
                     /locus_tag="PPUBIRD1_RS01315"
                     /old_locus_tag="PPUBIRD1_0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FMN reductase (NADPH)"
                     /protein_id="WP_003255835.1"
                     /db_xref="GI:489348730"
                     /translation="MLVVSIGGSPSLRSRSGVLLERSRQWLQDRGVEVVTFQVRDFPA
                     EDLLHARFDSPHVQHFQQLVAQADGLIVSTPVYKASFSGALKTLLDLLPERALAHKIV
                     LPIATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVAYAEGTKPAQLVQALE
                     ERLHDSLETFHVALARRPRPVAPGVLNERLISARWSI"
     gene            310822..311787
                     /locus_tag="PPUBIRD1_RS01320"
                     /old_locus_tag="PPUBIRD1_0263"
     CDS             310822..311787
                     /locus_tag="PPUBIRD1_RS01320"
                     /old_locus_tag="PPUBIRD1_0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589331.1"
                     /note="ABC-type transporter periplasmic sulfonate-binding
                     protein; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014589331.1"
                     /db_xref="GI:504402229"
                     /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLL
                     KAKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLL
                     YVAYEPPAPHSEAILVPKGSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSD
                     IQPVYLPPADARAAFERGSVDAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLAT
                     RNYATQHPAVINTVIEEVRAVGEWSQANPQEVTDQVAPLLGLPADITLTSVKRQGYGA
                     APLTPDVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
     gene            311847..312995
                     /locus_tag="PPUBIRD1_RS01325"
                     /old_locus_tag="PPUBIRD1_0264"
     CDS             311847..312995
                     /locus_tag="PPUBIRD1_RS01325"
                     /old_locus_tag="PPUBIRD1_0264"
                     /EC_number="1.14.14.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008095165.1"
                     /note="Alkanesulfonate monooxygenase; catalyzes the
                     release of sulfite from alkanesulfonates; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkanesulfonate monooxygenase"
                     /protein_id="WP_014589332.1"
                     /db_xref="GI:504402230"
                     /translation="MSLNIFWFLPTHGDGKYLGTSEGARAVDHGYLQQIAQAADRLGF
                     GGVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGR
                     ALFNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGA
                     KLLYPPIQQPRPPLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVRKKAAAQ
                     GREVRFGIRLHVIVRETNEAAWAAAERLISHLDDDTISRAQASLARFDSVGQQRMAAL
                     HGGNRDNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGIDTFIFSGYPH
                     LEESYRVAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
     gene            313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_RS01330"
                     /old_locus_tag="PPUBIRD1_0265"
     CDS             313006..313803
                     /gene="ssuC"
                     /locus_tag="PPUBIRD1_RS01330"
                     /old_locus_tag="PPUBIRD1_0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268598.1"
                     /note="part of the ABC type transport system for
                     alkanesulfonate SsuABC; SsuB the ATP-binding subunit and
                     SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfonate ABC transporter"
                     /protein_id="WP_003255831.1"
                     /db_xref="GI:489348725"
                     /translation="MSRATSSNLTQRLAPWALPVLLLAIWQLAVSAGWLSTRILPAPS
                     AVVSAGVELVRSGEIWTHLAISGWRAGLGFVIGGSIGLVLGFITGLSNWGERLLDSSV
                     QMIRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMAR
                     SYGLSGFGLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNARE
                     FLQTDVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVARKEGA"
     gene            313800..314612
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_RS01335"
                     /old_locus_tag="PPUBIRD1_0266"
     CDS             313800..314612
                     /gene="ssuB"
                     /locus_tag="PPUBIRD1_RS01335"
                     /old_locus_tag="PPUBIRD1_0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191051.1"
                     /note="Aliphatic sulfonates import ATP-binding protein
                     ssuB; part of the ABC type transport system SsuABC for
                     aliphatic sulfonates; with SsuA being the periplasmic
                     substrate-binding subunit, SsuB the ATP-binding subunit
                     and SsuC the permease; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aliphatic sulfonates import ATP-binding protein
                     SsuB"
                     /protein_id="WP_014589333.1"
                     /db_xref="GI:504402231"
                     /translation="MTVLKEQPPRLLRGTPLASKGLRKTFGQREVLKGIDLHIPAGQF
                     VAIVGRSGCGKSTLLRLLAGLDQPSAGQLLAGAAPLEEAREETRLMFQDARLLPWKKV
                     IDNVGLGLSGDWRPRALEALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLL
                     LDEPLGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGL
                     DLTVDLARPRARGSHRLAALESEVLNRVLSTPGTAPEPDPVAPLPTQLRWAH"
     gene            314640..314855
                     /locus_tag="PPUBIRD1_RS01340"
                     /old_locus_tag="PPUBIRD1_0267"
     CDS             314640..314855
                     /locus_tag="PPUBIRD1_RS01340"
                     /old_locus_tag="PPUBIRD1_0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007163030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_003255829.1"
                     /db_xref="GI:489348723"
                     /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTR
                     SVRELELQVGSEVIAFVKSTEVSIAKL"
     gene            complement(314998..315630)
                     /locus_tag="PPUBIRD1_RS01345"
                     /old_locus_tag="PPUBIRD1_0268"
     CDS             complement(314998..315630)
                     /locus_tag="PPUBIRD1_RS01345"
                     /old_locus_tag="PPUBIRD1_0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_010951618.1"
                     /db_xref="GI:499254078"
                     /translation="MNRTTTPRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAE
                     RAQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPIDSSAFSTWHELSRLIEQRM
                     LDIYHEDAAARQLILAQHGLSEVVQADRQHDMELGDLMHKLFDQHFHLPVMPPDVDVF
                     ALAMELSDRVYARSVQLHEAITPRMAEEGKRVFEAYLGLYLPPFLAKRSS"
     gene            complement(315630..317222)
                     /locus_tag="PPUBIRD1_RS01350"
                     /old_locus_tag="PPUBIRD1_0269"
     CDS             complement(315630..317222)
                     /locus_tag="PPUBIRD1_RS01350"
                     /old_locus_tag="PPUBIRD1_0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--cysteine ligase"
                     /protein_id="WP_041166819.1"
                     /db_xref="GI:752477543"
                     /translation="MKEYILSELLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRL
                     AQTPHPEALGSALTNEQITTDYSESLLEFITPALADPAKVLESLEETHRFVYSKLGDE
                     YLWSPSMPCTLPAEEDIPIAEYGSSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSL
                     PEALWPLLREAEGSTENDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGR
                     PHQLEELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYP
                     PYVEIGTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVR
                     CLDINPFLPVGIDLTEARFLDAFLLFCALEDSPQLDNGECGQCTSNFLTVVKEGRRPG
                     LELHRNGQPISLKDWASELIERIRQLANLLDQAQGTDEHAKALDAQQAKVDDTSLTPS
                     AQVLARMTEHDESFVQFSLRQSRVHAETFREQPLSNEKQQAFETLARESLARQSELEQ
                     DEVGDFDLFVGAYQASILAISS"
     gene            complement(317361..317744)
                     /locus_tag="PPUBIRD1_RS01355"
                     /old_locus_tag="PPUBIRD1_0270"
     CDS             complement(317361..317744)
                     /locus_tag="PPUBIRD1_RS01355"
                     /old_locus_tag="PPUBIRD1_0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012949666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_010951620.1"
                     /db_xref="GI:499254080"
                     /translation="MDVPREYVESAFSQLLGCRLQHLDSGVAEVALALEPQLRNRGQK
                     LHGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRR
                     TLVVDADVVQGDKLVAKAQGTFAVL"
     gene            complement(317744..320068)
                     /locus_tag="PPUBIRD1_RS01360"
                     /old_locus_tag="PPUBIRD1_0271"
     CDS             complement(317744..320068)
                     /locus_tag="PPUBIRD1_RS01360"
                     /old_locus_tag="PPUBIRD1_0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_014589335.1"
                     /db_xref="GI:504402233"
                     /translation="MDSINSRIAEELGVRPQQVEAAVSLLDEGSTVPFIARYRKEVTG
                     SLDDTQLRHLEERLRYLRELDERRASILSSIEEQGKLTPELAREIKLADTKTRLEDLY
                     LPYKQKRRTKGQIALEAGLGELADGLFNDPTLAPESEAARFVNAEKGVADVKAALEGA
                     KYILMERFAEDAALLDKLRSYLKQEAVLSARVVAGKEEEGAKFRDYFAHDELLRTAPS
                     HRALAIFRGRNEGVLSVSLKVGEELPGTLHPCELMIGNHVGIENRSRPADKWLGEVVR
                     WTWKVKLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRT
                     GCKIAVVDATGKLLDHTTVYPHAPKNDWDRTISIMAALCAKHSVELIAIGNGTASRES
                     DKLVAELVKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQD
                     PLAELVKIDPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRIS
                     GLNATLAQNIVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAV
                     HPEAYPLVQRIAADTDRDIRSLIGDSSFLKRLDPKKFTDETFGLPTVTDILQELDKPG
                     RDPRPEFKTATFQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALS
                     EKFVKDPREAVKAGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVEGNRGGNRGNGGN
                     RQPQAPRQRETATAAPANNAMASLFANAKQLKKK"
     gene            320286..321026
                     /locus_tag="PPUBIRD1_RS01365"
                     /old_locus_tag="PPUBIRD1_0273"
     CDS             320286..321026
                     /locus_tag="PPUBIRD1_RS01365"
                     /old_locus_tag="PPUBIRD1_0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_012270052.1"
                     /db_xref="GI:501227034"
                     /translation="MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTE
                     QMDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLE
                     LGADDYLGKPFNPDELMARVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKR
                     GDEVHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMI
                     EPDPSKPRYIQTVWGVGYVFVPDGNAGK"
     gene            321040..322353
                     /locus_tag="PPUBIRD1_RS01370"
                     /old_locus_tag="PPUBIRD1_0274"
     CDS             321040..322353
                     /locus_tag="PPUBIRD1_RS01370"
                     /old_locus_tag="PPUBIRD1_0274"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255819.1"
                     /note="integral membrane sensor signal transduction
                     histidine kinase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014589336.1"
                     /db_xref="GI:504402234"
                     /translation="MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDR
                     QYSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAE
                     LGDDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLST
                     ASAWIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQA
                     GRERELMLAGVSHDLRTPLTRLRLSLSLLNSDNELSDDMVRDIEDMDAILDQFLAFIR
                     DGRDEPVEEVDLADLVREVVAPYNQPVERVRLCLEPIPPFPLRRVSLKRMLGNLIGNA
                     LHHAGKGVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGT
                     GLGLAIVKRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
     gene            complement(322451..323356)
                     /locus_tag="PPUBIRD1_RS01375"
                     /old_locus_tag="PPUBIRD1_0275"
     CDS             complement(322451..323356)
                     /locus_tag="PPUBIRD1_RS01375"
                     /old_locus_tag="PPUBIRD1_0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007161257.1"
                     /note="responsible for the addition of glutamate residues
                     to the C-terminus of ribosomal protein S6; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-L-glutamate ligase"
                     /protein_id="WP_003255817.1"
                     /db_xref="GI:489348711"
                     /translation="MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIASH
                     KPQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLR
                     SLQLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETPQAA
                     ESVIEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGG
                     VASLIKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGK
                     NVAGMIIEHLEKNGGPNQTRTKGKG"
     gene            complement(323353..323835)
                     /locus_tag="PPUBIRD1_RS01380"
                     /old_locus_tag="PPUBIRD1_0276"
     CDS             complement(323353..323835)
                     /locus_tag="PPUBIRD1_RS01380"
                     /old_locus_tag="PPUBIRD1_0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004576370.1"
                     /db_xref="GI:490713588"
                     /translation="MKTFDHLTVIGLREWVALPDLGVAGLRAKIDTGASTSSLHATEV
                     EPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSSNGHAQTRYVIRTSLALG
                     DGVWEVEFTLACRKNMRYRLLLGSKALIHGQLVVNPGLKYVQDKPAFPATLSPVTGAA
                     "
     gene            323945..324346
                     /locus_tag="PPUBIRD1_RS01385"
                     /old_locus_tag="PPUBIRD1_0277"
     CDS             323945..324346
                     /locus_tag="PPUBIRD1_RS01385"
                     /old_locus_tag="PPUBIRD1_0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755033.1"
                     /note="RNA-binding S4 domain protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein S4"
                     /protein_id="WP_014589337.1"
                     /db_xref="GI:504402235"
                     /translation="MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGER
                     CKPGKEPRVGDEFLLRTGFDERTVVVKALSVVRRGAPEAQALYEETEESVRRREQAAE
                     MRKAGAMGVTTDGRPTKKQRRQIHQLHGSYD"
     gene            complement(324374..325168)
                     /locus_tag="PPUBIRD1_RS01390"
                     /old_locus_tag="PPUBIRD1_0278"
     CDS             complement(324374..325168)
                     /locus_tag="PPUBIRD1_RS01390"
                     /old_locus_tag="PPUBIRD1_0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_014589338.1"
                     /db_xref="GI:504402236"
                     /translation="MDNRPLFQARWSWGPLAACTLLPIALLCFWIWPFGQILCLTFDE
                     WLFRSLNAPLADSTTWRYIWTIGSLRPFDIVVGLILLAVLIRGDWVFKATQVRQAFFG
                     FLVTLLLLVVIRALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEAAWELKDRSSK
                     SFPGDHASVLLIWALFMSVFSRGLAQYLVVWGLAALFMLPRLVAGAHWGQDDYIGGLL
                     MAVLALGWSYYTPLAAKGSEALMRWTAPLFKLLSTLPLVGRMAVLR"
     gene            325289..326188
                     /locus_tag="PPUBIRD1_RS01395"
                     /old_locus_tag="PPUBIRD1_0279"
     CDS             325289..326188
                     /locus_tag="PPUBIRD1_RS01395"
                     /old_locus_tag="PPUBIRD1_0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472835.1"
                     /note="33 kDa chaperonin; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hsp33 chaperonin"
                     /protein_id="WP_014589339.1"
                     /db_xref="GI:504402237"
                     /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPV
                     KVLLGELMAATALLVGAMKFDGLLILQARSAGPIPLLMVECSSEREIRGMARYEADQI
                     PAGATLSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWL
                     NAAGGKARGLLLQQLPRDRQPDDEEREDSWQHVVALAKTLKPEEWTEGNETLLHRLYH
                     EDAVRLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDECGGTVEIDCQFCNERYF
                     FDASDVAQLFAGGGTDVASETRH"
     gene            326368..327909
                     /locus_tag="PPUBIRD1_RS01400"
                     /old_locus_tag="PPUBIRD1_0280"
     CDS             326368..327909
                     /locus_tag="PPUBIRD1_RS01400"
                     /old_locus_tag="PPUBIRD1_0280"
                     /EC_number="4.1.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750189.1"
                     /note="Phosphoenolpyruvate carboxykinase [ATP]; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate carboxykinase"
                     /protein_id="WP_014589340.1"
                     /db_xref="GI:504402238"
                     /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTG
                     RSPADRFIVEEPSTQDAIAWGPINRKFPADKFDALWDRVEAFNNAQDHFVSYVHVGAA
                     AEHYLPVKMTTQTAWQNLFGRCLFINPEQYNPAGRGEWQVLNVANFVCEPERDGTNSD
                     GCVIINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLF
                     FGLSGTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAI
                     KHGAVLENVVLDANKHADYSDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCD
                     LTGVLPPVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGE
                     YAELLIKRINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEH
                     LDIINLDVPKAVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKA
                     AGPQL"
     gene            328191..328631
                     /locus_tag="PPUBIRD1_RS01405"
                     /old_locus_tag="PPUBIRD1_0281"
     CDS             328191..328631
                     /locus_tag="PPUBIRD1_RS01405"
                     /old_locus_tag="PPUBIRD1_0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014589341.1"
                     /db_xref="GI:504402239"
                     /translation="MTEALQRIAFSHFHPILTRPQDNDLNGHIAGATVHSFFETAIQA
                     FLVEQAELDLRHGELAAFVVSSAADFYALPGFPDLLEVGLGVTRLAGSTVEYRLALYR
                     PGEPEACAAGTVVQVFIERDSGRPVALPEALQVILSGLVLERQA"
     gene            complement(328688..329170)
                     /locus_tag="PPUBIRD1_RS01410"
                     /old_locus_tag="PPUBIRD1_0282"
     CDS             complement(328688..329170)
                     /locus_tag="PPUBIRD1_RS01410"
                     /old_locus_tag="PPUBIRD1_0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951626.1"
                     /db_xref="GI:499254086"
                     /translation="MKKYSSILLLSFSLLSGVAMAGGTTEAGIGGALGGVLGSVVGNS
                     IGGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIG
                     AAAGGGAGGALGNYLGKEADKDDYRDGRRYRRGYDDDRRHWDRGHHYGHRKHKRHWRD
                     "
     gene            complement(329367..331712)
                     /locus_tag="PPUBIRD1_RS01415"
                     /old_locus_tag="PPUBIRD1_0283"
     CDS             complement(329367..331712)
                     /locus_tag="PPUBIRD1_RS01415"
                     /old_locus_tag="PPUBIRD1_0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438881.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_019438881.1"
                     /db_xref="GI:518268673"
                     /translation="MTSYQQFPDNTPASPPRYKPYHGPAGGWGALRSVAKAWAGSDNA
                     LKNIRALLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDAAFFAR
                     YSVTSLLQQSDYWLEYQGRLTEPMVYDAPSDRYLPISWDAAFALIARELNKLANPDQA
                     EFYTSGRASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALGQSVGVGKGTVTFDD
                     FEHADAIFVWGQNPGTNHPRMLDPLRDAVKRGAQVVCINPLKERGLERFQHPQNPLEM
                     LTNSDRPTNTAFFRPALGGDMAMLRGMAKFVLQWEREAQANGEPAVFDHAFIAEHGHG
                     VDEYLAVVDATPWSHIQAQSGLSLADIELAARMYCRGKRVIMCWAMGITQHRHSVPTI
                     QEIVNLQMLRGNIGVPGAGLCPVRGHSNVQGDRTMGINERPPEALLDAIEKRFGFPVP
                     RRNGHNTVEAIHAMLDGRAKVFIGLGGNFAQATPDTERTAQALRNCELTVHISTKLNR
                     SHLVHGKQALILPCLGRTDIDLQAEGPQAVTVEDSFSMVHASNGQLKPLSTQMRSEPA
                     VIAGIAAATLGKQPVDWHWLVADYDRIRDLIGDTIAGFSGFNQRLRHPGGFYLGNSAA
                     SREWATSTGRANFKANLLPDTLLDERVRASGQLPDLIMQSMRSHDQYNTTIYGLDDRY
                     RGVRGQREVLFANEADIIRLGFQPGQKVDIVSLWGDEHVRRVQGFTLLAFDIPAGQAA
                     AYYPEVNPLVPLESIGVGSHTPTSKFIAIKLERASEDRRIL"
     gene            complement(331718..332548)
                     /locus_tag="PPUBIRD1_RS01420"
                     /old_locus_tag="PPUBIRD1_0284"
     CDS             complement(331718..332548)
                     /locus_tag="PPUBIRD1_RS01420"
                     /old_locus_tag="PPUBIRD1_0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_019438880.1"
                     /db_xref="GI:518268672"
                     /translation="MNSKPPVCAASSPLSMPAASNTYDYVQLSDAKRDSTPLAEEVAL
                     AIVYNGLNQAVMLVSPTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEIS
                     SRAFWNLKNQRRQLAGTSGCGLCGVEALEQALPDLAVLPGAPLPPAQWLVGLRERIDA
                     FQPLGQHCGAVHAALFMDRQGQLLLGREDIGRHNALDKLIGALLRQRIDTQGGLAIVT
                     SRCSLELIQKVLRAGIQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES
                     "
     gene            332724..333164
                     /locus_tag="PPUBIRD1_RS01425"
                     /old_locus_tag="PPUBIRD1_0285"
     CDS             332724..333164
                     /locus_tag="PPUBIRD1_RS01425"
                     /old_locus_tag="PPUBIRD1_0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_014589344.1"
                     /db_xref="GI:504402242"
                     /translation="MSLFSFVKEAGEKLIDLLTPGNANADEQLKKHVEAVGLGNPNIT
                     ATVEGDKIILKGEVASQEEKEKIILAAGNINGVACVDDQITVTGPVVKAARFVTVKKG
                     DTLSAISVVVYGNANQYNKIFEANKPMLSHPDKIYPGQVLRIPE"
     gene            complement(333276..333938)
                     /locus_tag="PPUBIRD1_RS01430"
                     /old_locus_tag="PPUBIRD1_0286"
     CDS             complement(333276..333938)
                     /locus_tag="PPUBIRD1_RS01430"
                     /old_locus_tag="PPUBIRD1_0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008098990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_003255795.1"
                     /db_xref="GI:489348689"
                     /translation="MPVLPWSAIDTVLLDMDGTLLDLHYDNRFWLDHLPQRYAELHGV
                     SRAMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKREIADLIALRPDADTFLA
                     AIRQAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQAD
                     IGFEPERSLFIDDTLAILRSARRFGVGHLLAVRQPDSKAGPRDTEEFAAVEDYRELLV
                     GL"
     gene            334003..334569
                     /locus_tag="PPUBIRD1_RS01435"
                     /old_locus_tag="PPUBIRD1_0287"
     CDS             334003..334569
                     /locus_tag="PPUBIRD1_RS01435"
                     /old_locus_tag="PPUBIRD1_0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-ribose diphosphatase"
                     /protein_id="WP_003255794.1"
                     /db_xref="GI:489348688"
                     /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGAERTYERLVGRGN
                     GYGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGF
                     GARQLEHLTELSLSPGYMSQKIQVVLASDLYEERLEGDEPEPMRVDKVNLRELSALAM
                     HPQFTEGRALAALYLARDLLIQRGLLEL"
     gene            334566..335384
                     /locus_tag="PPUBIRD1_RS01440"
                     /old_locus_tag="PPUBIRD1_0288"
     CDS             334566..335384
                     /locus_tag="PPUBIRD1_RS01440"
                     /old_locus_tag="PPUBIRD1_0288"
                     /EC_number="3.1.3.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438879.1"
                     /note="catalyzes the formation of AMP from
                     adenosine-3',5'-bisphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3'-5'-bisphosphate nucleotidase"
                     /protein_id="WP_014589345.1"
                     /db_xref="GI:504402243"
                     /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAAD
                     LAAHRVIADGLLALAPQIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEF
                     TVNIALIENGDVVFGVVSMPTNGRCYFGGRGMGAWRADAGEAPQLIQVRNAPAQGERF
                     TVVASRRHSSPEQEALLAGLGAAVGDLELANIGSSLKFCLLAEGSADCYPRLAPTSQW
                     DTAAAQGVVEGACGEVIGLDGLPFRYPPRESLLNPYFLALPANAAWRQAFLNLI"
     gene            complement(335545..336000)
                     /locus_tag="PPUBIRD1_RS01445"
                     /old_locus_tag="PPUBIRD1_0289"
     CDS             complement(335545..336000)
                     /locus_tag="PPUBIRD1_RS01445"
                     /old_locus_tag="PPUBIRD1_0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019474025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_014589346.1"
                     /db_xref="GI:504402244"
                     /translation="MSTDSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANV
                     NHKSTMFGGSLYCAAVLVGWGWLHLRLRELGINDGHIVIQEGQISYPLPVTGTAVARC
                     TAPDKKTWERFLAMYQRRGRARLPLETTVSNAGSDEPAVKFSGQYVLHR"
     gene            complement(336000..337406)
                     /locus_tag="PPUBIRD1_RS01450"
                     /old_locus_tag="PPUBIRD1_0290"
     CDS             complement(336000..337406)
                     /locus_tag="PPUBIRD1_RS01450"
                     /old_locus_tag="PPUBIRD1_0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_014589347.1"
                     /db_xref="GI:504402245"
                     /translation="MTTETLIDSRAQVILVDDDPHLRQALSQTLDLAGLKVVALAEAQ
                     GLAERIEADWPGVVVSDIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMR
                     AGAYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAML
                     RLREQIGALAGTRADVLILGETGAGKEVVARALHDLSSRSEGPFVAINAGALAESVVE
                     SELFGHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERL
                     GGNQLIPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLF
                     QHFADAASQRHGLSPHALQPAQRALLLRHDWPGNVRELQNAAERFALGLELALDGQAP
                     SAAAPAAPMLSGNLSEQVEQFERSLIAAELAQPHGSMRSLAEALGIPRKTLHDKLRKH
                     GLNFDGGSGGHDDQEDNR"
     gene            complement(337403..339217)
                     /locus_tag="PPUBIRD1_RS01455"
                     /old_locus_tag="PPUBIRD1_0291"
     CDS             complement(337403..339217)
                     /locus_tag="PPUBIRD1_RS01455"
                     /old_locus_tag="PPUBIRD1_0291"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_014589348.1"
                     /db_xref="GI:504402246"
                     /translation="MIAKPTPPRRPRWRSLALLALSLAPLLWPLHHLAERYYQEELAS
                     QNRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQ
                     QTGAEVMYLMDVSGNTLAASNWDKHDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSA
                     KRGYFFAAAVRDRERIVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWR
                     FRATRTLTDAERQAIIAIQPYPTQAPQPLVLNPQAWITQTRDIKETGWQVSILAPRTL
                     VDRSVQTVMAIGAGTLLVLMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAERTADL
                     EGLNTRLKNAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSY
                     AENAEILLDHQRTEDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALD
                     DALALLAKRRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRR
                     LWLSAEQRDDCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRA
                     LGGELLLANHPEGGAMLTLQLRVAASGATLPNSEDPSA"
     gene            complement(339260..339805)
                     /locus_tag="PPUBIRD1_RS01460"
                     /old_locus_tag="PPUBIRD1_0292"
     CDS             complement(339260..339805)
                     /locus_tag="PPUBIRD1_RS01460"
                     /old_locus_tag="PPUBIRD1_0292"
                     /EC_number="5.1.3.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
                     /protein_id="WP_014589349.1"
                     /db_xref="GI:504402247"
                     /translation="MNIIPTAIPEVLIIEPKVFADSRGFFFEAFNAREFSQQTGVNVA
                     FVQDNHSRSIKGVLRGLHYQVANTQGKLVRVVHGEIRDIAVDVRKSSPTFGKWVAVHL
                     SADNHRQLWIPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLDIDWGLQQ
                     PPLLSDKDKVGLPLAEAELLP"
     gene            340082..341188
                     /locus_tag="PPUBIRD1_RS01465"
                     /old_locus_tag="PPUBIRD1_0293"
     CDS             340082..341188
                     /locus_tag="PPUBIRD1_RS01465"
                     /old_locus_tag="PPUBIRD1_0293"
                     /EC_number="3.5.3.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014860373.1"
                     /note="Agmatine deiminase; catalyzes the formation of
                     carbamoylputrescine from agmatine in the arginine
                     decarboxylase pathway of putrescine biosynthesis; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_014589350.1"
                     /db_xref="GI:504402248"
                     /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQ
                     AAHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVI
                     NDHGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKLLEMERCQRYQTEGFVLEGGSI
                     HVDGEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLYNDETDGHV
                     DNFCCYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLF
                     ATAEECAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILARI
                     FPDHEVVMIPGRELLLGGGNIHCLTQQQPAPVKR"
     gene            complement(341645..343714)
                     /locus_tag="PPUBIRD1_RS01470"
                     /old_locus_tag="PPUBIRD1_0294"
     CDS             complement(341645..343714)
                     /locus_tag="PPUBIRD1_RS01470"
                     /old_locus_tag="PPUBIRD1_0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_014589351.1"
                     /db_xref="GI:504402249"
                     /translation="MLVPCRLSPLTLGLSLLFSASLASAATTTLPESSVTADSEREKD
                     NPRVKEVSTATRTSTPVRYVPQAIDTVKTANVLDYGSNTLGKALEGIPNVSSGADTRF
                     DSVRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRV
                     SKAPEPGRRSTIEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFRDGIDGSR
                     QLFAPSISWQITPDLNWLVQYEYSRYNRTPDRGIPSVNGRPADVSRSATYGDNRDYID
                     DRAQSLRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVTGYNAGTNTLTRQRWQQDLN
                     TRNLFNNLEAEGDFDTLGLEHKLLLGLEFGNQRRDPLLYSAGSQSLPGLGKPSQPHNG
                     TLAVSSNNHTVVDSRGVYLQDQIRLNDQWQVLAGVRFDQFEVETTNKDGVREPQDSNS
                     TSPRLGVVYTPWRDHSFYASWSKTFSPVGGGLIGITPGAPGNTNKTDPEETRQKEIGV
                     KSDWLDQRLTTTLAIYELELYNRRTRDPNDPNIILLSGMQRSRGIELTATGNIVGNWY
                     VRGGIGLQDAIIVKDNNGQEGNRINDVAKRNGSLFVTWKPELGWYAETGLTLVGERYA
                     DNQNTTVLPGYGRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRSLV
                     VTGSYSF"
     gene            344189..345508
                     /locus_tag="PPUBIRD1_RS01475"
                     /old_locus_tag="PPUBIRD1_0295"
     CDS             344189..345508
                     /locus_tag="PPUBIRD1_RS01475"
                     /old_locus_tag="PPUBIRD1_0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_003255784.1"
                     /db_xref="GI:489348678"
                     /translation="MLKTRISLVALAMIAATQAQANDQADSKGFIEDSHANVLLRNAY
                     INRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGV
                     DFFKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLP
                     ESFTGTLITSKEIQGLELNAGRFTQEARKSAERRDGGGLKSINVLGGSYKFTDNFTAS
                     LYTADNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDINNKYVKAAGLNGDSNTIW
                     SLAATYAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAED
                     ERSWQLGYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYV
                     VQDGPAKDLSIKLRSSFLRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
     gene            complement(345634..346224)
                     /locus_tag="PPUBIRD1_RS01480"
     CDS             complement(345634..346224)
                     /locus_tag="PPUBIRD1_RS01480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010202879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167119.1"
                     /db_xref="GI:752477843"
                     /translation="MKPVNSVVRPKKYRSYRGTVGKVAANVLERNFVAQRPNQKWVTD
                     VTEFKVAQQKLYLSPVMDLYNGEIVAYEMASRPCYSLVGNMLGKALDCLGEKPKLVLH
                     SDQGWHYQQAQYRRKLSECGVKQSMSRKGNCLDNAAMESFFGTLKSEFFYLKRFESID
                     ELRAGLDEYIHYYNHDRIKLRLNGLSPVEYRAQAAA"
     gene            complement(346695..348365)
                     /locus_tag="PPUBIRD1_RS01485"
                     /old_locus_tag="PPUBIRD1_0297"
     CDS             complement(346695..348365)
                     /locus_tag="PPUBIRD1_RS01485"
                     /old_locus_tag="PPUBIRD1_0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate synthase"
                     /protein_id="WP_014589353.1"
                     /db_xref="GI:504402251"
                     /translation="MKHSLPSHYACLVLCLVFTFASLPLLAQHAWLWPVTLITALLSL
                     VGLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYA
                     RAKNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRMPYSASIF
                     NISAMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGC
                     RTEDGRFDPQRFAEQARSAQVKMIEIKLSQGAKPGHGGILPGHKVSPEIAETRGVRAG
                     EDCISPAAHSAFRTPVELLQFVAGLRELSGGKPVGFKFCLGHPWEFMGIAKAMLATGI
                     TPDFIVVDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIV
                     SAFDIASVLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPD
                     KAERVASFHRNTLHALAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPG
                     ELLSGSIESEFYARMWRMARSDSFAPETGDTATRTVASRLRHEETEPA"
     gene            complement(348567..349934)
                     /locus_tag="PPUBIRD1_RS01490"
                     /old_locus_tag="PPUBIRD1_0298"
     CDS             complement(348567..349934)
                     /locus_tag="PPUBIRD1_RS01490"
                     /old_locus_tag="PPUBIRD1_0298"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014589354.1"
                     /db_xref="GI:504402252"
                     /translation="MRWFHRLWPRTLFGQLLLIMVSGTLVIQLMSSSIWFDVRFAQAL
                     EVPVRLVAARSAPLIAQADCHGGTLQAPSHYQLRCVESLPAQEHDERRGHRRVELLLQ
                     QALKYELGRAQDVRLMNVQLTDELGQPIVWRSLFGLRTAQAHIQFAVPLPDGQWLTVA
                     GQELQGWSGESAWVLISDYLLRVYALRIVAVLLVCLVAVRLCLRPLRRLADAARGLGS
                     NLEQPPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMRLRL
                     ERLHDDEHRQRLRQNITQMDDMIGQVLDYLRAGEQQNLQQVDLDRLVARQCADLATAE
                     EPLTVHGKAGSLRVDALLLQRCLQNLLVNALRYAKNISVTLERATTGVFIHIDDCGPG
                     IAPGLLATITDPFVRGDGSRNQASGGYGLGLSIAQRIAASHGGELMLSNRESGGLRVS
                     ILLPG"
     gene            complement(349936..350655)
                     /locus_tag="PPUBIRD1_RS01495"
                     /old_locus_tag="PPUBIRD1_0299"
     CDS             complement(349936..350655)
                     /locus_tag="PPUBIRD1_RS01495"
                     /old_locus_tag="PPUBIRD1_0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436731.1"
                     /note="winged helix family two component transcriptional
                     regulator; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589355.1"
                     /db_xref="GI:504402253"
                     /translation="MSTTLLVVDDDDEIRELLCDYLTDAGYNVLAAADGQQMRDQLAR
                     HKVELVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAK
                     PFEPRELIARIKAVLRRPQRLGTSAEEPVVDAQLFAGFRLEHVKRLLTRPDGETLTLP
                     RSDYRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGAA
                     QILTIRNEGYLLSIAPLAAGA"
     gene            350796..353093
                     /locus_tag="PPUBIRD1_RS01500"
                     /old_locus_tag="PPUBIRD1_0300"
     CDS             350796..353093
                     /locus_tag="PPUBIRD1_RS01500"
                     /old_locus_tag="PPUBIRD1_0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014860377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_041166820.1"
                     /db_xref="GI:752477544"
                     /translation="MNPQSITTVFTPFSQSGNCLKPLAFCVAVAISGGAVAANGKPLE
                     LDATQIEDSALLPADDAGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIH
                     TIEQALETAPGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMD
                     LYERIDIVRGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNL
                     PLSEDGRLRSRFVMTQQDANSFRDNQSERSRAALANFAFDLDDATTLGAGYQYEYNKV
                     VGGGWGANIPIWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLK
                     AAQATTEALNHRGLAKVNSAGRGSYGGYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSG
                     PFQLFGRTHQAMVGYNDSRTVGWSPQYTCTMVGGGMTSAPALGCQFRANNGFPVTDWH
                     NGVDDDYDLIASRTGLHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVA
                     GERSSQEENGIVTPYLGAVYDLNDNYSVYASYTDIFTPQTSETSSGSKVEPIRGQSYE
                     TGIKGEWFDGRLNASAAYFRTKQENKAVLDGDLTTPTGGNAYKAGSGQETDGIDLEVA
                     GALTPNWNVYAGYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQT
                     NIRAISSPAGQPTNGVSNGATDVNWSGYAIWNAMAKYQLTDETSVSLNANNLFDKHYY
                     TQYGFYAGAIYGDPRNLSLTVSTAF"
     gene            complement(353258..353464)
                     /locus_tag="PPUBIRD1_RS01505"
                     /old_locus_tag="PPUBIRD1_0301"
     CDS             complement(353258..353464)
                     /locus_tag="PPUBIRD1_RS01505"
                     /old_locus_tag="PPUBIRD1_0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589357.1"
                     /db_xref="GI:504402255"
                     /translation="MAKRFPTTPRHPERICWGCDLYCPAKALACGNGADRTMHPVELF
                     GEDWDSFEGQLEKPIDPGQAVKPR"
     gene            353648..355255
                     /locus_tag="PPUBIRD1_RS01510"
                     /old_locus_tag="PPUBIRD1_0302"
     CDS             353648..355255
                     /locus_tag="PPUBIRD1_RS01510"
                     /old_locus_tag="PPUBIRD1_0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589358.1"
                     /db_xref="GI:504402256"
                     /translation="MPHSTGKRGVSYDPPQRRQRRDIPSIVRRVTLGVVVVWLALVAS
                     LGGWIVQRLTAEELDNLAAGAEYEAQITGRVVDRLFTEMASVANMVARQSEVIQLAAR
                     YRHDPPGFAALTREERASKFTRDPLVRSVGDFMDRLASDLHYGRIYMNNLSDDTVTAS
                     NWAESFSIVGQIYTGRAYLIDALRTGSGEMFGIARLNKTPSYFVASRIDDADGKPLGS
                     VTVKFDAPDIALYLTGRHIALIVNRQGRVTTASSELFMLRNVVTLLPPDIRRPLDGDE
                     EPGEPMDIRAVADAGQANQWLIDGHPYLVHRQPLNDAQYQLLTLAKLDHLQPMRQQYY
                     WTGASVAALGLILILLSSRVAGQMLLRRQEERYAANYDALTGLKNRRAILAALHRHFA
                     LAKRTGQGVLVAFIDLDEFKAINDTYGHEVGDKFLIESSRRLQGGLRASDELGRWGGD
                     EFVVIGLTASVHPDEMAKTAAAMRRRLVPLLIGSYEFDDCRFDYAGASFGITSVDPAA
                     TSLQAALKVADQLMYADKEVRRGLRRV"
     gene            complement(355337..355412)
                     /locus_tag="PPUBIRD1_RS01515"
                     /old_locus_tag="PPUBIRD1_t0063"
     tRNA            complement(355337..355412)
                     /locus_tag="PPUBIRD1_RS01515"
                     /old_locus_tag="PPUBIRD1_t0063"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(355377..355379),aa:Thr,seq:tgt)
     gene            complement(355511..355759)
                     /locus_tag="PPUBIRD1_RS01520"
                     /old_locus_tag="PPUBIRD1_0303"
     CDS             complement(355511..355759)
                     /locus_tag="PPUBIRD1_RS01520"
                     /old_locus_tag="PPUBIRD1_0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589359.1"
                     /db_xref="GI:504402257"
                     /translation="MTRATPLALLTFALALTGCAGGTSPHPNSNLGWNHPGMQLGGDN
                     GLPLRTEAPCRKRGCDNDKLFFNPGKSEPSVTTMHRGW"
     gene            356284..356574
                     /locus_tag="PPUBIRD1_RS01525"
                     /old_locus_tag="PPUBIRD1_0304"
     CDS             356284..356574
                     /locus_tag="PPUBIRD1_RS01525"
                     /old_locus_tag="PPUBIRD1_0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589360.1"
                     /db_xref="GI:504402258"
                     /translation="MKTIDADPNSPKSITTAGVETFLAAGNPSLNLLRVEPGIPIDAA
                     YEHVSILMGYIKHLVREGDMEDDHKFLGAADYLCDMAKALMNDIEIAKGKAH"
     gene            complement(356855..358060)
                     /locus_tag="PPUBIRD1_RS01530"
                     /old_locus_tag="PPUBIRD1_0305"
     CDS             complement(356855..358060)
                     /locus_tag="PPUBIRD1_RS01530"
                     /old_locus_tag="PPUBIRD1_0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589361.1"
                     /db_xref="GI:504402259"
                     /translation="MPSPLHSHHLSTRFQALDQFLIEHQQLWKPRPFTTLQLPWETTH
                     PELAAHLRQCSLADAEADSATDRLPAPFPQLAEQARQLATLGSLAQTNLPPAAHRLDV
                     AVPGRKWQQIEAFASHLAFREQPRHWLDWCSGKGHLGRRLLQPGQHLTCLEYDADLVA
                     AGQALSAHHHLQAQHVHQDVMASDSARHLADDKSVVALHACGDLHVRLLQLASQQGCR
                     QLAIAPCCYNRIAAQQYQALSTAAQASSLQLSLDDLGLPLSETVTAGARVRRQRDTSM
                     ARRLGFDLLQRQQRQSDEYLPTPSLPVAWLDKPFEQYCRDLAELKQLPVSGNPDWAML
                     EAAGWQRLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYDVRLGLFCDYPLTPRN
                     LLILAERDG"
     gene            complement(358172..358861)
                     /locus_tag="PPUBIRD1_RS01535"
                     /old_locus_tag="PPUBIRD1_0306"
     CDS             complement(358172..358861)
                     /locus_tag="PPUBIRD1_RS01535"
                     /old_locus_tag="PPUBIRD1_0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014589362.1"
                     /db_xref="GI:504402260"
                     /translation="MNWEVIFKWLPRLAEGAVLTLELVAIAVVAGLILAIPLGIARSS
                     RHWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTM
                     TLHTAAYIAEILRGALQSIPKGEIEAARALGMSRGKALFYIMLPRAARIGLPAYSNEV
                     ILMLKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFMLVQGFKLLE
                     RWLRVDACQGR"
     gene            complement(358861..359553)
                     /locus_tag="PPUBIRD1_RS01540"
                     /old_locus_tag="PPUBIRD1_0307"
     CDS             complement(358861..359553)
                     /locus_tag="PPUBIRD1_RS01540"
                     /old_locus_tag="PPUBIRD1_0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003255749.1"
                     /db_xref="GI:489348642"
                     /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSP
                     LKPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIA
                     LGLCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNL
                     FMILMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVLAMTGMHFM
                     EKRAARGFARAE"
     gene            complement(359608..360360)
                     /locus_tag="PPUBIRD1_RS01545"
                     /old_locus_tag="PPUBIRD1_0308"
     CDS             complement(359608..360360)
                     /locus_tag="PPUBIRD1_RS01545"
                     /old_locus_tag="PPUBIRD1_0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255747.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_014589363.1"
                     /db_xref="GI:504402261"
                     /translation="MHTYKKFLLAAAATLVMTANAMAAEKLRMGIEAAYPPFNNKDAS
                     GNVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAV
                     DFTEPYYSNKLQFIAPKNVDFKTDKASLKGKVIGTQRATLAGTYLEDNYPDVDVKLYD
                     TQENAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDT
                     KLRDDLNKALAEIKADGTYKKINDKYFPFSIE"
     gene            complement(360372..361145)
                     /locus_tag="PPUBIRD1_RS01550"
                     /old_locus_tag="PPUBIRD1_0309"
     CDS             complement(360372..361145)
                     /locus_tag="PPUBIRD1_RS01550"
                     /old_locus_tag="PPUBIRD1_0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018716895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_003255746.1"
                     /db_xref="GI:489348639"
                     /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGS
                     GKSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLIAADNRQINRLRSEIGFVFQN
                     FNLWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQ
                     RAAIARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARH
                     VSSEVVFLHQGLVEEQGSPQQVFENPTSARCKQFMSSHR"
     gene            361777..363162
                     /locus_tag="PPUBIRD1_RS01555"
                     /old_locus_tag="PPUBIRD1_0311"
     CDS             361777..363162
                     /locus_tag="PPUBIRD1_RS01555"
                     /old_locus_tag="PPUBIRD1_0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-aminobutyrate transporter"
                     /protein_id="WP_003255745.1"
                     /db_xref="GI:489348638"
                     /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGP
                     AVLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWV
                     LVIPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVL
                     AIIGFIAVGCAALFGFVPSSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEI
                     VTIAAAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVL
                     SRIGVPNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPH
                     VAVLLSTAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAVSQLRMRAQREARG
                     EKITFKMWLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRK
                     REAAGRAALDS"
     gene            complement(363401..363844)
                     /locus_tag="PPUBIRD1_RS01560"
                     /old_locus_tag="PPUBIRD1_0312"
     CDS             complement(363401..363844)
                     /locus_tag="PPUBIRD1_RS01560"
                     /old_locus_tag="PPUBIRD1_0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255744.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589364.1"
                     /db_xref="GI:504402262"
                     /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKASAGDSASVEQVY
                     NKAMESGSYDAMFNKMKEAQEGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFN
                     AYRKWLDGADEETTMAWLESDEFQDAYIAASELVAKQQQQQKQFG"
     gene            364084..364311
                     /locus_tag="PPUBIRD1_RS01565"
     CDS             364084..364311
                     /locus_tag="PPUBIRD1_RS01565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255743.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166821.1"
                     /db_xref="GI:752477545"
                     /translation="MKHFYLVTLYSYTDDGRVYYPTGFAGCDEQRITKADIAAIIEKG
                     KHHGQLQLHSISYMGHMTEDAFKHLRSMSDE"
     gene            complement(364500..364575)
                     /locus_tag="PPUBIRD1_RS01570"
                     /old_locus_tag="PPUBIRD1_t0062"
     tRNA            complement(364500..364575)
                     /locus_tag="PPUBIRD1_RS01570"
                     /old_locus_tag="PPUBIRD1_t0062"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(364540..364542),aa:Phe,seq:gaa)
     gene            complement(364666..364938)
                     /locus_tag="PPUBIRD1_RS01575"
                     /old_locus_tag="PPUBIRD1_0314"
     CDS             complement(364666..364938)
                     /locus_tag="PPUBIRD1_RS01575"
                     /old_locus_tag="PPUBIRD1_0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008091489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_014589365.1"
                     /db_xref="GI:504402263"
                     /translation="MTRTVMCRKYLEELPGLERPPYPGAKGQYIFEHISQKAWADWQK
                     HQTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
     gene            complement(364935..366002)
                     /locus_tag="PPUBIRD1_RS01580"
                     /old_locus_tag="PPUBIRD1_0315"
     CDS             complement(364935..366002)
                     /locus_tag="PPUBIRD1_RS01580"
                     /old_locus_tag="PPUBIRD1_0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190017.1"
                     /note="A/G-specific adenine glycosylase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine glycosylase"
                     /protein_id="WP_014589366.1"
                     /db_xref="GI:504402264"
                     /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQ
                     VSTVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGG
                     EFPRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKV
                     ANQLWATAERFTPQQRANHYTQAMMDMGATLCTRSKPSCLICPLQHGCEAHLHGEETR
                     YPEPKPRKALPQRRTLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAY
                     QHGLRLAGRHAMDGLTHTFSHFQLAIEPWLVHVDPVGEHVAEADWLWYNLATPPRLGL
                     AAPVKKLLERAADELIAGDAR"
     gene            complement(365999..368251)
                     /locus_tag="PPUBIRD1_RS01585"
                     /old_locus_tag="PPUBIRD1_0316"
     CDS             complement(365999..368251)
                     /locus_tag="PPUBIRD1_RS01585"
                     /old_locus_tag="PPUBIRD1_0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope biogenesis protein AsmA"
                     /protein_id="WP_014589367.1"
                     /db_xref="GI:504402265"
                     /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLAR
                     DKAHVELTLNGDIGWSLFPWLGLELHEASIATLNKPKEPFADLQMLGLSVRVLPLLRR
                     EVQMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAQNGAGTDAPAQAPAQAEQAPATS
                     DSNDRAIKLDIDSLTVNNARVQYTDAKTGHSYSAESIQLSTGPIHEGANIALKTSAFI
                     SASQPNIKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLLVD
                     LAANVASWNGLKVSANQLRALGELNLRDLDKAPQLSGGLSIAQFNLRTFLESIGHPLP
                     ATHDPAAFAKLELVTRLQGTPSSLALEDLAVKLDDSTFSGRVAVEDFAKQALRLQLKG
                     DTFDADRYLPAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDKLL
                     PVDRLRALDLQADLAFGSLTLDKLPIEGAQLKAVGQGGLLTLQTLRGALYNGTFEAKG
                     TVDVRPAVPQLGVNTNIQRVPVEHFIKAEGKEQTPPVKGLLTLTSDLTATGNSQKALV
                     DTLNGSANFAINDGVLVNANLEQQLCQAIATLNRKTLSSEPRGKDTPFQELRGSLVVR
                     NGVASNPDLKARIPGLTVNGHGDLDLRVLGMDYNIGVVVEGDQRAMPDPACQVNERYV
                     GVEVPLRCRGPLELGAKACRLDQNGLGKVAAKLAGNRLKDKIDEKLDEKLGDKVSPEL
                     KDALKGLFNR"
     gene            368520..370181
                     /locus_tag="PPUBIRD1_RS01590"
                     /old_locus_tag="PPUBIRD1_0317"
     CDS             368520..370181
                     /locus_tag="PPUBIRD1_RS01590"
                     /old_locus_tag="PPUBIRD1_0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589368.1"
                     /db_xref="GI:504402266"
                     /translation="MTSTVATGTLASEPGFLSKERIIARPGFNRWLVPPAALAIHLCI
                     GMAYGFSVFWLPLSQALGITAPVACAADMGFMARMFSAECDWPISMLSWIYTLFFVFL
                     GCSAAVLGGWLEHAGPRKAGLVSALCWCGGMLLSAIGVKTHQLWLMWLGSGVIGGIGL
                     GLGYISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQ
                     SFVAMAAIYFVFMTAGALAYRVPPTGWKPEGWAAPLKNASNAMVTDRHVHVSVAWKTP
                     QFALIWLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLSTAQLAQIAAIAA
                     GFTGLLSLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVA
                     AFCIILSMYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLREYQ
                     LAAGVERAAAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGA
                     DGARSLEWKAAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
     gene            370370..370963
                     /locus_tag="PPUBIRD1_RS01595"
                     /old_locus_tag="PPUBIRD1_0318"
     CDS             370370..370963
                     /locus_tag="PPUBIRD1_RS01595"
                     /old_locus_tag="PPUBIRD1_0318"
                     /EC_number="4.2.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008091492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazoleglycerol-phosphate dehydratase"
                     /protein_id="WP_003255736.1"
                     /db_xref="GI:489348629"
                     /translation="MVERKASVERNTLETQVKCSINLDGSGKARFDIGVPFLEHMLDQ
                     IARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKGIFRYGHAYVPLDE
                     ALSRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHALVTLHIDNLRGHN
                     THHQIETVFKAFGRALRMAITLDERMAGQMPSTKGCL"
     gene            370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_RS01600"
                     /old_locus_tag="PPUBIRD1_0319"
     CDS             370964..371602
                     /gene="hisH"
                     /locus_tag="PPUBIRD1_RS01600"
                     /old_locus_tag="PPUBIRD1_0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9HU42.1"
                     /note="Imidazole glycerol phosphate synthase subunit hisH;
                     with HisF IGPS catalyzes the conversion of
                     phosphoribulosyl-formimino-5-aminoimidazole-4-carboxamide
                     ribonucleotide phosphate and glutamine to
                     imidazole-glycerol phosphate,
                     5-aminoimidazol-4-carboxamide ribonucleotide, and
                     glutamate in histidine biosynthesis; the HisH subunit
                     provides the glutamine amidotransferase activity that
                     produces the ammonia necessary to HisF for the synthesis
                     of imidazole-glycerol phosphate and
                     5-aminoimidazol-4-carboxamide ribonucleotide; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisH"
                     /protein_id="WP_014589369.1"
                     /db_xref="GI:504402267"
                     /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDASVIREADRV
                     VFPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENTGVDCIGL
                     FPGQVRFFGKDLQEEGEHLKVPHMGWNEVSQTIDHPLWHDIPDRARFYFVHSYYINAG
                     KPGQVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFIAWDGRW"
     gene            371603..371863
                     /locus_tag="PPUBIRD1_RS01605"
                     /old_locus_tag="PPUBIRD1_0320"
     CDS             371603..371863
                     /locus_tag="PPUBIRD1_RS01605"
                     /old_locus_tag="PPUBIRD1_0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008091494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="WP_003255734.1"
                     /db_xref="GI:489348627"
                     /translation="MSRSKTKAPTITLAPEQEREALDTLKRFLEDRFELQLGSFEVAE
                     VLELFSKEIAPHYYNRAIADVQLHLKERFESIESDLWALEKP"
     gene            371891..372628
                     /locus_tag="PPUBIRD1_RS01610"
                     /old_locus_tag="PPUBIRD1_0321"
     CDS             371891..372628
                     /locus_tag="PPUBIRD1_RS01610"
                     /old_locus_tag="PPUBIRD1_0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268636.1"
                     /note="catalyzes the formation of
                     5-(5-phospho-1-deoxyribulos-1-ylamino)methylideneamino-l-
                     (5-phosphoribosyl)imidazole-4-carboxamide from
                     1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-(5-phosphoribosyl)-5-[(5-
                     phosphoribosylamino)methylideneamino]
                     imidazole-4-carboxamide isomerase"
                     /protein_id="WP_003255731.1"
                     /db_xref="GI:489348624"
                     /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGC
                     RRLHLVDLNGAFEGQPVNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVI
                     IGTKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLAKRFEADG
                     VSAIVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGII
                     GAITGRAIYEGTLDVAEAQAFCDNYQG"
     gene            372639..373409
                     /locus_tag="PPUBIRD1_RS01615"
                     /old_locus_tag="PPUBIRD1_0322"
     CDS             372639..373409
                     /locus_tag="PPUBIRD1_RS01615"
                     /old_locus_tag="PPUBIRD1_0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q4KJS4.1"
                     /note="Imidazole glycerol phosphate synthase subunit hisF;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="imidazole glycerol phosphate synthase subunit
                     HisF"
                     /protein_id="WP_014589370.1"
                     /db_xref="GI:504402268"
                     /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQG
                     ADEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVS
                     INTAAVFNPEFVGEAAERFGSQCIVVAIDAKKVSGPGEAPRWEIFTHGGRKPTGLDAV
                     EWAKKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLAD
                     GILEGHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
     gene            complement(373584..374762)
                     /locus_tag="PPUBIRD1_RS01620"
                     /old_locus_tag="PPUBIRD1_0323"
     CDS             complement(373584..374762)
                     /locus_tag="PPUBIRD1_RS01620"
                     /old_locus_tag="PPUBIRD1_0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009396907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010951660.1"
                     /db_xref="GI:499254120"
                     /translation="MSIIRFEDVDVIFSNKPREALALLDQGQTREQILKQTGLVVGVE
                     KANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIANCSAAE
                     LKMMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQW
                     RNKKPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLS
                     KTIVFVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNV
                     LCGRSLMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQKWAPGQD
                     VELLERRPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG
                     "
     gene            complement(374759..375604)
                     /locus_tag="PPUBIRD1_RS01625"
                     /old_locus_tag="PPUBIRD1_0324"
     CDS             complement(374759..375604)
                     /locus_tag="PPUBIRD1_RS01625"
                     /old_locus_tag="PPUBIRD1_0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003255725.1"
                     /db_xref="GI:489348618"
                     /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTS
                     ALTFFNPFVLIALFAALAHFIQRKWALTAFVALSFLLILNLGYWQETMETLAQVTFAT
                     VVCVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLIST
                     VVFAIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCI
                     MLSLSMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELP
                     VRGEA"
     gene            complement(375689..376636)
                     /locus_tag="PPUBIRD1_RS01630"
                     /old_locus_tag="PPUBIRD1_0325"
     CDS             complement(375689..376636)
                     /locus_tag="PPUBIRD1_RS01630"
                     /old_locus_tag="PPUBIRD1_0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589371.1"
                     /db_xref="GI:504402269"
                     /translation="MKGSPSLLLVALLSAPLLAQAAEPEQCQTVRFSDVGWTDITVTT
                     ATTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTV
                     ETVRANLENAKYTLAVPQALYDKGLKDFSDIPKFKKELNGKIYGIEPGNDGNRTIQSM
                     IDKNAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTG
                     GDEFFGPDFGKATVLTNTRKGYTQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPE
                     AAAKKWIKDNPGKLDAWLAGVTTVDGKPGLEAVKAKLTQ"
     gene            377089..378465
                     /locus_tag="PPUBIRD1_RS01635"
                     /old_locus_tag="PPUBIRD1_0326"
     CDS             377089..378465
                     /locus_tag="PPUBIRD1_RS01635"
                     /old_locus_tag="PPUBIRD1_0326"
                     /EC_number="4.3.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951662.1"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine dehydratase"
                     /protein_id="WP_014589372.1"
                     /db_xref="GI:504402270"
                     /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVK
                     RIEVRLYGSLSATGIGHGTDNATIMGLMGEWPDAIDPTQIVPRIADLRETNTLQLDSR
                     LPIEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASG
                     VLDADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEEDIRAGLYKLWEAM
                     QECVNNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVN
                     EENAAGGRMVTAPTNGAAGIIPAVLHYYMRFSDEVDESSVVDYFLAAAAVGILCKKNA
                     SISGAEVGCQGEVGSACAMAAAGLAEVLGATPAQVENAAEIALEHNLGLTCDPVGGLV
                     QVPCIERNAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGG
                     LAVSAIEC"
     gene            378959..380065
                     /locus_tag="PPUBIRD1_RS01640"
                     /old_locus_tag="PPUBIRD1_0327"
     CDS             378959..380065
                     /locus_tag="PPUBIRD1_RS01640"
                     /old_locus_tag="PPUBIRD1_0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016714506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_011953240.1"
                     /db_xref="GI:500574238"
                     /translation="MTSYTSGNPTQNRTTPQSIGFLLLDNFTLISLASAVEPLRMANQ
                     LSGRELYRWHTLTIDGGQVWASDGLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREH
                     VTWLQAQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRL
                     FTLDRNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKH
                     MLGTNQPKLQEIVALMEANLEEPIDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLK
                     LRLIRARQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVA
                     MMPIPQAMTLSPHSGPMAALSQARNESTFASVRL"
     gene            complement(380187..380444)
                     /locus_tag="PPUBIRD1_RS01645"
                     /old_locus_tag="PPUBIRD1_0328"
     CDS             complement(380187..380444)
                     /locus_tag="PPUBIRD1_RS01645"
                     /old_locus_tag="PPUBIRD1_0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009682891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589374.1"
                     /db_xref="GI:504402272"
                     /translation="MMHADLIDQDDLAGHLRSRGFDIPAGASAEQACEAVVRGLTEPN
                     ARALKGMVEQMYTGSATILPAVRQAIDKQLLPALAQFNKRA"
     gene            381125..381331
                     /locus_tag="PPUBIRD1_RS01650"
     CDS             381125..381331
                     /locus_tag="PPUBIRD1_RS01650"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166822.1"
                     /db_xref="GI:752477546"
                     /translation="MSWLMGTKDGLAISLQSGRQAAQGRKQKLISILSIICQSFALVI
                     SWQAIFWWMASDTDWFISVQIRTC"
     gene            complement(382524..382994)
                     /locus_tag="PPUBIRD1_RS01655"
                     /old_locus_tag="PPUBIRD1_0330"
     CDS             complement(382524..382994)
                     /locus_tag="PPUBIRD1_RS01655"
                     /old_locus_tag="PPUBIRD1_0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoyl-CoA thioesterase"
                     /protein_id="WP_014589376.1"
                     /db_xref="GI:504402274"
                     /translation="MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGL
                     DADSRGQSGNSLFTLEAHINYLHEVKLATEVWVQTQIIGFDKKRLHLYHSLHRSGFDE
                     ALAASEQLLLHVDLAGPKAKPFGESSTHRLQSVVDDQRDLPTPAFTGRVIKIPS"
     gene            complement(383005..383970)
                     /locus_tag="PPUBIRD1_RS01660"
                     /old_locus_tag="PPUBIRD1_0331"
     CDS             complement(383005..383970)
                     /locus_tag="PPUBIRD1_RS01660"
                     /old_locus_tag="PPUBIRD1_0331"
                     /EC_number="1.1.1.45"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589377.1"
                     /note="converts (S)-3-hydroxybutanoyl-CoA to
                     3-acetoacetyl-CoA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyryl-CoA dehydrogenase"
                     /protein_id="WP_014589377.1"
                     /db_xref="GI:504402275"
                     /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQ
                     ALRKRIANAWPALEKQGLAPGASQDRLKFVATIEECVHDADFIQESAPERLDLKLELH
                     AKISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRT
                     SPEAIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDD
                     AIRFGAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDD
                     VVDGTSEQLGEHSIAALERYRDDTLLAVLEAVKTSKASHGMSFGD"
     gene            complement(384133..385017)
                     /locus_tag="PPUBIRD1_RS01665"
                     /old_locus_tag="PPUBIRD1_0332"
     CDS             complement(384133..385017)
                     /locus_tag="PPUBIRD1_RS01665"
                     /old_locus_tag="PPUBIRD1_0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019471313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255710.1"
                     /db_xref="GI:489348603"
                     /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGAT
                     VVHCHVRDPQTGRFSRDVNLYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAF
                     GPGTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELG
                     VKAELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANV
                     TWAGFGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMG
                     GRVLSPAEGREKMNLKRR"
     gene            complement(385141..386085)
                     /locus_tag="PPUBIRD1_RS01670"
                     /old_locus_tag="PPUBIRD1_0333"
     CDS             complement(385141..386085)
                     /locus_tag="PPUBIRD1_RS01670"
                     /old_locus_tag="PPUBIRD1_0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589378.1"
                     /db_xref="GI:504402276"
                     /translation="MHSLIRRSLLPLALSSIVATPLFAAEPAACKNVRLGVVNWTDVI
                     ATSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDAN
                     QVKVLDKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKELGGKIYGIEPGSGANTQI
                     KAMITKNQFDLGKFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLG
                     DSQDALGPDEGRATVWTVTAPDYAERCPNAHRLLANLKFSAEDESRMMQPLLDHKDAL
                     ESARQWLKDHPEDKARWLEGVTTFDGKPAADNLKLTAN"
     gene            386230..387177
                     /locus_tag="PPUBIRD1_RS01675"
                     /old_locus_tag="PPUBIRD1_0334"
     CDS             386230..387177
                     /locus_tag="PPUBIRD1_RS01675"
                     /old_locus_tag="PPUBIRD1_0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_019436921.1"
                     /db_xref="GI:518266713"
                     /translation="MMETIAFLLVPGFSAMGFISAVEPLRVANRFGGQLYRWQVLSLD
                     GEAVLASNGMSINADAALGEGEPANILLVVAGFEPLANVAPKLLHALRRLNHEAVMLG
                     GIDTGAMVLAEAGLLEGYRATLHWEALEAFKERYPGLQATQELFEIDRSRITCAGGTA
                     SIDLMLHLIAQSHGSELAVKVSEQFVLGRIRQRQDHQRMQIGARYGISNKKLVHAIGE
                     MEKHIEPPLTTLELAAAIKVTRRQLERLFRMHLDATPSGFYLGLRLDKARQLLAQTDM
                     SVTEVSLACGFELPSYFTRRYKLRFGRCPREERRPSGTK"
     gene            complement(387181..387798)
                     /locus_tag="PPUBIRD1_RS01680"
                     /old_locus_tag="PPUBIRD1_0335"
     CDS             complement(387181..387798)
                     /locus_tag="PPUBIRD1_RS01680"
                     /old_locus_tag="PPUBIRD1_0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589380.1"
                     /db_xref="GI:504402278"
                     /translation="MGDTSLDTRIFEERLSIKPAPWLTLDTWEDLQLCLRYSQAVANE
                     KYSMETQPQQWFTVARATLQSLKFTLFEHTHRTIVYEPNLLALSDVYSGYLPPPREKG
                     PWFKSLEENVQAALQSAGTRTFTVMNASSHLSIEMDHEGDHVPVAILFYAYCITDPVE
                     PTRKLNLVFDHLGARFNAAGFAPLREDLQARNREKLRAILERELD"
     gene            complement(387872..388564)
                     /locus_tag="PPUBIRD1_RS01685"
                     /old_locus_tag="PPUBIRD1_0336"
     CDS             complement(387872..388564)
                     /locus_tag="PPUBIRD1_RS01685"
                     /old_locus_tag="PPUBIRD1_0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589381.1"
                     /db_xref="GI:504402279"
                     /translation="MADIKVEMEKIRKEGQERVAATGQTICIFADNVPANIAEDILAG
                     MRLMTELANKKFDKETQQREWYNFYNDGLIKFGWTMTGAAHAEDAIDEDNLTLAELIT
                     KSVTISVSADPRRAACARRVLQIVVQKPEVKAHLEKHSHSESGKSSNFVVAQCEMTPQ
                     GLPAMHMTSFQASYDSKVEREGALTRKVDKTSTRVYRASQQGTFSVRHFDAARDLVNE
                     KIKGDLGAFLAI"
     gene            complement(388703..389119)
                     /locus_tag="PPUBIRD1_RS01690"
                     /old_locus_tag="PPUBIRD1_0337"
     CDS             complement(388703..389119)
                     /locus_tag="PPUBIRD1_RS01690"
                     /old_locus_tag="PPUBIRD1_0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255702.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589382.1"
                     /db_xref="GI:504402280"
                     /translation="MKSMAWLVLLAIVSGAQAGEEESTPCDNVENDQQTFACAAFNKQ
                     VAERELQSAYDDLVARMRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSN
                     AYQIAWNSCIAQRSDERAEYLRSLGSQNSDEPAPED"
     gene            389405..390382
                     /locus_tag="PPUBIRD1_RS01695"
                     /old_locus_tag="PPUBIRD1_0338"
     CDS             389405..390382
                     /locus_tag="PPUBIRD1_RS01695"
                     /old_locus_tag="PPUBIRD1_0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002555667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane dipeptidase"
                     /protein_id="WP_003255700.1"
                     /db_xref="GI:489348593"
                     /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVW
                     EGFKATVDNIASSQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQI
                     AYVDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHV
                     GSKTSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLA
                     KGIDSTIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFG
                     KIINPLGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
     gene            390458..390988
                     /locus_tag="PPUBIRD1_RS01700"
                     /old_locus_tag="PPUBIRD1_0339"
     CDS             390458..390988
                     /locus_tag="PPUBIRD1_RS01700"
                     /old_locus_tag="PPUBIRD1_0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255698.1"
                     /db_xref="GI:489348591"
                     /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHMGIEEV
                     LGADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDID
                     LDKGTCSVKLKHSAFVYVYGKCGRKVDYMFTGWFAGAMDQILAARGSKIRTVAEQVYG
                     GSEEGHEDGLFVTKPL"
     gene            391004..393064
                     /locus_tag="PPUBIRD1_RS01705"
                     /old_locus_tag="PPUBIRD1_0340"
     CDS             391004..393064
                     /locus_tag="PPUBIRD1_RS01705"
                     /old_locus_tag="PPUBIRD1_0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002555665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-methylproline demethylase"
                     /protein_id="WP_003255697.1"
                     /db_xref="GI:489348590"
                     /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKY
                     YEEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIM
                     IQITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAK
                     EGGLDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDF
                     CVGMRICGDEFHPDGLSHEDMKQIAAYYDATGMLDFIGVVGSGCDTHNTLANVIPNMS
                     YPPEPFLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLI
                     AKIKMGQIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRK
                     VVVVGAGPAGMEAARVAAERGHDVTLFEKRDQIGGQITIAAKAPQRDQIAGITRWYQL
                     ELARLKVDLRLGTAADVAAIQDLRPDVIVLAVGGHSFLEQNEHWGAAEGLVVSSWDVL
                     DGKVAPGKNVLVYDTICEFTGMSVADFIADKGSQVEIVTDDIKPGVAMGGTTFPTYYR
                     SMYPKEVIMTGDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEELY
                     YALKEGSRNKGQIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRL
                     CKDF"
     gene            393243..395195
                     /locus_tag="PPUBIRD1_RS01710"
                     /old_locus_tag="PPUBIRD1_0341"
     CDS             393243..395195
                     /locus_tag="PPUBIRD1_RS01710"
                     /old_locus_tag="PPUBIRD1_0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(Fe-S)-binding protein"
                     /protein_id="WP_014589383.1"
                     /db_xref="GI:504402281"
                     /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRPSKVNLIGGLLA
                     MPRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAVLAILVHGFGLQSKILGYALLVAT
                     VIMFTGAIFVFKRRLNPPSRLSKGPWMRLPKSLLAFAVSFFIATLPVAGILPANTGGW
                     VMVAVLGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKPLD
                     LEDPNAPLGVEKPVDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIG
                     LAGGTDAQFAGSPYPGKPIGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIE
                     HVDAIVDMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLQLLSE
                     VKATEVLFWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEA
                     TFQQLAKRNIQTLAKYKFQRIVTCDPHSFHVLKNEYGALGGDYQVQHHSTYIAELIAA
                     KKLNLGQHKGGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGG
                     GGAPITDIPGKQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELV
                     ADVLIEEDASTVPKPQTAKREPAEVH"
     gene            395195..396427
                     /locus_tag="PPUBIRD1_RS01715"
                     /old_locus_tag="PPUBIRD1_0342"
     CDS             395195..396427
                     /locus_tag="PPUBIRD1_RS01715"
                     /old_locus_tag="PPUBIRD1_0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255695.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="WP_014589384.1"
                     /db_xref="GI:504402282"
                     /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTSWMGPNGIIRKNP
                     HAIAAGFVGPAGIKRIDRSGAQQGTGAGGRRTAAAEVKLPLHQVAAPAFYIAVVPDMV
                     GGRLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKESNFSTAGVDRLLVIEGEAFEGYA
                     PEQLVQGLRAVDNQFAPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQVKDGQCIG
                     RAGAGQQDLQRAVPRLILAAAECAEPVSETRHEALPVELSTSVVRSLPRIEDLGSVAV
                     DPATIAMAEAEFIVSGGNGVKDWDLYHKATAALGATEGASRVAVDDGFMPRNRQVGAT
                     GTWVTARVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILK
                     ALIEAVDNYRSGGQRDAA"
     gene            396438..397208
                     /locus_tag="PPUBIRD1_RS01720"
                     /old_locus_tag="PPUBIRD1_0343"
     CDS             396438..397208
                     /locus_tag="PPUBIRD1_RS01720"
                     /old_locus_tag="PPUBIRD1_0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="WP_003255694.1"
                     /db_xref="GI:489348587"
                     /translation="MSTKVISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVV
                     HAGDPQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGE
                     GSGMLPFLLAEKLGWPLIVGLAEVESIDNGTAQVLQALPRGQRRRLKVRLPLLATVDN
                     AAPKPRQSAFGPARRGVLAARNVAIVEDELLAEAELQPARPRPKRLKVIKAKSGADRM
                     KAATAKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
     gene            397831..398718
                     /locus_tag="PPUBIRD1_RS01725"
     CDS             397831..398718
                     /locus_tag="PPUBIRD1_RS01725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166823.1"
                     /db_xref="GI:752477547"
                     /translation="MHGMLQPVIPTHMGGIPRSYSAYGAYAGARNIAFAGQMVDRLTG
                     CYHLGNGRRTYNPVLMRFHSADSLSPFSDGGLNAYAYCNGDPINRVDPSGAYPVTSAR
                     NRVDVISPAISGISMFSSSVTLGGAVARTARNVVADLQSQHSGAEYTAPSLRSRIGNT
                     SLFYTGVMGVAGTAMSGVEQGWIGNVLTSHGRRLGLGNAIGNISGGLFSNAEAAQAVW
                     RGVGQPGVSGVRVAWETVYEVTGVRMVFEGASYVWGRSMALGARIASAGRAAADAWRR
                     WGTEPSAPPQSPNRDIRRP"
     gene            complement(398762..400054)
                     /locus_tag="PPUBIRD1_RS01730"
                     /old_locus_tag="PPUBIRD1_0344"
     CDS             complement(398762..400054)
                     /locus_tag="PPUBIRD1_RS01730"
                     /old_locus_tag="PPUBIRD1_0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011536156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rieske (2Fe-2S) protein"
                     /protein_id="WP_014589386.1"
                     /db_xref="GI:504402284"
                     /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLF
                     QIDMQEIFHKEWLIAGMTCEIPAKGNYITLQIGKNPIIVVRGAEGKVHAFHNVCRHRG
                     SRLCVSEKGKVAKLVCPYHQWTYELDGRLLFAGTEMGADFDMNQYGLKPVNVKVAGGY
                     IFISLAENPPAIDEFLATLDHYMEPYDMENTKVAVQTTLMEKANWKLVLENNRECYHC
                     NGSHPELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRM
                     PLLKGTVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPIS
                     AQETMVTTKWLVHKDAVEGVDYNPENMRKVWDATNDQDRRLAEENQRGINSTAYQPGP
                     YSKTYEFGVVNFIDWYSGRLLNNLGAEPAPYLKEVQAQ"
     gene            400350..401450
                     /locus_tag="PPUBIRD1_RS01735"
                     /old_locus_tag="PPUBIRD1_0346"
     CDS             400350..401450
                     /locus_tag="PPUBIRD1_RS01735"
                     /old_locus_tag="PPUBIRD1_0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008089660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_014589387.1"
                     /db_xref="GI:504402285"
                     /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPI
                     MFFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMH
                     EGLELPVHGPVGLFNAIDFPSGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSA
                     RSPKDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYME
                     RVVFCCGPTPYMTAVKRLLEAVGFDMANYHEESFGATPAEAKADAVEHAEQAADAPEL
                     DVSDLNLVEFIGSEKSIRIAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVE
                     MEHNGGITEEDEAEGYILSCCSVPKGDVRIDY"
     gene            complement(401559..403184)
                     /locus_tag="PPUBIRD1_RS01740"
                     /old_locus_tag="PPUBIRD1_0347"
     CDS             complement(401559..403184)
                     /locus_tag="PPUBIRD1_RS01740"
                     /old_locus_tag="PPUBIRD1_0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255688.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_003255688.1"
                     /db_xref="GI:489348581"
                     /translation="MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAI
                     EQVSVPSIKILDELTALNLRMRTLSYRLLLNREPATQRDTLDLLDQRNSQIDRARQAY
                     LPMIVAADEQAAFDQYGQLLNQYRQLESRMRTLSQADRLDELRDLLNRDLLANSEQIN
                     KVMDTLVRINTDQTRATNEKAANQYAGAFALVIGLLVAATVLTFACAFLLTRSIVKPI
                     EEALKCAEQVADGDLTHVIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASA
                     AEELNAVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTG
                     DGRDLVMETVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNA
                     AIEAARAGEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTE
                     RAESTLNIARGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLS
                     VQSATGAHQTSAASAELSRLAVDLNGLVARFRT"
     gene            403451..403681
                     /locus_tag="PPUBIRD1_RS01745"
                     /old_locus_tag="PPUBIRD1_0348"
     CDS             403451..403681
                     /locus_tag="PPUBIRD1_RS01745"
                     /old_locus_tag="PPUBIRD1_0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008089655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255686.1"
                     /db_xref="GI:489348579"
                     /translation="MLEASLNQIEQLVSDLMQKNAQLIEQNTALGQELAQAKEENETL
                     QLSLMEQEEKNGATAARIQALVERASAGVVGA"
     gene            403678..403980
                     /locus_tag="PPUBIRD1_RS01750"
                     /old_locus_tag="PPUBIRD1_0349"
     CDS             403678..403980
                     /locus_tag="PPUBIRD1_RS01750"
                     /old_locus_tag="PPUBIRD1_0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255684.1"
                     /db_xref="GI:489348577"
                     /translation="MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNKALNET
                     KRQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAEQ"
     gene            404162..406099
                     /locus_tag="PPUBIRD1_RS01755"
                     /old_locus_tag="PPUBIRD1_0350"
     CDS             404162..406099
                     /locus_tag="PPUBIRD1_RS01755"
                     /old_locus_tag="PPUBIRD1_0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_014589388.1"
                     /db_xref="GI:504402286"
                     /translation="MRIWRKSIQLQLITSMGAALLASILVVVIIFTVALNRLTDRYLV
                     DTALPASIEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEDPAQVPQFIEYLTAA
                     KQRNHAFTTLFASTETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERFINIDIDGA
                     TGELALFIDYRVEKEGKLVGVAGMGLRMTELSKLIHDFSFGEHGKVFLVRNDGLIQVH
                     PDAAFSGKRQLAEQLGADAAKGVMTGDESLRSSRFSRDGERYLALGLPLRDLNWTLVA
                     EVPESEIYAQMHQAVWLTSLIGGAVALVSLLLVVLLARGLVRPIRRVTAALVQIGGGA
                     GDLSHRLDDTRQDELGDLARGFNRFLDSQRSLIGEVLSTSERLRRAVEQVTQVVDNTA
                     ERSGRQQEMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVQRSIRG
                     IEGMSGDIGKAADAVSQLADEVASVDEVLAVIRSISEQTNLLALNAAIEAARAGEMGR
                     GFAVVADEVRTLARRTQLSTDEVQQMIQRLKLGAGSAVSSMQAGQQATGSGVESSQRT
                     GASLSAITDQVEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVRGCRE
                     ECQALRGLADDLARQMGGFRL"
     gene            complement(406132..407172)
                     /locus_tag="PPUBIRD1_RS01760"
                     /old_locus_tag="PPUBIRD1_0351"
     CDS             complement(406132..407172)
                     /locus_tag="PPUBIRD1_RS01760"
                     /old_locus_tag="PPUBIRD1_0351"
                     /EC_number="4.1.2.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine aldolase"
                     /protein_id="WP_014589389.1"
                     /db_xref="GI:504402287"
                     /translation="MTDKSQQFASDNYSGICPEAWAAMEKANRGHDRAYGDDQWTERA
                     SEYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFS
                     NGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAI
                     SATCKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILF
                     FNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVS
                     DLPGVELMFPVEANGVFLQMPEHAIEALRGKGWRFYTFIGSGGARFMCSWDTEEARVR
                     ELAADIRTIIGG"
     gene            407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS01765"
                     /old_locus_tag="PPUBIRD1_0353"
     CDS             407497..408750
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS01765"
                     /old_locus_tag="PPUBIRD1_0353"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017903837.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase 1"
                     /protein_id="WP_003255681.1"
                     /db_xref="GI:489348574"
                     /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSKRVM
                     QAQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSAN
                     GAVYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGIDTNTGLIDYDEVE
                     RLAVEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPI
                     PFADVVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCF
                     KEALEPGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDAD
                     AALGRAHITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDN
                     LGDADVEADVAKNVAALCADFPVYR"
     gene            408766..410016
                     /locus_tag="PPUBIRD1_RS01770"
                     /old_locus_tag="PPUBIRD1_0354"
     CDS             408766..410016
                     /locus_tag="PPUBIRD1_RS01770"
                     /old_locus_tag="PPUBIRD1_0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008365064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit beta"
                     /protein_id="WP_003255680.1"
                     /db_xref="GI:489348573"
                     /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHG
                     LATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEG
                     LSQDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNTAQVAAEIPYL
                     DCSKNTRYPILGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGAV
                     IGVETNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIM
                     SNAVHGYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNR
                     QWGGIVDTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLA
                     APFSMDRFYNGALIDEHGAAAVAH"
     gene            410031..410366
                     /locus_tag="PPUBIRD1_RS01775"
                     /old_locus_tag="PPUBIRD1_0355"
     CDS             410031..410366
                     /locus_tag="PPUBIRD1_RS01775"
                     /old_locus_tag="PPUBIRD1_0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008089644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit delta"
                     /protein_id="WP_010951682.1"
                     /db_xref="GI:499254142"
                     /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPNACSDEEWGTYM
                     FYRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTASGKATSAAS
                     TVKGQGEKV"
     gene            410363..413377
                     /locus_tag="PPUBIRD1_RS01780"
                     /old_locus_tag="PPUBIRD1_0356"
     CDS             410363..413377
                     /locus_tag="PPUBIRD1_RS01780"
                     /old_locus_tag="PPUBIRD1_0356"
                     /EC_number="1.5.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014860936.1"
                     /note="Sarcosine oxidase subunit alpha; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit alpha"
                     /protein_id="WP_014589390.1"
                     /db_xref="GI:504402288"
                     /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANG
                     VDIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTN
                     GWPNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQND
                     PDSYDYMNRHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDTRETLDG
                     KPAADWVNAVVKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRH
                     RVHRVRAKRVVLAAGAHERPLVYGNNDVPGNMLAGAVSTYVRRYGVAPGRKLVLSTNN
                     DHAYRAALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVIEAKGSKHVT
                     GARVAAIDVQAHKVTSPGEILECDLIASSGGYSPIVHLASHLGGRPVWRDDILGFVPG
                     DAPQKRECVGGINGVYALGDVIADGFEGGVRAATEAGFKATVGTLPKTVARKEEATVA
                     LFLVPHDKGTKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLG
                     NINGLAIAARSIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHV
                     KNGAEFEDVGQWKRPWYFPKAGEDIHAAVTRECKAVRDSVGLLDASTLGKIDIQGPDA
                     REFLNRIYTNAWTKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARV
                     LQWMELYHQTEWPELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTW
                     KEGNVGGVPARVFRISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHV
                     LRAEKGFIIVGQDTDGSMNPDDLNMSWCVGRNKPFSWIGLRGMNREDCVRENRKQLVG
                     LKPVDPTQWLPEGAQLVFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMG
                     ERVYSPQADGSVIEAEIVSSVFFDPKGERQNV"
     gene            413547..414179
                     /locus_tag="PPUBIRD1_RS01785"
                     /old_locus_tag="PPUBIRD1_0357"
     CDS             413547..414179
                     /locus_tag="PPUBIRD1_RS01785"
                     /old_locus_tag="PPUBIRD1_0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255677.1"
                     /note="sarcosine oxidase, gamma subunit family; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sarcosine oxidase subunit gamma"
                     /protein_id="WP_014589391.1"
                     /db_xref="GI:504402289"
                     /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRER
                     KFLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANKDMSLQWVGPDEWLLIVPGG
                     QELAVEQKLRAALEGQHIQVVNVSGGQSLLELRGPNVRDVLMKSTSYDVHPNNFPVGK
                     AVGTVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
     gene            414191..415048
                     /locus_tag="PPUBIRD1_RS01790"
                     /old_locus_tag="PPUBIRD1_0358"
     CDS             414191..415048
                     /locus_tag="PPUBIRD1_RS01790"
                     /old_locus_tag="PPUBIRD1_0358"
                     /EC_number="3.5.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002555606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formyltetrahydrofolate deformylase"
                     /protein_id="WP_003255675.1"
                     /db_xref="GI:489348568"
                     /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDR
                     QSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHC
                     LNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQV
                     IEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMV
                     GATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVF
                     LNANRTVVL"
     gene            415350..416549
                     /locus_tag="PPUBIRD1_RS01795"
                     /old_locus_tag="PPUBIRD1_0359"
     CDS             415350..416549
                     /locus_tag="PPUBIRD1_RS01795"
                     /old_locus_tag="PPUBIRD1_0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dismutase"
                     /protein_id="WP_011953256.1"
                     /db_xref="GI:500574324"
                     /translation="MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVST
                     NICGSDQHMVRGRTTAQVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCR
                     SCKEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAME
                     KIRDLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGD
                     LNPARLAHAKSQGFEVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAK
                     HEAPATVLNSLMQVTRVAGNIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSF
                     HTGQTPTMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDP
                     HKMWGAA"
     gene            complement(416797..417111)
                     /locus_tag="PPUBIRD1_RS01800"
     CDS             complement(416797..417111)
                     /locus_tag="PPUBIRD1_RS01800"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166824.1"
                     /db_xref="GI:752477548"
                     /translation="MVNAEVDFFTGKVEKYKAKTAANYDRKTVAQNSYEDELKYAQYT
                     EHLENITIIRDDLYSFTEGTVDGKTRLFTKANQTKYLELLFNEPNTTSSPDTLSKGGT
                     RR"
     gene            complement(417441..417686)
                     /locus_tag="PPUBIRD1_RS01805"
     CDS             complement(417441..417686)
                     /locus_tag="PPUBIRD1_RS01805"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166825.1"
                     /db_xref="GI:752477549"
                     /translation="MKQQTPTQFFYNKQNLSTLTTEPHTTTLFRTTDLALGELGPEKK
                     VFLAVNDSSSVLEAGKINETQKTLIQLMATIPPQPQR"
     gene            418185..418760
                     /locus_tag="PPUBIRD1_RS01810"
                     /old_locus_tag="PPUBIRD1_0360"
     CDS             418185..418760
                     /locus_tag="PPUBIRD1_RS01810"
                     /old_locus_tag="PPUBIRD1_0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589392.1"
                     /db_xref="GI:504402290"
                     /translation="MKAFTLATLMTLAASPVFAFNLSDAANAVSAMQNQQQQGQVQAP
                     EAQANLLNTLGSQLNITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGAN
                     ALGGLSGLGDLLGKNSESQSALSNALGNNVENRSDLDNAFKALGMDTGMIGQFAPLIL
                     QYLGQQGIAGSLLQNLGSLWTTPAPLAQPSV"
     gene            complement(418858..420207)
                     /locus_tag="PPUBIRD1_RS01815"
                     /old_locus_tag="PPUBIRD1_0361"
     CDS             complement(418858..420207)
                     /locus_tag="PPUBIRD1_RS01815"
                     /old_locus_tag="PPUBIRD1_0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_014589393.1"
                     /db_xref="GI:504402291"
                     /translation="MANPPSSNPAQLRRVLGLPALVFFGLVYMVPLTIFTTYGIVTEL
                     TGGRTAGAYLVTLVAMLFTAASYSFMVKRFPVAGSAYSYTNMAFGPNVGFLAGWSLLL
                     DYLFLPMINYLLIGLFLNIAFPAVPAWAFVLACIALVTVLNVVGINSVAKTSNLIVGA
                     QIVFIGVFVALSCQTLAGQPLDLLSPLIGDGSKPGFGHLMAGAAVLCLSFLGFDAVST
                     LAEECRDARRDVPRAIILTTLFAGLLFTVLAYVSQLVLPGSSFANADAAANEVMFKAG
                     GQFLTNFFTAAYVAGSLGSALASQAAVSRILFTMGRDNVLPRRSFGYLSPRFGTPVFA
                     IALVSAFSLLALVIDLSTLASLISFGALVAFSAVNLTVVKTHLMDDASQRNFIGLLSY
                     GLVPLVGLGLTLWLWTSLSALTLVIGLCWFALGLAYLAVLTAGFRRPVRLVDFSEAV"
     gene            complement(420447..421334)
                     /locus_tag="PPUBIRD1_RS01820"
                     /old_locus_tag="PPUBIRD1_0362"
     CDS             complement(420447..421334)
                     /locus_tag="PPUBIRD1_RS01820"
                     /old_locus_tag="PPUBIRD1_0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase"
                     /protein_id="WP_014589394.1"
                     /db_xref="GI:504402292"
                     /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYAS
                     WAVMWVAETWSEIDKAIFALCIPTQWDIRGVENLRKDTSYLAVSNHQTWVDIPALIES
                     LNRRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKA
                     ACELFKRQPVTVVNYLEGTRFTEAKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDAL
                     LDVTIVYPGNKAPGFWDLLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWV
                     NQLWVAKDQRIEQLRAEMG"
     gene            421517..422017
                     /locus_tag="PPUBIRD1_RS01825"
                     /old_locus_tag="PPUBIRD1_0363"
     CDS             421517..422017
                     /locus_tag="PPUBIRD1_RS01825"
                     /old_locus_tag="PPUBIRD1_0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589395.1"
                     /db_xref="GI:504402293"
                     /translation="MKPLLALLSLLALPVMAAEPTLYGRYENIALPELGETLKAKMDT
                     GAFTASLSAKDIELFTRDGDEWVRFRLATKDSDGKVYEHKVSRISKIKGRADEEDEGD
                     APEVSKRPVVDLELCLGDVKRTVEVNLVDRSNFNYPLLVGSKALREFKAAVNPAKKFT
                     AGKPGC"
     gene            422157..422837
                     /locus_tag="PPUBIRD1_RS01830"
                     /old_locus_tag="PPUBIRD1_0364"
     CDS             422157..422837
                     /locus_tag="PPUBIRD1_RS01830"
                     /old_locus_tag="PPUBIRD1_0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750247.1"
                     /note="response regulator in two-component regulatory
                     system with CreC; CreB protein is phosphorylated by sensor
                     protein phospho-CreC; involved in catabolic regulation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041166826.1"
                     /db_xref="GI:752477550"
                     /translation="MPHILIVEDEAAIADTLVYALQADGHSTEWVTLGSAALDQQRQR
                     PADLVILDIGLPDISGFETCRQLRRFTEVPVMFLSARDGEIDRVVGLEIGADDYVVKP
                     FSPREVAARVRAILKRMAPRAEAAGGTSLFQLDTLRMQITYRSQPLTLTRHEFRLLQC
                     LLEQPQRVFSREQLLDALGVASDVGYERTIDSHIKSLRAKLRQVAGDAEPIQTHRGLG
                     YSYSPEHA"
     gene            422837..424273
                     /locus_tag="PPUBIRD1_RS01835"
                     /old_locus_tag="PPUBIRD1_0365"
     CDS             422837..424273
                     /locus_tag="PPUBIRD1_RS01835"
                     /old_locus_tag="PPUBIRD1_0365"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270131.1"
                     /note="part of a two-component regulatory system with CreB
                     or PhoB; involved in catabolic regulation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_014589397.1"
                     /db_xref="GI:504402295"
                     /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVD
                     TANLLAEILRDDVKAGTLNQGRLPEVLEAYGSRSPGAQIWGLAKNQVSHRIYVTDAKG
                     IVLLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPNDESTSVMHVGAPIIDNGKI
                     IGVVTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRKLAGYAQ
                     AVSEGERAELPHYKGGELANLAQAVERMRTQLEGKAYVERYVHTLTHELKSPLAAIRG
                     ASELLQGEDMPADQRARFAGNIERESERLQQMIERLLNLARVEQMQALEDEQQVALAA
                     LVDELLLAHAARIEGAGLQVRQRVPATLRLLCDPFLMRQALANLLDNALDFTPEGGTL
                     LFDLERAGERVALSVFNQGQAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVM
                     QLHGGALAVDNVDGGVRVRLWLPLRRIS"
     gene            424381..425709
                     /locus_tag="PPUBIRD1_RS01840"
                     /old_locus_tag="PPUBIRD1_0366"
     CDS             424381..425709
                     /locus_tag="PPUBIRD1_RS01840"
                     /old_locus_tag="PPUBIRD1_0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589398.1"
                     /db_xref="GI:504402296"
                     /translation="MNKTLGFKLGMIAMLMLLLLIPLLLINGLIDDRQAMRDGVLRDI
                     AQSTSFDQQLSGPLLVVPYRKYQRRWIEKDGARTQETSTITGHLYFLPETFDADLGVD
                     TELRARGIYQARLFHAKGRISGRFKLPAHWGIDKDFDDYRFDKPFLVVGISDIRGIKS
                     ALELSMDEQKVPFEPGTQLDWMRGGVHASLPGLDGLQARAFSYGFDLALQGTGQLHVV
                     PVGRTSSVNMRANWPHPSFVGSYLPNRREIDAQGFSAHWQTSFFATNLEDALRQCAVG
                     GQCADFSERTFGVSFVDPVDQYLKSERAIKYALLFIALTFAGFFLFEVMKNLSVHPVQ
                     YILVGVALAFFYLLLLSLSEHIGFGLAYGLSASACVLLIGFYLSHVLRSRGRGVGFAA
                     GLAALYALLYGLLSAEDYALLMGSLLCFGLLGVFMVMTRRLDWARVGRAA"
     gene            complement(425876..426499)
                     /locus_tag="PPUBIRD1_RS01845"
                     /old_locus_tag="PPUBIRD1_0367"
     CDS             complement(425876..426499)
                     /locus_tag="PPUBIRD1_RS01845"
                     /old_locus_tag="PPUBIRD1_0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="WP_019437095.1"
                     /db_xref="GI:518266887"
                     /translation="MSTMTLFHSPLSPFVRKVMVVLHETGQLERVQLQPVNISPVSGD
                     PQLNLDNPIGKIPALRLEDGTVLHDSRVICEYLDMQHVGLPLLPREGSARWRRMTLVS
                     QADAIMDAAVSSRYESFLRPEDKRWDGWLQAQGDKIRRSLANLEQEHLPELISGFDLA
                     AIGVACALGYLDLRQPGFGWRERQPGLAAWYAEVVKRPSMVATAPVA"
     gene            complement(426503..427171)
                     /locus_tag="PPUBIRD1_RS01850"
                     /old_locus_tag="PPUBIRD1_0368"
     CDS             complement(426503..427171)
                     /locus_tag="PPUBIRD1_RS01850"
                     /old_locus_tag="PPUBIRD1_0368"
                     /EC_number="1.8.4.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B1JE82.1"
                     /note="Peptide methionine sulfoxide reductase msrA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase MsrA"
                     /protein_id="WP_014589400.1"
                     /db_xref="GI:504402298"
                     /translation="MVLRSEILVNKNVMPTAEQALPGRDTPMSLPEFHYVFKDTPLLG
                     PFFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFTPHPTYEEVCSGLTGHT
                     EVVLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDIGTQYRSAIYCTSPEQLEQAKA
                     SRDAYQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPDGYCGIGGTGVCLPPS
                     LQGN"
     gene            complement(427340..430030)
                     /locus_tag="PPUBIRD1_RS01855"
                     /old_locus_tag="PPUBIRD1_0370"
     CDS             complement(427340..430030)
                     /locus_tag="PPUBIRD1_RS01855"
                     /old_locus_tag="PPUBIRD1_0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589401.1"
                     /db_xref="GI:504402299"
                     /translation="MKSQPDAASRVAAEVVTQLPVPSRLGMLRFERLNEASWAMLYLD
                     PACERQFGLQTGELCALIDAPYASLMEPEARYRLHDEIQLQLAQRGYYRVRYTLHTPS
                     TSLRLLEAGEAYKQHNRQLLRGYLSVLDDQQEETGETGASDLESRNNRLQLALQLNQR
                     TQQEQLEHLERVRGQQDLILRLARHRYSADNSLLEAAQLITQSACEIYKVDCASIWHL
                     EDQRLEPIIAWYRDAQEHRQPEAIDASRFPDYLDALHASRAIDAHNAGHDPRTRALAQ
                     SMRPENKAMLDASIRVDGQVIGVLCLEQSGQPRAWQSDEIAFAGELADQFAQVITNHK
                     RRAAASALHLFQRAVEQSASAFLLVNRDGRVEYVNPSFTAITQYSTDEVQGRQLGELP
                     ALENLSELLFDSPSSLAMGNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGI
                     YEDVTQTKLAQQRIERLAYTDNLTNLGNRPAFIRSLDERFARDGESSMCLLLVDIDNF
                     KRINDSLGHQTGDKLLISLARRLRNSLHSGGILARFASNEFAVLLDDTSLEDGQGVAQ
                     QLLCTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLMKNAGLALHKAKANGKHQVQ
                     VFTEVLNAEASYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGLEALLRWNHPER
                     GMIRPDQFISVAEETGLIIPIGKWVVRQACCMSQQLRKAGLGNLHVAINLSPKQFSDP
                     DLVASISTILKEEALPPHLLELELTEGLLLEASEDTHRQLDELKALGLTLAMDDFGTG
                     YSSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMAHNLKLKVVAEGIETPE
                     QLAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA"
     gene            complement(430392..432032)
                     /locus_tag="PPUBIRD1_RS01860"
                     /old_locus_tag="PPUBIRD1_0371"
     CDS             complement(430392..432032)
                     /locus_tag="PPUBIRD1_RS01860"
                     /old_locus_tag="PPUBIRD1_0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007971816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrolipoamide acetyltransferase"
                     /protein_id="WP_003255652.1"
                     /db_xref="GI:489348544"
                     /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASM
                     EIPAPKAGVIKELKVKLGDRLKEGDELLVLEAEGAAAAAPEAPAAAAAPAAAPAPAAE
                     AAPAAPAAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASM
                     EIPSPAAGVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPAPAAAPAPAKAEAAPAA
                     APAAAAPAAAPAPAATAPAAGSNAKVHAGPAVRQLAREFGVELGAVAATGPHGRILKE
                     DVQVYVKAMMQKAKEAPAAAGATGGAGIPPIPAVDFSKFGEVEEVALTRLMQVGAANL
                     HRSWLNVPHVTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPD
                     FNSSLAPSGKAIIRKKYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKAR
                     TKKLSADEMQGACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPK
                     LMLPLSLSYDHRVINGAAAARFTKRLGDVLGDIRTMLL"
     gene            complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_RS01865"
                     /old_locus_tag="PPUBIRD1_0372"
     CDS             complement(432046..434691)
                     /gene="aceE"
                     /locus_tag="PPUBIRD1_RS01865"
                     /old_locus_tag="PPUBIRD1_0372"
                     /EC_number="1.2.4.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003171281.1"
                     /note="Pyruvate dehydrogenase E1 component; E1 component;
                     part of pyruvate dehydrogenase; forms a complex with DlaT
                     and LpdC; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase"
                     /protein_id="WP_014589402.1"
                     /db_xref="GI:504402300"
                     /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGS
                     QLPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHI
                     SSFASSATLYDIGFNYFFQAPTDEHGGDLVFFQGHASPGVYARAFMEGRISEDQMNNF
                     RQEVDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQK
                     VWCFMGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGV
                     FRGGGWNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVREHFFN
                     TPELKAMVEDLSDEEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGA
                     GEAKNTAHNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAA
                     LGGFVPQRRAKSFSVPTPPLETLKAILDGSGDREISTTMAFVRILAQLVKDKDIGQRI
                     VPIIPDEARTFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAG
                     AMSSFIAAGTSYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRT
                     TLNGEGLQHEDGHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYIT
                     VMNESYQQPAMPAGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILRE
                     EFNVGADVWSVTSFNELRRDGLAVERANRLKPGQKPQQTYVEQCLNGRKGPVIASTDY
                     MKLFAEQIRQWVPSKEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGE
                     IEPKVVADAIVKFGIDPDKRNPLDC"
     gene            435075..438008
                     /locus_tag="PPUBIRD1_RS01870"
                     /old_locus_tag="PPUBIRD1_0374"
     CDS             435075..438008
                     /locus_tag="PPUBIRD1_RS01870"
                     /old_locus_tag="PPUBIRD1_0374"
                     /EC_number="2.7.7.42"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QZ4.1"
                     /note="Glutamate-ammonia-ligase adenylyltransferase;
                     catalyzes the ATP-dependent addition of AMP to a subunit
                     of glutamine synthetase; also catalyzes the reverse
                     reaction - deadenylation; adenylation/deadenylation of
                     glutamine synthetase subunits is important for the
                     regulation of this enzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-synthetase adenylyltransferase"
                     /protein_id="WP_014589403.1"
                     /db_xref="GI:504402301"
                     /translation="MRLPLPSDLPATLQPLVTRNQQFISDAVAGHPELDLQAWSPLHR
                     QQFDQVAAASEFVLSLAQREPAMLFALLASGELERRYAPGELRGQIAATAQAAQSEDE
                     LARNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFG
                     TPIGNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLDNQEFFT
                     RLGQRLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAM
                     IKARVVAGDQAAGAQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMAENIK
                     LGAGGIREVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYE
                     FLRYTEHAIQAIADRQTQMLPEGETDQARVAYVLGFADWQSFHDQLMYWRGRIDWHFR
                     QVIADPDDEDGEGELVVGGEWSPLWEQAQDEEAAGRQLQEAGFKQPAEALRRLAGLRS
                     SPQLRSMQRIGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTE
                     NPGALRRLLTLCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRI
                     PEDDLEQQMEALRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWR
                     QTVARHGQPKRSDGSLCDPGFIIIGYGKMGGLELGHGSDLDLVFIHDGDPQAETDGAK
                     PIDSAQFFTRLGQRIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNE
                     AWTWEHQALVRARVLVGCKQVGAAFEGVRAKVLGQARDLEKLRAEVSEMRAKMRDNLG
                     TKATAAGTAANAFDAGVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRI
                     LEELEQANLMPASDAVLLREVYKAFRSASHRQALQKEAGVIDAAQFADERREVRRIWG
                     ELGLS"
     gene            438211..439260
                     /locus_tag="PPUBIRD1_RS01875"
                     /old_locus_tag="PPUBIRD1_0375"
     CDS             438211..439260
                     /locus_tag="PPUBIRD1_RS01875"
                     /old_locus_tag="PPUBIRD1_0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="WP_010951695.1"
                     /db_xref="GI:499254155"
                     /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPI
                     LERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIP
                     KRTGWRGEMRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPNLQIEAQS
                     RDAALAKFGLELDRPVLALCPGAEFGEAKRWPAEHYAAVADAMIRQGWQVWLFGSKND
                     HPVGEQIRDRLIPGLREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRP
                     LVAVYGSTSPGFTPPLAEQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALH
                     SLSGPDLIDTVAEVD"
     gene            439261..440319
                     /locus_tag="PPUBIRD1_RS01880"
                     /old_locus_tag="PPUBIRD1_0376"
     CDS             439261..440319
                     /locus_tag="PPUBIRD1_RS01880"
                     /old_locus_tag="PPUBIRD1_0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016714542.1"
                     /note="lipopolysaccharide heptosyltransferase I; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose:LPS heptosyl transferase"
                     /protein_id="WP_014589404.1"
                     /db_xref="GI:504402302"
                     /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEI
                     PSWHPAVDQVIPVAIRRWRKNLWQTIKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWL
                     TRYVKAPVAGLDRYSAREGWASRFYDRPLSVATGQHAVERVRQLFAMALAYDLPEGIG
                     NYGLDLDRLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPA
                     EKARAERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTISLF
                     GPTNPGLTGAYGRTQIHQASDWPCAPCLQKKCTYKPRADDLARFDLKREWPLCFTRLN
                     PEHVASRLSALLLAEDVR"
     gene            440319..441443
                     /locus_tag="PPUBIRD1_RS01885"
                     /old_locus_tag="PPUBIRD1_0377"
     CDS             440319..441443
                     /locus_tag="PPUBIRD1_RS01885"
                     /old_locus_tag="PPUBIRD1_0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497649.1"
                     /note="catalyzes the addition of the first glucose residue
                     to the LPS core; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosyltransferase"
                     /protein_id="WP_003255647.1"
                     /db_xref="GI:489348539"
                     /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGD
                     IPPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGC
                     FEDKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVE
                     RFHLLPPGISQDRRAPANAAEIRAEFRKEFNLGDDDLLLVQIGSGFKTKGVDRSLKAL
                     AALPSALRKRTRLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADLLIH
                     PAYNENTGTVLLEALVAGLPVLVSKVCGYAHYIAEADSGLVLDEPFEQDQLNGYLQRM
                     LEDPQARASWSRNGLAFADSADLYSMPQHAADVILGQKTA"
     gene            441440..442246
                     /locus_tag="PPUBIRD1_RS01890"
                     /old_locus_tag="PPUBIRD1_0378"
     CDS             441440..442246
                     /locus_tag="PPUBIRD1_RS01890"
                     /old_locus_tag="PPUBIRD1_0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470538.1"
                     /note="lipopolysaccharide kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide core heptose(I) kinase RfaP"
                     /protein_id="WP_014589405.1"
                     /db_xref="GI:504402303"
                     /translation="MKLILAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTEVA
                     GEGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWRAIQRLHEVGVPTMTAVAYGERG
                     NNPAAQHSFIITEELAPTISLEDFSIDWVKQPPEPRLKRALIAEVAKMTGGMHRAGVN
                     HRDCYICHFLLHTDRPVTADDFKLSVIDLHRAQTRARISRRWRDKDLAALYFSALDIG
                     LTQRDKLRFLRGYFQRPLRQVLKDEAALLAWLERKAQKLYDRKQRYGDAL"
     gene            442246..442980
                     /locus_tag="PPUBIRD1_RS01895"
                     /old_locus_tag="PPUBIRD1_0379"
     CDS             442246..442980
                     /locus_tag="PPUBIRD1_RS01895"
                     /old_locus_tag="PPUBIRD1_0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lipopolysaccharide kinase"
                     /protein_id="WP_014589406.1"
                     /db_xref="GI:504402304"
                     /translation="MASWTLAPGYEHLAADFGSLDAVFALQGERLTRDPLSEVVRIER
                     DGINYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERNGLAF
                     GRGAMITRELPRTEDLSALAEHNDARLADRAWVDHVSRQLARHTRVMHEHRFAHNDLK
                     WRNLLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQ
                     YRGRDRLNVRDKKRIHRVLGFFEGRE"
     gene            442977..443729
                     /locus_tag="PPUBIRD1_RS01900"
                     /old_locus_tag="PPUBIRD1_0380"
     CDS             442977..443729
                     /locus_tag="PPUBIRD1_RS01900"
                     /old_locus_tag="PPUBIRD1_0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008095935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide kinase"
                     /protein_id="WP_014589407.1"
                     /db_xref="GI:504402305"
                     /translation="MTDYLASADLALLKRHGLDNFEALWALQLDAVDEPNTGRGGWSS
                     VFRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLRIPALQAVFYGE
                     RKQGGTHRAILMTRALDEWADLDSLLAQWPRLGEAERTGILQACGQLARTLHSAGQVH
                     GCFYPKHIFLRQRREGWDAQLIDLEKTRPLLFGMRDRLKDLEPLLRRAQAWRVQDVRT
                     LLATYLGQPADGALVDTWLQRLTQRRREKEAR"
     gene            443729..445171
                     /locus_tag="PPUBIRD1_RS01905"
                     /old_locus_tag="PPUBIRD1_0381"
     CDS             443729..445171
                     /locus_tag="PPUBIRD1_RS01905"
                     /old_locus_tag="PPUBIRD1_0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide kinase"
                     /protein_id="WP_014589408.1"
                     /db_xref="GI:504402306"
                     /translation="MRLSELKDAGRSPALPLSITLVDAAGSADLQLLSLLRVLPGQRY
                     VGAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPTLLADGLKEGEGGWL
                     LFEFLDGAQSLADAWAAVENLPVLADEQHLVLGEALTAVAHMHARGLWQEDLHLDNLL
                     RHAGKLYLIDGAGIRAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLAN
                     AEHALPLEALQKQVDKVRNWRQKDYLDKAGRECSLFSVQRTLSGLQAIRRSEVQAMQP
                     VLEQADALIDKGHLYKTGGAASVARIEVNGRQLVIKRYNIKNTAHWFKRFWRPSRAWH
                     SWIEGHRLEFLDIATPRPLAVLEQRVLGLRSRAYLVTEFVDGPDLTACFAPYVESGDA
                     PEEQVDALVHVMQQLIRERISHGDFKGHNLFWHNGQWSLIDLDAMCQHATQLSFAPAY
                     ARDRARLLRNWPNGSALHQRLDRLLPKLVD"
     gene            complement(445190..447976)
                     /locus_tag="PPUBIRD1_RS01910"
                     /old_locus_tag="PPUBIRD1_0382"
     CDS             complement(445190..447976)
                     /locus_tag="PPUBIRD1_RS01910"
                     /old_locus_tag="PPUBIRD1_0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589409.1"
                     /db_xref="GI:504402307"
                     /translation="MRPLEQLEQIDRQIGDLLDGIPTLALQHPINPDTRTWLHGELAS
                     FWTTADEHGETPRQKLLALRKALMLAEVELRLGDETLGYRSADQLWACLQQPLPSQRR
                     HMPLAKRPQVYRVLLEGLRPNWRSYLPGTLIIVAGTAEGHMLTPQDAAGAALLCSLSQ
                     GIEAFDSLGALHQELCERLEDPLQSRPLLHLYTDTQADRARRSQRLRYDWYADSLLEA
                     QIDSVIETQRQRLSDTSLWSNGSPDQHTRIHKALALWPEVGAKPILQTRYSQLLEKNL
                     PNWLRNTSAQGLSHMMQAMQTLVAIAEQAAAPGVLSLNDFKQRNSLLAWANARLRERL
                     SHDLGYDTDPREIKIVVVRARRTGAIMHPFALSSYVTYAGMRRVGHEMVEMVEEINTL
                     EEIALKNLPWFDTDYWLTARVIHAHGKAMPAGLTPQYVKHMVRELNVGDSYAKYLHTQ
                     LISSRAGKWRLTAHSKVNRARMHAEAVKARYAGHFGEDPFEHGYNWVRAVLDQPHNAL
                     RAPVAGYPVTVRQLNIMGHTLQGVLLLNSLPYKSPACVLYTPDAPDRRAWRRFRTTRE
                     LLRTLRQQPALRAYVAQRLPLLPAATVQRLLDKGRLSTHLTTPEVKDDLFFDYYMAEA
                     RALIAQADADSMTTSEVNAESVMALSWRLLDFISLLLPNRALLVLSIGRMAIDILDGI
                     EAFNQEDVEGVMRHSYQALSHLNDAGTSFLGSRVLRRSLRGIPKQPPLPLPARFQAQP
                     DSSSLRYRIDGIYGEGVYEQSSAFGGLSLYFVKDSNNRYYQVSFDGYRWRAIDPDQPD
                     AYLQQPLKRKADGQWVIDSPVLWYDGLPDLTQLLQDCYLQTPVAGLPVNIEQGLFQAD
                     EQLYLALENGQLPVRRHLLPDHYHLQIAVASNAGVVPWAVLRHENGQWLIRVRQAGRS
                     SDWLTLPDQPPPAH"
     gene            complement(448044..448229)
                     /locus_tag="PPUBIRD1_RS01915"
     CDS             complement(448044..448229)
                     /locus_tag="PPUBIRD1_RS01915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011953272.1"
                     /db_xref="GI:500574395"
                     /translation="MSHRSQATARLFAWPALIALLGFLGLFAALLGDGGWDVLAWAGL
                     GLPALLSLRGLLWRRGR"
     gene            complement(448226..449338)
                     /locus_tag="PPUBIRD1_RS01920"
                     /old_locus_tag="PPUBIRD1_0384"
     CDS             complement(448226..449338)
                     /locus_tag="PPUBIRD1_RS01920"
                     /old_locus_tag="PPUBIRD1_0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255633.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_014589410.1"
                     /db_xref="GI:504402308"
                     /translation="MKSPTIRRWSLIHTWSSLVCTLFLLLLAVTGLPLIFHHELEHLL
                     GDAPELREMPAGTPHLDLQQLVLKAEQHRPGEVMQYFGYDEDEPNGVVAITAATAGTD
                     PNLSHTFMLDARTGEAVAMPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAI
                     VSGTVLYAPFMRRLEFGTVRHKKSRRLRWLDLHNLIGVVTLAWALTVSVTGVISALSD
                     LVIAAWRNDSLAAMVAPYRDAPPLVERAPATRLLDIAEQAAPGMRPDFIAFPGTRFSS
                     EHHYAVFMNGATHLSSHLFTPVLIDARTLAVTAVGNRPWYMDAMGLSQPLHFGDYGGR
                     PMQILWALLDVLTIIVLGSGLYLWWGKQRKPREARA"
     gene            complement(449395..451827)
                     /locus_tag="PPUBIRD1_RS01925"
                     /old_locus_tag="PPUBIRD1_0385"
     CDS             complement(449395..451827)
                     /locus_tag="PPUBIRD1_RS01925"
                     /old_locus_tag="PPUBIRD1_0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014860430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_014589411.1"
                     /db_xref="GI:504402309"
                     /translation="MSRAVDHILRPSLMALAIGLAAPLTSPVLFAAEQSTSRAYNLPS
                     APLATTLNQIASQAGIALAIDPALVSGRTSAPVSGQYDGLGALQAALSGTGLQLQQST
                     AGSYSLVAVPDGTLALPETTVNATSTSEIAWGPVEGYVAKRTAAGTKTDTALVEVPRS
                     ISVATREQMKDRGVHSLDDAVRYMPGIVSASFGSDTRYDWMRVRGFEPTQFLDGLPLP
                     RGVYANPKAETWNLDRLALLRGPASSIYGQTPPGGLLDMVSRRPQAESAHEIELQYGS
                     DNHRQINFASTGKIDDEGRFLYGVSGVIRDSGTQIDHIDNKRYNIAPSLTWNIDEDTT
                     LTFLTQFTRDDTGATSQFRPIQGTKIDMPFGKISHHKNLGDPDYEFYDRTYYALGYAF
                     EHRINDVWQFRQNLRYTKSDLSFQTITPGSYNKSSPPVQDDGTVSRMSTNTDEDISQF
                     AVDNNFQADFATGDIDHTLLIGLDHQRINTNYLSIFDFNVPDSNVNNPVYGLPITRPD
                     RSTAFYDYNQKTRQTGLYVQDQMALGNWRLTLGGREDWVHTGTKFFNQGDATNTQRDK
                     KFSGNAAISYVFDSGFVPYLSYAESFQPSSNASVSASDSFKPTEGKQWELGVKYQPPG
                     SNTLLSAAVYDLTQKNVSVTNTVGGVTITSQTGEVKVRGLELEAVSDVTDNLKVIAAY
                     TLAKSEVQDGDFKGNRLQLMPNQQASIWGDYTWHSGVLDGFGIGLGARYTGNTYGDQG
                     NTYLGKAKAYTVFDGSVHYDLGRLNGSLKGASVAVTATNLLNKDYLSTCDSYYCYYGD
                     ERSVVASATYKF"
     gene            complement(452080..453036)
                     /locus_tag="PPUBIRD1_RS01930"
                     /old_locus_tag="PPUBIRD1_0387"
     CDS             complement(452080..453036)
                     /locus_tag="PPUBIRD1_RS01930"
                     /old_locus_tag="PPUBIRD1_0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589412.1"
                     /db_xref="GI:504402310"
                     /translation="MSNLPVSSRVLEAAIAWKLSLGDSSGTPDERSEFMRWHAASEEH
                     ARAWRQLGAMDQRVSAAAGPARQALLQSRASLRRRIGKVGGGLAGTFLLGALLAWVGA
                     PSLAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGAQRVIVLHQGEISV
                     ETGHQDPRPLLVRTEDGRLRPLGTRFLVRREAGGTRLEVLQASVAAMPHDSGDEQVLR
                     EGQQVLMNANGLGEVGTVPAGADAWTRGMLVVDNVRLGDLLATLGQYRSGYLGVDAKV
                     ADLRVTGSFPLTNTDLALASLVPALPVKIERHTQWWVNVTSK"
     gene            complement(453033..453551)
                     /locus_tag="PPUBIRD1_RS01935"
                     /old_locus_tag="PPUBIRD1_0388"
     CDS             complement(453033..453551)
                     /locus_tag="PPUBIRD1_RS01935"
                     /old_locus_tag="PPUBIRD1_0388"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016714553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor"
                     /protein_id="WP_010951704.1"
                     /db_xref="GI:499254164"
                     /translation="MSSAQSPHADLVGALYRDHRGWLLAWLQRSMACRQRAEDLSQDT
                     FVRLLGREQLDTPREPRAFLAAVAKGLMFDHFRRAALEQAYLAELALIPEAEQPSPEM
                     QHLILEDLKAIDRLLGKLSSKARAAFLHSRLDGMGHAEIAERLGVSVSRVRQYIAQGM
                     RQCYVALYGEPT"
     gene            complement(453699..454409)
                     /locus_tag="PPUBIRD1_RS01940"
                     /old_locus_tag="PPUBIRD1_0389"
     CDS             complement(453699..454409)
                     /locus_tag="PPUBIRD1_RS01940"
                     /old_locus_tag="PPUBIRD1_0389"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="WP_014589413.1"
                     /db_xref="GI:504402311"
                     /translation="MSLFAWLRPSAPELDHATRQRLARLPKPVPLGVCTLREQRWVVL
                     DLETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPSAL
                     AAGCDPAEALLDLLDFIGNSPVLAFHAPFDQRMLARALKESLGYRLQSPFLDIAELAP
                     MLNPDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQ
                     LEQRLRGWRRRKMQSHGL"
     gene            complement(454406..456343)
                     /locus_tag="PPUBIRD1_RS01945"
                     /old_locus_tag="PPUBIRD1_0390"
     CDS             complement(454406..456343)
                     /locus_tag="PPUBIRD1_RS01945"
                     /old_locus_tag="PPUBIRD1_0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008095359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic nucleotide-binding protein"
                     /protein_id="WP_014589414.1"
                     /db_xref="GI:504402312"
                     /translation="MSKKDAYSQAGKTAVLQNIQGTLQFLQRFPPFNQMEHSHLAFLV
                     EQCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLAKPGVETTFEITSGECFP
                     LAALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQ
                     VRQRAVETLGTQYSLNTPLGELAMRHPVVCSANTPLREAVRLMHEQQVGSIVVVDPQR
                     YPIGIFTLRDLRQVVATIDADLGAAIDRHMTAKPFYLPPQASAFDAAMAMTERHIAHV
                     CLVENRRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAH
                     GASSTQITQIITLLNDHTVCRVIELALAERGDPGVPFSWLCFGSEGRREQTLHTDQDN
                     GILFEAVDSAEADAIRARLLPLAQYINQCLAQCGFTLCMGNVMAGNPELCLSRSEWAR
                     RFAGFVREASPENLLGSSIYFDLRVVWGDEQGCEQLRQGLLAQVADNRIFQRMMADNA
                     LRQRPPVGRLREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGIAACNTLERL
                     RQLVAKGVIEPLDGAAYEEAYHFIQQTRMQQHQRQIRDNLPYSNRLDPDSLNHLDRRI
                     LRESLRQAQRLQSSLALRYQL"
     gene            456460..457005
                     /locus_tag="PPUBIRD1_RS01950"
                     /old_locus_tag="PPUBIRD1_0391"
     CDS             456460..457005
                     /locus_tag="PPUBIRD1_RS01950"
                     /old_locus_tag="PPUBIRD1_0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020192755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_019437059.1"
                     /db_xref="GI:518266851"
                     /translation="MSALVKDPTKGETGYASNAVLMLKRNFFDEMSMPEHTDILSDAE
                     REALAVINQNAPVAARPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHY
                     QKRIGLMITDLRMQPESGLDLIRTIRASERAALSIIVVSGDTDVEEAVDVMHLGVVDF
                     LLKPVDLGKLLELVNKELKIG"
     gene            complement(457051..459228)
                     /locus_tag="PPUBIRD1_RS01955"
                     /old_locus_tag="PPUBIRD1_0392"
     CDS             complement(457051..459228)
                     /locus_tag="PPUBIRD1_RS01955"
                     /old_locus_tag="PPUBIRD1_0392"
                     /EC_number="2.3.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970550.1"
                     /note="Malate synthase G; catalyzes the formation of
                     malate from glyoxylate and acetyl-CoA; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="WP_014589416.1"
                     /db_xref="GI:504402314"
                     /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIN
                     DLAPKNKALLAKRDELQAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATT
                     QNVDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGY
                     NKIRGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNTGLRDDAQL
                     IGFHGDAAAPTAVLLKHNGLHFEIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDS
                     VAAVDADDKVIVYRNWLGLMKGDLAESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGR
                     SLLFVRNVGHLMTNPAILDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRSGSVY
                     IVKPKMHGPEEVAFAAEIFSQVEDLLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAER
                     VAFINTGFLDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQ
                     IGKGMWAMPDLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELA
                     SRTPASVDDILAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDIN
                     NVGLMEDRATLRISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDPLYRPMAP
                     NFDDNVAFQAAVELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
     gene            459678..460196
                     /locus_tag="PPUBIRD1_RS01960"
                     /old_locus_tag="PPUBIRD1_0393"
     CDS             459678..460196
                     /locus_tag="PPUBIRD1_RS01960"
                     /old_locus_tag="PPUBIRD1_0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein R"
                     /protein_id="WP_014589417.1"
                     /db_xref="GI:504402315"
                     /translation="MDHLVLTVIAPDKAGQVERIAQCIADHSGNWLESRMSRMAGQFA
                     GILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIV
                     RDITRLLAELQVNVERFSTEVRPAPMSSEPLFHADALLALPLTLPLDELQQKLESLAD
                     DLMVELKLRAED"
     gene            complement(460521..461408)
                     /locus_tag="PPUBIRD1_RS01965"
                     /old_locus_tag="PPUBIRD1_0394"
     CDS             complement(460521..461408)
                     /locus_tag="PPUBIRD1_RS01965"
                     /old_locus_tag="PPUBIRD1_0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437061.1"
                     /note="RarD protein, DMT superfamily transporter; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589418.1"
                     /db_xref="GI:504402316"
                     /translation="MHAANPRRGYILGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVL
                     WSALFGSLLLLVWKHPGWWRELRNNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEA
                     SLGYYINPLINVLLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALS
                     FGFYGLIRKQAPVAALPGLVVETWMLVPLAIGWLLLHPAAMSAQGAFYTSSEALWLMA
                     AGPVTLVPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVVLFDEHLSSSTLAAFMFI
                     WAGLAIYSVDAWLNLRKRS"
     gene            complement(461473..462446)
                     /locus_tag="PPUBIRD1_RS01970"
                     /note="serine/threonine protein kinase; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(462605..463369)
                     /locus_tag="PPUBIRD1_RS01975"
                     /old_locus_tag="PPUBIRD1_0397"
     CDS             complement(462605..463369)
                     /locus_tag="PPUBIRD1_RS01975"
                     /old_locus_tag="PPUBIRD1_0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ModE family transcriptional regulator"
                     /protein_id="WP_014589421.1"
                     /db_xref="GI:504402319"
                     /translation="MSLPPVLTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAA
                     WDAIDELNNLASQPLVKRSTGGRGGGGAHLSPEGERVLRLYQRLQALQAQILEAAEES
                     GDLDLLGRLMLRTSARNQLQGQVSGLRPEGRYDRVSLALGGGLEIDALITHDSTARLE
                     LTLGTMVVALLKAGWVRLLAEGEEAEAGSNCLCTKVEEVLAEVDGPSEVRLALGNGQT
                     LCAMADAHWLAAQQVVDGSVVRVQFHPSYVLIGVPA"
     gene            complement(463419..464150)
                     /locus_tag="PPUBIRD1_RS01980"
                     /old_locus_tag="PPUBIRD1_0398"
     CDS             complement(463419..464150)
                     /locus_tag="PPUBIRD1_RS01980"
                     /old_locus_tag="PPUBIRD1_0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidophosphoribosyltransferase"
                     /protein_id="WP_014589422.1"
                     /db_xref="GI:504402320"
                     /translation="MNCQLHWKRLVYKCSLINQKCLLCDEPAEQHYPLCITCEQALPW
                     LGDQCRHCALPLPMAGLTCAPCGRCLPAFDQVIALWHFGFPVDTLISRFKHNRQWPLG
                     RLMAELLGQGLLYRYAEGLPRPDLLLPVPLARRRLRERGFNQAGMLGRWLSSHVGVTC
                     NERLLVRTRETPAQQHLGAKARQRNLRQAFAVKGELEGKHVAIVDDVLTTGATAQAIA
                     QALRKAGARRVDVYCLARTPKPGYV"
     gene            464240..465298
                     /locus_tag="PPUBIRD1_RS01985"
                     /old_locus_tag="PPUBIRD1_0399"
     CDS             464240..465298
                     /locus_tag="PPUBIRD1_RS01985"
                     /old_locus_tag="PPUBIRD1_0399"
                     /EC_number="2.8.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009681528.1"
                     /note="Biotin synthase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_014589423.1"
                     /db_xref="GI:504402321"
                     /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFDPN
                     RVQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRF
                     CMGAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQEQTKALAQAGLDYYNHNL
                     DTSPEFYGSIITTRTYSERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANL
                     PEHPESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNE
                     QMQALAFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIE
                     QALVEQRSSEMFYDAATA"
     gene            465300..466472
                     /locus_tag="PPUBIRD1_RS01990"
                     /old_locus_tag="PPUBIRD1_0400"
     CDS             465300..466472
                     /locus_tag="PPUBIRD1_RS01990"
                     /old_locus_tag="PPUBIRD1_0400"
                     /EC_number="2.3.1.47"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QX1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_004577120.1"
                     /db_xref="GI:490714385"
                     /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCS
                     NDYLGLANHPEVIAAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALL
                     FSTGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDPASLASRL
                     DKAVGNTLVVTDGVFSMDGDLADLPALADVARARGAWLMVDDAHGLGTLGAQGGGIVE
                     HFGLGVDDVPVLIGTLGKACGTAGAFVAGSEALIEALVQFARPYIYTTSQPPALACAT
                     LKSLELLRRETWRREHLAALIRQFREGAQQLGLQLMDSPTPIQPIVIGDSAQALRLSR
                     LLRERGLLVTAIRPPTVPAGSARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
     gene            466465..467196
                     /locus_tag="PPUBIRD1_RS01995"
                     /old_locus_tag="PPUBIRD1_0401"
     CDS             466465..467196
                     /locus_tag="PPUBIRD1_RS01995"
                     /old_locus_tag="PPUBIRD1_0401"
                     /EC_number="3.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577121.1"
                     /note="carboxylesterase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_014589424.1"
                     /db_xref="GI:504402322"
                     /translation="MRNRLVLLPGWGLGTAALEPLAASLRAQDARLQVELMPLPELAH
                     SDVQAWIDHLDRKLPNNVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPSFLARPD
                     WPHGMAEDTFGTFLDGCRNHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPDTDPLYL
                     ATGLEVLAKLDTREALQAYDGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSS
                     HAFLLEYPQELAAGIKSFLHESGDD"
     gene            467189..468007
                     /locus_tag="PPUBIRD1_RS02000"
                     /old_locus_tag="PPUBIRD1_0402"
     CDS             467189..468007
                     /locus_tag="PPUBIRD1_RS02000"
                     /old_locus_tag="PPUBIRD1_0402"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-CoA O-methyltransferase"
                     /protein_id="WP_014589425.1"
                     /db_xref="GI:504402323"
                     /translation="MTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVGLSL
                     LEQLPAGLQPSHWLDLGSGTGHFSRMLAERFAQASGVAVDIAEGMLLHARHVKGGAQY
                     HVVGDAERLPLRDGSIDLVFSSLAVQWCDQFASVLAEAQRVLCPGGVLAFSSLCVGTL
                     DELRASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELERCPHVLHYPDVRSLTHEL
                     KALGAHNLNPGRPSGLTGRARMQGLLQAYEAFRQPAGLPATYQVVYGVLRKPQV"
     gene            468018..468698
                     /locus_tag="PPUBIRD1_RS02005"
                     /old_locus_tag="PPUBIRD1_0403"
     CDS             468018..468698
                     /locus_tag="PPUBIRD1_RS02005"
                     /old_locus_tag="PPUBIRD1_0403"
                     /EC_number="6.3.3.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dithiobiotin synthetase"
                     /protein_id="WP_003255605.1"
                     /db_xref="GI:489348497"
                     /translation="MSQAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGC
                     TMTPKGLRNSDALALIDESTVKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAA
                     MRNVLQQNADFTLIEGAGGWRVPLSGLENLSDLAVALRLPVILVVGVRLGCISHALLS
                     AEAIERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAE
                     HLQLDLLD"
     gene            468911..469207
                     /locus_tag="PPUBIRD1_RS02010"
                     /old_locus_tag="PPUBIRD1_0404"
     CDS             468911..469207
                     /locus_tag="PPUBIRD1_RS02010"
                     /old_locus_tag="PPUBIRD1_0404"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003258614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589426.1"
                     /db_xref="GI:504402324"
                     /translation="MEITGSSAYYAGLSAIQTGQNRVDQAASQIANTTAERTATSQSS
                     DFQAERLRAVDRSQQMDLATSVVQQAVGKTEVELGAKVVKASDEMLGRIIDTYA"
     gene            469496..471301
                     /locus_tag="PPUBIRD1_RS02015"
                     /old_locus_tag="PPUBIRD1_0405"
     CDS             469496..471301
                     /locus_tag="PPUBIRD1_RS02015"
                     /old_locus_tag="PPUBIRD1_0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_010951720.1"
                     /db_xref="GI:499254180"
                     /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILE
                     EGAKFCEQVLSPLNRVGDQEGCTWSESGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGG
                     QGLPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTAEQQHTYLTKLVSGEWT
                     GTMCLTEPHCGTDLGMLRTKAEPQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLP
                     DAPAGTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGY
                     LIGPANKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPD
                     KAADPIIVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAF
                     LTPIAKAFMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALD
                     LLGRKVLMTQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMA
                     AMKDREEVGAASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARF
                     YFQRILPRTRTHVATMLSGANNLMAMDEEHFGLSY"
     gene            471675..472958
                     /locus_tag="PPUBIRD1_RS02020"
                     /old_locus_tag="PPUBIRD1_0406"
     CDS             471675..472958
                     /locus_tag="PPUBIRD1_RS02020"
                     /old_locus_tag="PPUBIRD1_0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589427.1"
                     /db_xref="GI:504402325"
                     /translation="MFRLNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPT
                     LVLLLGGAYCAVYRRQRELFLMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCL
                     LLPALFGLYGAWQERTHLLQDLVARGAVLFAVGSVAVALQQSYPEALLTWLAEIRWPA
                     LHGHWMSLIQMVYPLFLGVFILLVVQYLRAPRPLHAAQLIGLLGIFWMLPQTFILPFT
                     LNIMCSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDH
                     FKKFNDTHGHDVGDQVLRLVASRLSKVTGGGRAYRYGGEEFALVFAGKTAAECVPHVE
                     AVREVIANYVMHLRDQHNRPQDDTAGRQRRAGSTGGTVSVTISIGVAERQADHRNPEA
                     VLKSADQALYSAKGAGRNCVMVHGRQSLRGAVRTA"
     gene            473083..474861
                     /locus_tag="PPUBIRD1_RS02025"
                     /old_locus_tag="PPUBIRD1_0407"
     CDS             473083..474861
                     /locus_tag="PPUBIRD1_RS02025"
                     /old_locus_tag="PPUBIRD1_0407"
                     /EC_number="1.3.8.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_014589428.1"
                     /db_xref="GI:504402326"
                     /translation="MADYKAPLRDMRFVLNEVFNVAEQWTQLPGLAEVVDADTAIAVL
                     EEAGKVTARTIAPLSRAADEEGCHWDNGAVRTPAGFIEAYNTYAEGGWVGVGGDPLFG
                     GMGMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKEKYLPNMYAGVW
                     AGSMCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKL
                     PDAPAGPKGISLFLVPKFLVNEDGSLGARNPATCGSIEHKMGIQASATCVMNFDEAVG
                     YIVGEPNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPTGPQAK
                     DKAADPIIVHPDVRRMLLTMKALIEGGRAFSTYVAMQLDSAKYSEDASVRKRSEELVA
                     LLTPVAKAFLTDLGLECAVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQAL
                     DLMGRKVVASGGAYYKLFSDEIRQFINRAGSELDEFTKPLGASLDQLDGLTEWVLQQA
                     KGNPNEIGAASVEYLHAFGYVAYGYMWALMARAAQAGEGDAPFYSGKLGTARFYFARL
                     LPRVDSLVASVKAGSESLYLLDAEQF"
     gene            complement(475200..476123)
                     /locus_tag="PPUBIRD1_RS02030"
                     /old_locus_tag="PPUBIRD1_0408"
     CDS             complement(475200..476123)
                     /locus_tag="PPUBIRD1_RS02030"
                     /old_locus_tag="PPUBIRD1_0408"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_003255599.1"
                     /db_xref="GI:489348491"
                     /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLD
                     LSLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVR
                     PSLIPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGNLDIGISYLPPRQPGLHGLLL
                     YEDELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPQVQ
                     AEMNNMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDAQ
                     RQQASVELLRTLLEEETDARLLGASPLDVLA"
     gene            476335..477615
                     /locus_tag="PPUBIRD1_RS02035"
                     /old_locus_tag="PPUBIRD1_0409"
     CDS             476335..477615
                     /locus_tag="PPUBIRD1_RS02035"
                     /old_locus_tag="PPUBIRD1_0409"
                     /EC_number="2.6.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014860211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine aminotransferase"
                     /protein_id="WP_014589429.1"
                     /db_xref="GI:504402327"
                     /translation="MNLFNLRRSAPAAVAEPKCAPVIVPHATELSPERLMPGAERAAQ
                     VFVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNR
                     GLLGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITASQACHG
                     RSLGALSASDPLPCNRCEPGLPGFSKVPFNDLAVLHAEVDSRTVAIMLEPIQGEAGVI
                     PATQEYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGG
                     VPLAALLARGKACCAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLR
                     EGLSRLTGRYGQGEVRGHGLLWALQLKENLARELVAAALHEGLLLNAPQVDVVRFSPA
                     LTVSKGNIDEMLLRLARAFARLHAQQQARREVPA"
     gene            477763..477921
                     /locus_tag="PPUBIRD1_RS02040"
                     /old_locus_tag="PPUBIRD1_0410"
     CDS             477763..477921
                     /locus_tag="PPUBIRD1_RS02040"
                     /old_locus_tag="PPUBIRD1_0410"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012316587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003177654.1"
                     /db_xref="GI:489269914"
                     /translation="MDFIRIIIAILLPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVH
                     AVYIIAKR"
     gene            complement(477984..479807)
                     /locus_tag="PPUBIRD1_RS02045"
                     /old_locus_tag="PPUBIRD1_0411"
     CDS             complement(477984..479807)
                     /locus_tag="PPUBIRD1_RS02045"
                     /old_locus_tag="PPUBIRD1_0411"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S9"
                     /protein_id="WP_014589430.1"
                     /db_xref="GI:504402328"
                     /translation="MIETPVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWNEFRPAD
                     GACRIWHWLHYQARCLTPDGFSVRSRVYEYGGGSFCPGGDGLVFVNEKDQQVYTQPLD
                     DLLPRALTQDASCRYGDVQWHDGHVLAVEERHAEHVEHRLVALGDSSREVLAEGADFY
                     ASPTVSADGQRLAWIEWDRPAQPWTVTRLMCSVRDASGHWGPAQCVAAAEESLQQPRF
                     DAEGRLYCLSDRNGFWQPWGEVDGQWQALPAAPADHAAAPWQLGTCTWLALGPQSYLA
                     SWFEDGFGQLGLRGEDGRMERFASAYTRFRSLAMDSEHLYAIAASPISPPAVIAIDRS
                     NHEVRVLAGGAEILPAGQISLPQSIHYGSDGEQAHGFFYPPAQSKSAAPLVVFIHGGP
                     TSACYPVLDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALNQRWGESDVADACAVVE
                     YLAAQGLVDKQKAFIRGGSAGGYTTLCALAFHDVFRAGASLYGVSDPIALGRATHKFE
                     GDYLDWLIGDPQRDTERYRQRTPLLHAQRIKVPVIFFQGELDAVVVPEQTRAMLAALQ
                     ANGIDAEGYFYAQERHGFRKAENLAHALEEEWKFYCRVLAQ"
     gene            complement(479773..480933)
                     /locus_tag="PPUBIRD1_RS02050"
                     /old_locus_tag="PPUBIRD1_0412"
     CDS             complement(479773..480933)
                     /locus_tag="PPUBIRD1_RS02050"
                     /old_locus_tag="PPUBIRD1_0412"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqE"
                     /protein_id="WP_014589431.1"
                     /db_xref="GI:504402329"
                     /translation="MPNTGSSSPELPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDF
                     AAQGQELSTEQWFKVMAEAREMGAAQIGFSGGEPLVRQDLAELIGEARRLGYYTNLIT
                     SGIGLTEARIADFKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGY
                     PMVLNFVTHRHNIEKIDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTRAQLER
                     AERITNEYRDKLKAEGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHG
                     ARQLPVQFPNVRDHDLHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFM
                     LTGDASNADPVCAKSTEHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
     gene            complement(480905..481180)
                     /locus_tag="PPUBIRD1_RS02055"
                     /old_locus_tag="PPUBIRD1_0413"
     CDS             complement(480905..481180)
                     /locus_tag="PPUBIRD1_RS02055"
                     /old_locus_tag="PPUBIRD1_0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004375207.1"
                     /note="with PqqC converts a biosynthetic intermediate to
                     pyrroloquinoline quinone; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Coenzyme PQQ synthesis protein D 1"
                     /protein_id="WP_010951728.1"
                     /db_xref="GI:499254188"
                     /translation="MSFDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNDSASLI
                     GGLIDGQRDVAAIISELEQQFPGVPEVADDIEQFMEVARAEHWIVLA"
     gene            complement(481177..481932)
                     /locus_tag="PPUBIRD1_RS02060"
                     /old_locus_tag="PPUBIRD1_0414"
     CDS             complement(481177..481932)
                     /locus_tag="PPUBIRD1_RS02060"
                     /old_locus_tag="PPUBIRD1_0414"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A5VXG6.1"
                     /note="Required in the synthesis of PPQ, but its exact
                     function is unknown; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline-quinone synthase"
                     /protein_id="WP_003255592.1"
                     /db_xref="GI:489348483"
                     /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQ
                     GWVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQ
                     AVGLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDS
                     WPQHYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDIL
                     WSMLDAMSMAYELNRPPYHSVTQERVWHKGITL"
     gene            complement(482095..483006)
                     /locus_tag="PPUBIRD1_RS02065"
                     /old_locus_tag="PPUBIRD1_0415"
     CDS             complement(482095..483006)
                     /locus_tag="PPUBIRD1_RS02065"
                     /old_locus_tag="PPUBIRD1_0415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755119.1"
                     /note="Coenzyme PQQ synthesis protein B; possibly involved
                     in transport of pyrroloquinoline quinone transport;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein B"
                     /protein_id="WP_014589432.1"
                     /db_xref="GI:504402330"
                     /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIAL
                     SDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLRE
                     GCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFP
                     LRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLL
                     VDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPI
                     LDEDSPERAEVLRRGVEVAFDGMSIEL"
     gene            complement(483316..485616)
                     /locus_tag="PPUBIRD1_RS02070"
                     /old_locus_tag="PPUBIRD1_0416"
     CDS             complement(483316..485616)
                     /locus_tag="PPUBIRD1_RS02070"
                     /old_locus_tag="PPUBIRD1_0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439093.1"
                     /note="Coenzyme PQQ synthesis protein F; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_014589433.1"
                     /db_xref="GI:504402331"
                     /translation="MPDAIRQLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPAKW
                     PGLAHFLEHLFFLGTLRFPLEDGLMRYVQALGGQVNASTRERATDFFFEVPPNALGGG
                     LERLCQMLAEPNLGIERQRREREVIHAEFIAWSRNPSAQQQFALLQSVSAKHPLGAFH
                     AGNRYTLALHDAAFQQALAGFHQRFYQGGQICLSLCGPQPLDELERLARQHAELFAAG
                     ERVPQMLPPPLPAIASSLTFTHQGLPSGAEHALELLFAYLEDSRPGTWLGALRERGWL
                     QRFTAERLYAFAGQLLWHLDLKLSADACPDEASALLQGWFKFIRQADREQLNHQFGLL
                     QRSRAHSASALELARRDSTGQPFAKLDTQGLQALGALLESLPGGDHGDWQLLPVDPLL
                     KADLPHAKTQPLPAAMKISDQLPPARQFAALYLRWHVPSPLRQPLERVLEQALAPLQE
                     RCDRASVQLQYSSAGEYWQLRCAGLPAAVLRAVEQALALMLKPPASCWLPCTAQPPAL
                     IPIRALLKQLPDAVRGSVPEVVPACTLTQQQLDSLWLHTEWHGMAAGFEDTALNALGT
                     ALLQCPGQGSRPSPLPSWANHRWQHAHVPGSEHALLLFCPLPAAKEAAGRLLAQLLQG
                     PVYQRLRVDLQLGYAVFSAFRQIEGVGGLLFGVQSPHTAQAQVLDHLLSLLRHGVTLD
                     PAARQALAGQFDEPAMADADVAEWAWQTHLATQADRLDVLRRSILTTRQTDLDHLLSD
                     LLDPGSAWLCLANAAAPDTSWQGENR"
     gene            complement(485757..486551)
                     /locus_tag="PPUBIRD1_RS02075"
                     /old_locus_tag="PPUBIRD1_0417"
     CDS             complement(485757..486551)
                     /locus_tag="PPUBIRD1_RS02075"
                     /old_locus_tag="PPUBIRD1_0417"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-nitrogen hydrolase"
                     /protein_id="WP_014589434.1"
                     /db_xref="GI:504402332"
                     /translation="MRIALYQGAPKPLDVPGNLQRLLHQAQLAAERGAQLLVCPEMFL
                     TGYNIGLAQVERLAEAADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDA
                     HGRSLSNYRKTHLFGELDRSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLAL
                     DGAELILVPTANMTPYDFTCQVTVRARAQENQCYLVYANYCGAEDEIQYCGQSSIIGP
                     DGSLLAMAGRDECQLLAELEHERVVQGRRAFPYLTDLRQELHLRKG"
     gene            complement(486566..488248)
                     /locus_tag="PPUBIRD1_RS02080"
                     /old_locus_tag="PPUBIRD1_0418"
     CDS             complement(486566..488248)
                     /locus_tag="PPUBIRD1_RS02080"
                     /old_locus_tag="PPUBIRD1_0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amine oxidase"
                     /protein_id="WP_003255585.1"
                     /db_xref="GI:489348476"
                     /translation="MNKKNRHPADGKKPITIFGPDFPFAFDDWLEHPAGLGSIPAERH
                     GEEVAIVGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIVAELGGMR
                     FPVSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKPTDLPQLFHEVA
                     DAWADALESGAQFADIQQAIRDRDVPRLKELWNKLVPLWDDRTFYDFVATSRSFAKLS
                     FQHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHV
                     PERCVHWPEGTSLSTLHGGAPRTGVKRIARAADGRLAVTDNWGDTRHYSAVLATCQTW
                     LLTTQIDCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLLSMTLT
                     DRLTRGTYLFDNGNDKPGVICLSYSWMSDALKMLPHPVEKRVQLALDALKKIYPKTDI
                     AGHIIGDPITVSWEADPYFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGIFIAGD
                     DVSWTPAWVEGAVQTSLNAVWGIMNHFGGHTHPDNPGPGDVFNEIGPIALAD"
     gene            complement(488588..489049)
                     /locus_tag="PPUBIRD1_RS02085"
                     /old_locus_tag="PPUBIRD1_0419"
     CDS             complement(488588..489049)
                     /locus_tag="PPUBIRD1_RS02085"
                     /old_locus_tag="PPUBIRD1_0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_003255583.1"
                     /db_xref="GI:489348474"
                     /translation="MSDSRSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNS
                     RLERLEKNKVISGYGVRLGQSVIGGGLQAYVGIKVQPRSGKDVVRRLSAMGQVQQLCA
                     VSGEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPL"
     gene            489237..489791
                     /locus_tag="PPUBIRD1_RS02090"
                     /old_locus_tag="PPUBIRD1_0420"
     CDS             489237..489791
                     /locus_tag="PPUBIRD1_RS02090"
                     /old_locus_tag="PPUBIRD1_0420"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589435.1"
                     /db_xref="GI:504402333"
                     /translation="MNLDHLLECWRLEVSNKKRPGRPISLLFNVLRRARKDNKLRFLF
                     AYRLAQYLDARGGLARRHARRMQQRLNLKYGVDIDIGAQIAPGLRIAHLPGVVITRYV
                     SIGRNFFIRQNCSIGIKTLGLDEYALRIGDNVSMGANSCIVADRIDIGDDVVIGAMSL
                     VTRDIPPGMTFYNPRQVEMRPGGG"
     gene            complement(490356..490432)
                     /locus_tag="PPUBIRD1_RS02095"
                     /old_locus_tag="PPUBIRD1_t0061"
     tRNA            complement(490356..490432)
                     /locus_tag="PPUBIRD1_RS02095"
                     /old_locus_tag="PPUBIRD1_t0061"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(490396..490398),aa:Met,seq:cat)
     gene            complement(490449..494192)
                     /locus_tag="PPUBIRD1_RS02100"
                     /old_locus_tag="PPUBIRD1_0423"
     CDS             complement(490449..494192)
                     /locus_tag="PPUBIRD1_RS02100"
                     /old_locus_tag="PPUBIRD1_0423"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589437.1"
                     /db_xref="GI:504402335"
                     /translation="MSLKPAILLLILILWNTTAGALTLTDEENAWLAAHPQLKLGVDA
                     SWPPFEFRDQEGRYQGLAADYIAMIQQRLGVTFKPVEPSSWTEVLVQARESRIDLLPG
                     IMSTPERQGFLAFTRPYLDFPIVILAHKGGAQPRKLADLYGLKIAVVENYAPHELLRT
                     HHPDLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQ
                     LAMAVPRDKSVLVGILDKVMADMSSSEISQIQQHWVGNVVDQRMFWSDLLVYGLPTVL
                     LLMAVLAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTY
                     SYVSPHAEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIR
                     ADGQPLWVRNIVSMIEHGHQPVMRGLMIDISETKRTEDALRLSEQKFASVFQQCPDIL
                     LIARHSDGCLLEVNEAFEEQIGLPPDQVIGRTATDLDLWGVEGSGPLLLERLHQGGIR
                     NLEMSFRRSNGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQQQLQTSEEKFAKA
                     FHASPDGLLLSRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRLVD
                     QLNRDGFVRDFTCHIRRSDGQIRLCELSARPLPITGVDCMLTIARDITERHLMQEKLQ
                     LAATVFENTAEGVLITDIDQRISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFY
                     LAMWHQLTAEGHWQGEIYNKRKNGELYPSWLTISAVRNSDREITHFVAVFADISSIKH
                     AQAKLDYQAHHDPLTGLPNRTLFENRLQGVLTCAQVSNRQGAVLFLDLDRFKHINDSL
                     GHPVGDLLLKGIAQRLKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACF
                     NAPFQAGEHEFFTSASIGISLYPQDGTDVSTLIRNADAAMYRSKAKGRNRVEAYTRDL
                     TAQASERIALEHELRRAVERNEMSLCFQPKLSLKTQSLVGAEALIRWSHPTFGEVPPE
                     HFIHLAEENGTILQLGDWVLEQACRQMQAWKQHYEPFGPLSINLAGAQLRHPHLARRI
                     EQLLKHHQLKAGDLQLEITENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSY
                     LKRLPLDILKIDKSFIRGLPDDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLA
                     AEGCEQIQGYIVSLPLPPEEFAAAFLRIALSDLSDGTGAKPSL"
     gene            complement(494320..496170)
                     /locus_tag="PPUBIRD1_RS02105"
                     /old_locus_tag="PPUBIRD1_0424"
     CDS             complement(494320..496170)
                     /locus_tag="PPUBIRD1_RS02105"
                     /old_locus_tag="PPUBIRD1_0424"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016393217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_003255578.1"
                     /db_xref="GI:489348469"
                     /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVE
                     DIIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRM
                     YMREMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRL
                     SDVLSGYIDPDDNIAAPTEEVPIPGAKAAAAKEESDDDEEESESGDDEEEAESGPDPV
                     VAAQRFGAVSDQLQATSKVLKKNGRNHKESIEALQALADLFMPIKLVPKQFEVLVERV
                     RDALNRLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALG
                     EKNAAIVACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARRAKKEMVEANLRLVIS
                     IAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQA
                     RTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPI
                     SMETPIGDDEDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRF
                     GIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
     gene            complement(496238..498219)
                     /locus_tag="PPUBIRD1_RS02110"
                     /old_locus_tag="PPUBIRD1_0426"
                     /note="DNA primase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(498525..498740)
                     /gene="rpsU"
                     /locus_tag="PPUBIRD1_RS02115"
                     /old_locus_tag="PPUBIRD1_0427"
     CDS             complement(498525..498740)
                     /gene="rpsU"
                     /locus_tag="PPUBIRD1_RS02115"
                     /old_locus_tag="PPUBIRD1_0427"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88A58.1"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_003255575.1"
                     /db_xref="GI:489348466"
                     /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAE
                     RKRKAAAAVKRHAKKVQREQRRAVRLY"
     gene            498945..499970
                     /locus_tag="PPUBIRD1_RS02120"
                     /old_locus_tag="PPUBIRD1_0428"
     CDS             498945..499970
                     /locus_tag="PPUBIRD1_RS02120"
                     /old_locus_tag="PPUBIRD1_0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970580.1"
                     /note="Probable O-sialoglycoprotein endopeptidase;
                     universal genome maintenance protein; Kae1/Qri7/OSGEP/YgjD
                     family protein; in Archaea, some Kae1 are found as fusion
                     proteins similar to two distinct proteins in yeast that
                     are involved in the KEOPS complex; kinase associated
                     endopeptidase 1 (Kae1) and a serine/threonine protein
                     kinase (Bud32); in Pyrococcus Kae1 has atypical AP
                     endonuclease activity and inhibits the kinase activity of
                     Bud32; the protein is essential in Escherichia coli and
                     Bacillus subtilis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA N6-adenosine threonylcarbamoyltransferase"
                     /protein_id="WP_014589440.1"
                     /db_xref="GI:504402338"
                     /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVP
                     ELASRDHVKRMLPLIRQVLDEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAW
                     DIPAIGVHHMEGHLLAPMLEENPPEFPFVALLVSGGHTQLVRVDGIGQYELLGESLDD
                     AAGEAFDKTAKLIGLNYPGGPEIARLAEQGVPGRFVFPRPMTDRPGLEFSFSGLKTFA
                     LNTWQQCRNAGDDSEQTRCDLSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSAN
                     KALRASLEDMLGSIKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQQQDLAISVQARWP
                     MEQLPPL"
     gene            complement(499988..500557)
                     /locus_tag="PPUBIRD1_RS02125"
                     /old_locus_tag="PPUBIRD1_0429"
     CDS             complement(499988..500557)
                     /locus_tag="PPUBIRD1_RS02125"
                     /old_locus_tag="PPUBIRD1_0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QU5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_014589441.1"
                     /db_xref="GI:504402339"
                     /translation="MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNML
                     RLAGRKLAILTLLGDLCKGLLPVLLARAAGLDLHAQAWVGICAVLGHLFPLYFRFKGG
                     KGVATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEAL
                     LPISVLTVMIVWRHRNNLRDLFAGRERHF"
     gene            500632..500988
                     /locus_tag="PPUBIRD1_RS02130"
                     /old_locus_tag="PPUBIRD1_0430"
     CDS             500632..500988
                     /locus_tag="PPUBIRD1_RS02130"
                     /old_locus_tag="PPUBIRD1_0430"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="WP_004576188.1"
                     /db_xref="GI:490713401"
                     /translation="MDRVFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAG
                     DDLNLALDYASVSARIQAFAEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAV
                     PAARGGVGVEIERGCL"
     gene            500979..501488
                     /locus_tag="PPUBIRD1_RS02135"
                     /old_locus_tag="PPUBIRD1_0431"
     CDS             500979..501488
                     /locus_tag="PPUBIRD1_RS02135"
                     /old_locus_tag="PPUBIRD1_0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016715762.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="WP_003255569.1"
                     /db_xref="GI:489348460"
                     /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQA
                     VGIKSGPFINFVVTGQTALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLH
                     GTFDGLVLPRAEILKNAFVLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFE
                     WRGLQLTPA"
     gene            complement(501736..502842)
                     /locus_tag="PPUBIRD1_RS02140"
                     /old_locus_tag="PPUBIRD1_0432"
     CDS             complement(501736..502842)
                     /locus_tag="PPUBIRD1_RS02140"
                     /old_locus_tag="PPUBIRD1_0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576190.1"
                     /note="Multifunctional CCA protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA nucleotidyl transferase"
                     /protein_id="WP_014589443.1"
                     /db_xref="GI:504402341"
                     /translation="MHIYKVGGAVRDRLLGRPFSDIDWLVVGATVEEMLAKGYRPVGA
                     DFPVFLHPKTGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLIRRDLTINAMAEDE
                     AGTVYDPYQGKNDLDQRLLRHVSPAFAEDPLRVLRVARFAARYAPLGFRVADETLALM
                     RQISASGELQALTAERSWKEIERALMEVQPQVFFKVLSACGALQELLPELDDGSRTLA
                     ALEQAAAHEQPLHVRWACLLRGLPPTSIKAVNQRLKAPRECQELAMLAGECLAQGNQA
                     LELPATALLELLQKFDVYRRPQRFEDFLAVCEMAARGDGKQGYPQADYLRGAAAAARA
                     VDVKPLVQAGLTGQALGEALKGERLKALEAYQRG"
     gene            complement(502898..504466)
                     /locus_tag="PPUBIRD1_RS02145"
                     /old_locus_tag="PPUBIRD1_0433"
     CDS             complement(502898..504466)
                     /locus_tag="PPUBIRD1_RS02145"
                     /old_locus_tag="PPUBIRD1_0433"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497701.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVR family protein"
                     /protein_id="WP_010951740.1"
                     /db_xref="GI:499254200"
                     /translation="MTARAQRRQPISTGSEWTFELIQTYDREISRLAERYALDTYPNQ
                     IEVITAEQMMDAYASVGMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIA
                     YLMEENTMCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEER
                     HGIDAVEDLIDSCHALMNYGVDRYKRPYPISAEEERRRQQEREEHLQRQINDLWRTIP
                     KNAEKGNDRDEGRFPAEPQENILYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQ
                     VMNEGWATFWHYTLMNDLYDEGLITEGFMMEFLQSHTSVVFQPGFDSPYYSGINPYAL
                     GFAMYTDIRRMCENPTEEDRHWFPEIAGSDWLSTIKFAMSSFKDESFILQYLSPKVMR
                     DLKLFSILDDDQRDDLLVPAIHDEAGYRVIREQLAAQYNLGNREPNVQIWSVDRRGDR
                     SLTLRHQQHNRKPLGDSTDEVLKHLHRLWGFDIHLETVQGEQVMSTHHMPPRGEHSES
                     ADYGRMDLAVIHHL"
     gene            complement(504463..505734)
                     /locus_tag="PPUBIRD1_RS02150"
                     /old_locus_tag="PPUBIRD1_0434"
     CDS             complement(504463..505734)
                     /locus_tag="PPUBIRD1_RS02150"
                     /old_locus_tag="PPUBIRD1_0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019097137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255564.1"
                     /db_xref="GI:489348455"
                     /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIM
                     DMEHGEQISIPGRDIDEPVLHHGRGGKQTIVHPGNKEFTAGEHIPRPQGGGGGGGRGK
                     AGNSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRHLTGADTFKTVRAGIANEGNPS
                     RINIVRTLRSAHARRIALTGSSRALLREAQKELDRLRVEEPDNFTDIQEVEQEIERLK
                     ARINRLPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYL
                     FLKRNYERIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPASD
                     WNIYAAQASDGDNWNDDSPICRDILSKQIMPHVQYYTYVEITPREHQALWYEYERIGD
                     AFPDTFAQQQLVSAGDIYPVFRELFQRRLAT"
     gene            complement(505890..507812)
                     /locus_tag="PPUBIRD1_RS02155"
                     /old_locus_tag="PPUBIRD1_0435"
     CDS             complement(505890..507812)
                     /locus_tag="PPUBIRD1_RS02155"
                     /old_locus_tag="PPUBIRD1_0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020295462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PrkA family serine protein kinase"
                     /protein_id="WP_003255563.1"
                     /db_xref="GI:489348454"
                     /translation="MSIFSHFQQRFESTRQEELSLQEYLELCKEDRSAYASAAERLLL
                     AIGEPELIDTSTNSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEK
                     KQILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNATEDGAILEEE
                     FGIPRRYLNTIMSPWATKRLQEFGGDISKFKVVKLYPSILNQIAIAKTEPGDENNQDI
                     SALVGKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQ
                     EGNYNSTEGLGAIPYTGILLAHSNESEWHTFRNNKNNEAFIDRIYIVKVPYCLRVSDE
                     IKIYDKLLVNSSLSKAHCAPDTLKMLAQFTVLSRLKEPENSNIYSKMRVYDGENLKDT
                     DPKAKSIQEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQI
                     EQEQFPAEVRERYLRYLKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADF
                     WIQDQEYRDPETGEILNRIALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGK
                     NPSWLSYEKLRVVIEKKMFSNTEDLLPVISFNAKASKEDQKKHNDFVTRMVERGYTDK
                     QVRLLSEWYLRVRKSQ"
     gene            complement(508095..508427)
                     /locus_tag="PPUBIRD1_RS02160"
                     /old_locus_tag="PPUBIRD1_0436"
     CDS             complement(508095..508427)
                     /locus_tag="PPUBIRD1_RS02160"
                     /old_locus_tag="PPUBIRD1_0436"
                     /EC_number="2.8.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QT9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiosulfate sulfurtransferase GlpE"
                     /protein_id="WP_010951742.1"
                     /db_xref="GI:499254202"
                     /translation="MSEFKRIPPEQALELRKKEGAVVVDIRDPQAFAAGHITGARHLD
                     NHSVADFIRNADLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPA
                     ETAQGNAE"
     gene            complement(508442..509308)
                     /locus_tag="PPUBIRD1_RS02165"
                     /old_locus_tag="PPUBIRD1_0437"
     CDS             complement(508442..509308)
                     /locus_tag="PPUBIRD1_RS02165"
                     /old_locus_tag="PPUBIRD1_0437"
                     /EC_number="3.6.1.41"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470209.1"
                     /note="Bis(5'-nucleosyl)-tetraphosphatase, symmetrical;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diadenosine tetraphosphatase"
                     /protein_id="WP_014589444.1"
                     /db_xref="GI:504402342"
                     /translation="MATYAVGDLQGCLQPLKCLLDRVSFNPAVDRLWLVGDLVNRGPE
                     SLETLRFLYSIRHSLVCVLGNHDLHLLAAWHNVERLKKSDTLREIIEAPDADQLFDWL
                     RQQKLLHYDEPRGIALVHAGIPPQWTLGKALELAAEVEEVLRDDTRLQLYLDGMYGNE
                     PNKWSKNLAGVERLRVITNYFTRMRFCTADGKLDLKSKEGLGSAPKGYKAWYAHKDRR
                     SRHVKIIFGHWAALQGEVTEPDVIALDTGCVWGGAMTLYNVDSGQYHRCDCADDGTLR
                     QPAQPTTLNDHT"
     gene            complement(509308..509688)
                     /locus_tag="PPUBIRD1_RS02170"
                     /old_locus_tag="PPUBIRD1_0438"
     CDS             complement(509308..509688)
                     /locus_tag="PPUBIRD1_RS02170"
                     /old_locus_tag="PPUBIRD1_0438"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019099225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein ApaG"
                     /protein_id="WP_003255559.1"
                     /db_xref="GI:489348450"
                     /translation="MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSA
                     KLLSRHWLITNGDGEVEEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQM
                     FAEDGKRFDAEIAPFRLAVPGALH"
     gene            complement(509886..510689)
                     /locus_tag="PPUBIRD1_RS02175"
                     /old_locus_tag="PPUBIRD1_0439"
     CDS             complement(509886..510689)
                     /locus_tag="PPUBIRD1_RS02175"
                     /old_locus_tag="PPUBIRD1_0439"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QT6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal RNA small subunit methyltransferase A"
                     /protein_id="WP_003255558.1"
                     /db_xref="GI:489348449"
                     /translation="MNEQYQHRARKRFGQNFLHDAGIIDRILRAINAKAGEHLLEIGP
                     GQGALTEGLLGSGAQLDVVELDKDLVPILQHKFADRSNFRLHQGDALKFDFNQLGVPP
                     RSLKVVGNLPYNISTPLIFHLLSHAGLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIM
                     VQYHCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPFPAKDHLLLERVVREAFNQR
                     RKTLRNTMKGLLDSAAIEAAGVDGSLRPEQLDLAAFVRLADQLADQQQA"
     gene            complement(510686..511675)
                     /locus_tag="PPUBIRD1_RS02180"
                     /old_locus_tag="PPUBIRD1_0440"
     CDS             complement(510686..511675)
                     /locus_tag="PPUBIRD1_RS02180"
                     /old_locus_tag="PPUBIRD1_0440"
                     /EC_number="1.1.1.262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_014589445.1"
                     /db_xref="GI:504402343"
                     /translation="MKPLRFAVTPGEPAGIGPDLCLLLAADAQPHPLIAITSRDLLAE
                     RATQLGLAVSLLPVAPGQWPDLPAPAGSLYVWDTPLAAPVVPGQLDKANAAFVLETLT
                     RAGQGCLDGHFAGMITAPVHKGVINESGIAFSGHTEFLAELTRTAQVVMMLATRGLRV
                     ALVTTHLPLRDVADAITAERVERVTRILHADMRDKFGIANPRILVCGLNPHAGEGGHL
                     GREEIDIIEPTLARLRTEGMDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYK
                     GFGAAVNVTLGLPIIRTSVDHGTALDLAGTGKIDTGSLRVALETAYQMAENRP"
     gene            complement(511672..512991)
                     /locus_tag="PPUBIRD1_RS02185"
                     /old_locus_tag="PPUBIRD1_0441"
     CDS             complement(511672..512991)
                     /locus_tag="PPUBIRD1_RS02185"
                     /old_locus_tag="PPUBIRD1_0441"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone SurA"
                     /protein_id="WP_014589446.1"
                     /db_xref="GI:504402344"
                     /translation="MKTKLIDRLRPVLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQ
                     SQLDQRVHEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELN
                     QAIGTIAQRNGMSLDQFRAALARDGLSFEDAREQVKREMIISRVRQRRVAERIQVSEQ
                     EVKNFLASDLGKMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFG
                     QMAIANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLE
                     EKRGGSENVLRDEVHVRHILIKPSEIRSEAATQQLAERLYDRIKNGEDFGELAKSFSE
                     DPGSALNGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDS
                     TEQAREQQALGVLRNRKYDEELQTWLRQIRDEAYVEIKLPGADQAAQ"
     gene            complement(512972..515779)
                     /locus_tag="PPUBIRD1_RS02190"
                     /old_locus_tag="PPUBIRD1_0442"
     CDS             complement(512972..515779)
                     /locus_tag="PPUBIRD1_RS02190"
                     /old_locus_tag="PPUBIRD1_0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS-assembly protein LptD"
                     /protein_id="WP_014589447.1"
                     /db_xref="GI:504402345"
                     /translation="MALKSPAFRRKFPLLVTGGLLALQPLATSYVVAAEQFDCQVSAA
                     GGWDCKPKTPVNNLPPRPVHEGAAVSSGTEAAGEAETADRPMLVTEAKGRGLKSRSED
                     YSHLDWVPREKLTAAQLAETGPYCGGAYIEPTRPGMADTTPKDESPTYINAKVSKYQQ
                     EQQIATLAGDVVMRQGSMQAEADEANLYQAENRGELKGNVKIRDNGSLVVGDEAQIQL
                     DTGEAQVDNAEYVMHKSHIRGSALYAKRGENAIIRLKDGTYTTCEPGSNAWQLKGNNI
                     TLNPATGFGTATNVTLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSTSSDTGFMLVT
                     PYYFNLAPNYDATLYPRYMAKRGLLMEGEFRYLTPSSEGQFGGAYLNDKNDDRKDQTD
                     YKDQRWMVNWQHKGGLDERLMTEVDYTDISDPFYFQDLESDQIGVESRDLLNQQGALT
                     YRGDSYTARLNVHAYEMATISQITPYDRLPQLTLNGTLPFQPGGLNLGYETEAVRFDR
                     DLKDDFVLDEDGNPDASAGVPGRRLDENIFGVARANGTRLNVAPSISLPMEASYGYIT
                     PKLKYMYTHYDLDLDSKGKSDIAGANADTLDVFGDYKSNLNRDIPIFSVDSGLYFDRN
                     TSLFGTNYRQTLEPRMFYLYVPYKDQMDIPLFDTGETLFSYDSLFRDNRFSGTDRIGD
                     ENKLSLGVTTRWIEENGFERQNFSIGQAYYFKDRKVQLPGIDYRTRKDAQSDVSPYAL
                     VYNYYFNRDWRFNSDFNWDPDSRSTRSGSAMFHYQPEDNPNKIVNLGYRYRNDTIAYD
                     STTGTWKVGGGDYGTPGDPNYIKDYYKIQQHDFSVIWPIVPQWNVIARWQHDYNRNRT
                     LEAMGGFEYDNCCWKLRLINRYWIDYDDFSQALPQNEKGDHGVFLQIVLKGLGGVVGN
                     KVESFLDQGIQGYREREDQAY"
     gene            515910..516929
                     /locus_tag="PPUBIRD1_RS02195"
                     /old_locus_tag="PPUBIRD1_0443"
     CDS             515910..516929
                     /locus_tag="PPUBIRD1_RS02195"
                     /old_locus_tag="PPUBIRD1_0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_014589448.1"
                     /db_xref="GI:504402346"
                     /translation="MPEHDVRLQQLTVWLDEQLNDLFRDNAWGEVPAGSLTAASSDAS
                     FRRYFRWQGAGHSFVIMDAPPPQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLL
                     GDLGTQTYLDIINADNADGLFADAIDALLKFQRLPMDAPLPSYDDALLRREVELFPEW
                     YVGRELGLSLTDAQKATWQRVSQLLIDSALAQPKVLVHRDYMPRNLMQSTPNPGVLDF
                     QDAVYGPVTYDITCLFKDAFVSWPQARVEGWLSDYWQQAQAAGIPVHAEFEAFHRASD
                     LMGVQRHLKVIGIFARICHRDGKPRYLGDVPRFFAYINEVIGRRPELAELGELIAELQ
                     AGARA"
     gene            516926..517597
                     /locus_tag="PPUBIRD1_RS02200"
                     /old_locus_tag="PPUBIRD1_0444"
     CDS             516926..517597
                     /locus_tag="PPUBIRD1_RS02200"
                     /old_locus_tag="PPUBIRD1_0444"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanylyltransferase"
                     /protein_id="WP_010951745.1"
                     /db_xref="GI:499254205"
                     /translation="MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAA
                     GVTEVVINHAWLGQQIEDHLGDGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFL
                     LVNGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVVDGDDAPGTLTF
                     SGISVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESL
                     IGERA"
     gene            517599..518366
                     /locus_tag="PPUBIRD1_RS02205"
                     /old_locus_tag="PPUBIRD1_0445"
     CDS             517599..518366
                     /locus_tag="PPUBIRD1_RS02205"
                     /old_locus_tag="PPUBIRD1_0445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755131.1"
                     /note="heat shock protein DnaJ domain protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_014589449.1"
                     /db_xref="GI:504402347"
                     /translation="MWWPGTVIGVGAGFAVANIPGALLGALLGQAIDRRLRLQGWEDM
                     RERLGGRPALRDDELLFVMLGRLAKCDGRVAEQHIQQARQEMVRLDLAEAARLRAINA
                     FNRGKAGKDRLGGHLRRISQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLG
                     MSRRQVQAMSLEYEPRKATGAESVPMTYAAALRLLAVDADTDTDKVKQAYRRLVSRHH
                     PDKLAGTGASEAQVREATARTRELHQAYAMIRKRRGL"
     gene            complement(518393..519391)
                     /locus_tag="PPUBIRD1_RS02210"
                     /old_locus_tag="PPUBIRD1_0446"
     CDS             complement(518393..519391)
                     /locus_tag="PPUBIRD1_RS02210"
                     /old_locus_tag="PPUBIRD1_0446"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589450.1"
                     /db_xref="GI:504402348"
                     /translation="MSTLYRTTLAMCCLASVLPLGALAADAEKPPANTMAPAAEAPRP
                     PLLERSQEDALALERLLPKAEQQTLQAGADSFLALWKPANDNDPQGAVIIVPGAGETA
                     DWPNAVGPLRQKFPDIGWHSLSVSLPDLLADSPQARVEATPPAAPAPDKGESAPVKDV
                     PADANANVAQATAADADTADSTDAEQASEQADPADAERIFARLDAAVAFAQQHNTRSI
                     VLIGHGSGAYWAARYLSEKQPPQVQKLVMVAAQTPARVEQDLESLAPTLKVPTADIYY
                     ATRSADRNAAQQRLQASKRQKDSQYRQLSLIAMPANKAAEQEQLFRRVRGWMSPQG"
     gene            519487..521874
                     /locus_tag="PPUBIRD1_RS02215"
                     /old_locus_tag="PPUBIRD1_0447"
     CDS             519487..521874
                     /locus_tag="PPUBIRD1_RS02215"
                     /old_locus_tag="PPUBIRD1_0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_019439101.1"
                     /db_xref="GI:518268893"
                     /translation="MKRVRRLLVIGCLWLPLIAWAKPEALPTVVLEPDQQQWLDTHRS
                     LRVGLVLQAPYAQFDRRLQQLYGANVELVNSLAQTLRLDLTWRNFSDQASLEHALQSG
                     EIDFAPGLTQTPASLRLWLFSDPYMRVPQLVVGPRTGAMAVELEKLEAEQRVAVRMPS
                     PLADYLRSNYGNLNLQGVPDDREALQLVVGGQASFAVLDEAQLSRLSRESEFSELAVV
                     GDIGLPQLLRIGSRRDWPLLADVLERGLQALPAKELEQLHQRWLQPKYPRLSESPGFW
                     QNMALLFGLLLLCALATLVWQRRQQRQLERSLLAARESLVERQVREEALRLSQFAIDQ
                     STVGILWVNWDSHVRYANHAAERMLGYSEGALLERPLSDFEPSLNMDRWLELWKGART
                     GAGGVGQFETQCRRADQSLLPVELSLSFLRFRDSEYLVVYLADVTERHRALAALRESE
                     ARLKGIAGNVPGLVFRLERDPAEGDLEFPYISEGSEALVGYAPSEIQHPQMGLRNLVH
                     PEDRADYHRVQDLALASDQDWSWQGRILTRQGEQRWADIKASARHLGNGQVVWDGVVW
                     DITQGKRAELALAKSQEQLRELSAHLESVREEEKARIAREVHDELGQMLTVLKLEVSM
                     CELAYAELDPGLNDRLASMKRLIAQLFQLVRDVATALRPPILDAGIASAIEWQARRFE
                     ARTQIPCLVQVPDNLPALSDAKATGLFRILQEALTNVMRHAQAHSVEIELVREGGQLR
                     MTVSDDGQGFCREQTRPTSFGLVGVRERVLMLGGSMTLESEPGEGTSLSVAIPLE"
     gene            521885..522514
                     /locus_tag="PPUBIRD1_RS02220"
                     /old_locus_tag="PPUBIRD1_0448"
     CDS             521885..522514
                     /locus_tag="PPUBIRD1_RS02220"
                     /old_locus_tag="PPUBIRD1_0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_010951749.1"
                     /db_xref="GI:499254209"
                     /translation="MIRVLVAEDHTIVREGIKQLIGLAKDMQVAGEAGNGEQLLETLR
                     HTPCEVVLLDISMPGVNGLEAIPRIRALHDAPAILMLSMHDEAQMAARALKAGAAGYA
                     TKDSDPALLLTAIRRVAGGGRYIDPSLADRMVFEVGLTESRPLHTLLSEREFSVFERL
                     AQGANVNDIAQQLALSSKTISTHKARLMQKLKVNSLAELVKYAMEHKLI"
     gene            522810..523934
                     /locus_tag="PPUBIRD1_RS02225"
                     /old_locus_tag="PPUBIRD1_0449"
     CDS             522810..523934
                     /locus_tag="PPUBIRD1_RS02225"
                     /old_locus_tag="PPUBIRD1_0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_003255547.1"
                     /db_xref="GI:489348438"
                     /translation="MSEAKSNAATGETLVSFRGVQKSYDGESLIVKDLNLDIRKGEFL
                     TLLGPSGSGKTTSLMMLAGFETPTAGEIQLGGRSINNVPPHKRDIGMVFQNYALFPHM
                     TVAENLAFPLTVRNLSKTDISERVKRVLNMVQLDAFAKRYPGQLSGGQQQRVALARAL
                     VFEPQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAV
                     FHQGEIQQIADPRTLYEEPCNTFVANFIGENNRISGTLLASDGKRCQVQLPRGERVEA
                     LAVNVGQAGEPVTLSIRPERVRLNGHSESCVNRFSGRVAEFIYLGDHVRVRLEVCGKG
                     DFFVKQPIAELDPALAVGDVVPLGWEVEHARALDPIAEAH"
     gene            523975..525009
                     /locus_tag="PPUBIRD1_RS02230"
                     /old_locus_tag="PPUBIRD1_0450"
     CDS             523975..525009
                     /locus_tag="PPUBIRD1_RS02230"
                     /old_locus_tag="PPUBIRD1_0450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010221457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589452.1"
                     /db_xref="GI:504402350"
                     /translation="MRKQLKLTALALGLFTAGQAMAADLTVISFGGANKAAQVKAFYE
                     PWEKAGNGKIVAGEYNGEMAKVKAMVDTKSVSWNLVEVESPELARGCDEGMFEELDPA
                     LFGNKDDYVPGAIQPCGVGFFVWSTVMAYNADKLKTAPTSWADFWDTKQFPGKRGLRK
                     GAKYTMEFALMADGVAPKDVYKVLATKEGQDRAFKKLDELKPSIQWWEAGAQPPQFLA
                     SGDVVMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKNVEEAKKFIAYSVK
                     PEQQKIYSENIAYGPANSKAVSLLSDEVKKDMPTTPENIANQVQIDVTFWADNSEQLE
                     QRFNAWAAKK"
     gene            525070..526317
                     /locus_tag="PPUBIRD1_RS02235"
                     /old_locus_tag="PPUBIRD1_0451"
     CDS             525070..526317
                     /locus_tag="PPUBIRD1_RS02235"
                     /old_locus_tag="PPUBIRD1_0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007904292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589453.1"
                     /db_xref="GI:504402351"
                     /translation="MAIAVPLNEGAGPSLKQRLKHAERVNRWKAQALIAPLALFLLLV
                     FLVPIAALLYKSVGNPEVVAGLPRTVEVISQWDGKSLPGEDVYKALSQDLAESRKNQT
                     LGDLSKRLNMELAGYRSLLTKTARALPFKAEPASYKEALQAVDERWGDPAYWQAIRRN
                     TSSVTSFYLLASVDHRIDDLGELAKATPDQAIYLDIFVRTLWMGVVITTICLVLAYPL
                     AYLLANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINSALMAMGIIDQPL
                     ELVFNRTGVYISMVHILLPFMILPLYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQ
                     TYAGVGAGCLLVFILAIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLL
                     LLATVLLYLIYSWLVGASRLRLS"
     gene            526328..527155
                     /locus_tag="PPUBIRD1_RS02240"
                     /old_locus_tag="PPUBIRD1_0452"
     CDS             526328..527155
                     /locus_tag="PPUBIRD1_RS02240"
                     /old_locus_tag="PPUBIRD1_0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyamine ABC transporter permease"
                     /protein_id="WP_014589454.1"
                     /db_xref="GI:504402352"
                     /translation="MLSPYMSPVERVWFYSLRILCGLILLFLILPVLVIVPLSFNSGS
                     FLVYPLQGFSLQWYQDFFGSAEWMRALKNSIIVAPAATVLAMVFGTLAAIGLTRGDFP
                     GKSLVMALVISPMVVPVVIIGVASYLFFAPLGMGNSFTSLILVHAVLGVPFVIITVSA
                     TLQGFNYNLVRAAASLGASPLLAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLA
                     GPEQATLPRQMFSGIRENLSPTIAAAATLLIAFSVVLLLTLEWLRGRSEKLRTQQPA"
     gene            527307..527981
                     /locus_tag="PPUBIRD1_RS02245"
                     /old_locus_tag="PPUBIRD1_0453"
     CDS             527307..527981
                     /locus_tag="PPUBIRD1_RS02245"
                     /old_locus_tag="PPUBIRD1_0453"
                     /EC_number="5.1.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003260678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribulose-phosphate 3-epimerase"
                     /protein_id="WP_003255539.1"
                     /db_xref="GI:489348430"
                     /translation="MQPYAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVP
                     NLTIGPMVCTALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEATQHIDRS
                     LQLIKDGGCKAGLVFNPATSLDALKYVMDKIDMVLLMSVNPGFGGQKFIPGTLDKLRE
                     ARALIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYQEVIAKMRAE
                     LALARP"
     gene            527978..528796
                     /locus_tag="PPUBIRD1_RS02250"
                     /old_locus_tag="PPUBIRD1_0454"
     CDS             527978..528796
                     /locus_tag="PPUBIRD1_RS02250"
                     /old_locus_tag="PPUBIRD1_0454"
                     /EC_number="3.1.3.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_014589455.1"
                     /db_xref="GI:504402353"
                     /translation="MSGFEQLFPGTLPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGR
                     PPAGLEAVRHWVGNGAQVLVRRALAGGIDHADVDDALAEQALALFMDAYAESHELTVV
                     YPGVRDTLRWLRKQGVEMALITNKPERFVGPLLDQMKIGNFFRWIIGGDTLPQKKPDP
                     AALLFVMQMAGVTPQQSLFVGDSRSDVQAAKAAGVQCVGLTYGYNHGRPIDDESPSLV
                     IDDLRALLPGCADPATGITLADLQASQDRESTVAVTGKFWMKVIKALARWRWRA"
     gene            528866..530347
                     /locus_tag="PPUBIRD1_RS02255"
                     /old_locus_tag="PPUBIRD1_0455"
     CDS             528866..530347
                     /locus_tag="PPUBIRD1_RS02255"
                     /old_locus_tag="PPUBIRD1_0455"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255536.1"
                     /note="with component II, the glutamine amidotransferase,
                     catalyzes the formation of anthranilate from chorismate
                     and glutamine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase subunit I"
                     /protein_id="WP_014589456.1"
                     /db_xref="GI:504402354"
                     /translation="MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSY
                     LLESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILHDGVEVESCEVEDPLAFVETFKD
                     RYKVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVF
                     DNLAGKMHAIVLVDPAEDQAFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPAFR
                     SSYTREDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMY
                     FFNFGDFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIA
                     EHLMLIDLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVTGQLREGLTAMDALR
                     AILPAGTLSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVIKDG
                     ELHVQAGGGIVADSVPALEWEETINKRRAMFRAVALAEQTSAR"
     gene            complement(530620..532509)
                     /locus_tag="PPUBIRD1_RS02260"
                     /old_locus_tag="PPUBIRD1_0456"
     CDS             complement(530620..532509)
                     /locus_tag="PPUBIRD1_RS02260"
                     /old_locus_tag="PPUBIRD1_0456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014589457.1"
                     /db_xref="GI:504402355"
                     /translation="MRKAPLLRFTLASLALACSQALAGPSPYSTLIVFGDSLADAGQF
                     PDLGGGTPGARFTNRDADGNFAPVSPMILGGRLGVAPGELNPSTSVGIQPDGNNWAVG
                     GYTTQQILDSITTTSETVIPPGNPNAGQVLRERPGYLANGLRADPNALYYLTGGGNDF
                     LQGLVNSPADAVAAGARLAASAQALQQGGARYIMVWLLPDLGQTPNFSGTPQQNPLSL
                     LSAAFNQSLISQLGQIDAQIIPLNIPVLLSEALASPSQFGLASDQNLVGTCYSGDSCV
                     ENPVYGINGTTPDPTKLLFNDSVHPTIAGQQLIADYAYSILAAPWELTLLPEMAHASL
                     RAHQDELRNQWQTPWQAVGQWQAFVASGAHDLDFDGQRSAASGDGRGYNLTVGGSYRL
                     NDAWRLGLAGGAYRQKLEAGEQDSDYKLNSYMASAFAQYRQDRWWADAALTAGHLDYS
                     DLKRTFALGVNDRSEKGDTDGEAWAMSGRLGYNLAADTSNWQLAPFISADYARVKVDG
                     YDEKSGRSTALGFDDQERTSRRLGVGLLGSVQVQPNTRLFAEVAQEHEFEDDEQDVTM
                     HLTSLPANDFTLTGYTPHSDLTRASLGVSHELVAGVHLRGNYNWRKSDELTQQGVSVG
                     VSVDF"
     gene            532877..533470
                     /locus_tag="PPUBIRD1_RS02265"
                     /old_locus_tag="PPUBIRD1_0457"
     CDS             532877..533470
                     /locus_tag="PPUBIRD1_RS02265"
                     /old_locus_tag="PPUBIRD1_0457"
                     /EC_number="4.1.3.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472944.1"
                     /note="TrpG; with TrpE catalyzes the formation of
                     anthranilate and glutamate from chorismate and glutamine;
                     TrpG provides the glutamine amidotransferase activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate synthase component II"
                     /protein_id="WP_003255531.1"
                     /db_xref="GI:489348422"
                     /translation="MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDEMTIAQIEALNP
                     ERIVVSPGPCTPSEAGVSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHG
                     KTSPVYHRDLGVFASLNNPLTVTRYHSLVVKRETLPDCLEVTAWTSHADGSVDEIMGL
                     RHKTLNIEGVQFHPESILTEQGHELFANFLKQTGGRR"
     gene            533480..534529
                     /gene="trpD"
                     /locus_tag="PPUBIRD1_RS02270"
                     /old_locus_tag="PPUBIRD1_0458"
     CDS             533480..534529
                     /gene="trpD"
                     /locus_tag="PPUBIRD1_RS02270"
                     /old_locus_tag="PPUBIRD1_0458"
                     /EC_number="2.4.2.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970609.1"
                     /note="Anthranilate phosphoribosyltransferase; Catalyzes
                     the conversion of N-(5-phospho-D-ribosyl)-anthranilate and
                     diphosphate to anthranilate and 5-phospho-alpha-D-ribose
                     1-diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anthranilate phosphoribosyltransferase"
                     /protein_id="WP_014589458.1"
                     /db_xref="GI:504402356"
                     /translation="MDIKSALSRIVGQLDLTTEEMREVMRQIMTGQCSEAQIGAFLMG
                     MRMKSESIDEIVGAVSVMRELAEKVELQSLDGVVDIVGTGGDGANIFNVSTASSFVLA
                     AAGCPVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSHHSA
                     MKHAAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFAQTLCRPLAEVLQRLGSKHVL
                     VVHSKDGLDEFSLAAPTFVAELKNGEITEYWVEPEDLGMKSQSLHGLAVESPQASLEL
                     IRDALGRRKTENGQKAAEMIVLNAGAALYAADHAMSLKAGVELAHDVLHTGLAWEKLQ
                     ELGAFTAVFKVENEA"
     gene            534526..535359
                     /gene="trpC"
                     /locus_tag="PPUBIRD1_RS02275"
                     /old_locus_tag="PPUBIRD1_0459"
     CDS             534526..535359
                     /gene="trpC"
                     /locus_tag="PPUBIRD1_RS02275"
                     /old_locus_tag="PPUBIRD1_0459"
                     /EC_number="4.1.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436725.1"
                     /note="Indole-3-glycerol phosphate synthase; involved in
                     tryptophan biosynthesis; amino acid biosynthesis; converts
                     1-(2-carboxyphenylamino)-1-deoxy-D-ribulose 5-phosphate to
                     C(1)-(3-indolyl)-glycerol 3-phosphate and carbon dioxide
                     and water; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="indole-3-glycerol phosphate synthase"
                     /protein_id="WP_014589459.1"
                     /db_xref="GI:504402357"
                     /translation="MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKAADAPRGFA
                     NALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYF
                     QGSDEYLQQARAAVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAA
                     TAKDVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRD
                     RLAITESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQL
                     D"
     gene            535507..536211
                     /locus_tag="PPUBIRD1_RS02280"
                     /old_locus_tag="PPUBIRD1_0460"
     CDS             535507..536211
                     /locus_tag="PPUBIRD1_RS02280"
                     /old_locus_tag="PPUBIRD1_0460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951758.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589460.1"
                     /db_xref="GI:504402358"
                     /translation="MTDQPLALSVEQGLHAEQELLAAVCRGERESGVLFWRPTDHALV
                     MPRRMSRLGNFEVACAELAIAGWPVLLRETGGEPVPQSHSTVNVALVYAAPRSEGDHG
                     RIENAYERLCLPLCDVLREWGGVASVGEIDGAFCDGRYNVNLNGRKLVGTAQRWRQGL
                     GGKRPVVLVHGALLLDNERESMVAAVNRFNECCELEQRCRADAHIALHEVAPAAPWFE
                     RLSQAYAKVLAELPKD"
     gene            complement(536208..536852)
                     /locus_tag="PPUBIRD1_RS02285"
                     /old_locus_tag="PPUBIRD1_0461"
     CDS             complement(536208..536852)
                     /locus_tag="PPUBIRD1_RS02285"
                     /old_locus_tag="PPUBIRD1_0461"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_019436724.1"
                     /db_xref="GI:518266516"
                     /translation="MVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGDRAETLSFI
                     IKGSVTILIEDDDGHEMIIAYLNNGDFFGELGLFEPVDGEQQRSAWVRAKTECEVAEI
                     SYEKFRELARQDPEILYALGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLELCKQPD
                     AMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKDLEERSLVQVKGKTMVVYGTR"
     gene            537044..537466
                     /locus_tag="PPUBIRD1_RS02290"
                     /old_locus_tag="PPUBIRD1_0462"
     CDS             537044..537466
                     /locus_tag="PPUBIRD1_RS02290"
                     /old_locus_tag="PPUBIRD1_0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004376171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_004376171.1"
                     /db_xref="GI:490510159"
                     /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPEAGGRNLGVRPMEML
                     LLGLGGCSSFDVVSILKKSRQAVESCEAFLEAERASEDPKVFTKIHMNFVVKGRGLKE
                     AQVKRAVELSAEKYCSASIMLERAGVEITHGYEIVELG"
     gene            complement(537543..538583)
                     /locus_tag="PPUBIRD1_RS02295"
                     /old_locus_tag="PPUBIRD1_0463"
     CDS             complement(537543..538583)
                     /locus_tag="PPUBIRD1_RS02295"
                     /old_locus_tag="PPUBIRD1_0463"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589462.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589462.1"
                     /db_xref="GI:504402360"
                     /translation="MTDRFDAKDLARAVQAGILQPGQDQSLLAFLRQQPAPRGSFQLA
                     HVAFYFGAMLIMAALGWLLTEAWMSLGDSALLIIASLYILLITLFALNLQRRAQPVAA
                     GVLAAVAVSIVPLAVFAIERMFGWWPLDDVQADYHQYYTYVQGGWLAMEAATVLAGLL
                     MLRLIPYPFVVMPMAVALWFMSMDLSEWFFGSPFSWEQRRQVSLWFGLGLLVVFLVID
                     GRTREDYARWGYLAGLAAFWGGLTLLESGSELGKAIYCLINIALMGMAVLLRRPVFMV
                     FGALGVAAYLGYLSYEVFAQSLLFPVVLTMIGLGVIWLGLVYQKRRERLSQALRSSLP
                     QWLRIALPALRN"
     gene            complement(538594..539241)
                     /locus_tag="PPUBIRD1_RS02300"
                     /old_locus_tag="PPUBIRD1_0464"
     CDS             complement(538594..539241)
                     /locus_tag="PPUBIRD1_RS02300"
                     /old_locus_tag="PPUBIRD1_0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
                     hydroxylase"
                     /protein_id="WP_011953317.1"
                     /db_xref="GI:500574748"
                     /translation="MATERHYSPLDRLLLQADTAMRTLLPFSGQPARPSPAIVQPDVD
                     LDEQQARHIAGLMRINHTGEVCAQALYQGQALTAKLPEVRKAMEHAAEEEVDHLAWCE
                     QRIRQLNSHPSVLNPLFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQL
                     PHEDEKSRAILEQMRIDEEQHAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI"
     gene            complement(539307..539645)
                     /locus_tag="PPUBIRD1_RS02305"
                     /old_locus_tag="PPUBIRD1_0465"
     CDS             complement(539307..539645)
                     /locus_tag="PPUBIRD1_RS02305"
                     /old_locus_tag="PPUBIRD1_0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009681261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family hydrolase"
                     /protein_id="WP_003255518.1"
                     /db_xref="GI:489348409"
                     /translation="MDDLFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIPKK
                     HIRTLNDLTEEDKALAGHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVL
                     GQRQMNWPPG"
     gene            complement(539709..540491)
                     /locus_tag="PPUBIRD1_RS02310"
                     /old_locus_tag="PPUBIRD1_0466"
     CDS             complement(539709..540491)
                     /locus_tag="PPUBIRD1_RS02310"
                     /old_locus_tag="PPUBIRD1_0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589463.1"
                     /db_xref="GI:504402361"
                     /translation="MTRYAMITGASSGLGLALAEALARRGRNLILVARQRETLEPVAI
                     ELTQRFGVEVLFRACDLSQPLRLSGFVLELEEGERRIDLLVNCAGLRTYGPFLAHEWA
                     DEQDLLEVNVLALSRLCHAIGNLMAVQGGGQILNVAGLAGVAPGPWMAAYAASKAYVL
                     SFSQALREELKRTGIKVSVLCPGPVRSARRRIARLDGKPRCLSPEEVALYTVRALDKN
                     LALIMPGRRNRWLAFAPRLLPRWLVRKLAGAIHRRYCPSGME"
     gene            complement(540559..541515)
                     /locus_tag="PPUBIRD1_RS02315"
                     /old_locus_tag="PPUBIRD1_0467"
     CDS             complement(540559..541515)
                     /locus_tag="PPUBIRD1_RS02315"
                     /old_locus_tag="PPUBIRD1_0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004574932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_014589464.1"
                     /db_xref="GI:504402362"
                     /translation="MSLPASLEQRLRLPVVAAPMFLISNPQLVLACCASGVVGSFPAL
                     NQRDSAGFKAWLEEIEAGLAQLQAPAPYAVNLIVHPTNPRLQADLALCVEQRVPIVIT
                     SLGAVKEVVDAVHGYGGLVLHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFA
                     LAAEIRQFFDKTLLLAGCINHGHEILAAQLLGADLAYMGTRFIATTESQAQGTYKQML
                     LDAHAADIIHTPVVSGIPASFLRQSLEQAGYDMNALKGGQVQGKLKPIDDEAKAWKTV
                     WSAGQGVGAIHDLPSASALIERLHGEYRQALEHCQVLRARAL"
     gene            complement(541544..541969)
                     /locus_tag="PPUBIRD1_RS02320"
                     /old_locus_tag="PPUBIRD1_0468"
     CDS             complement(541544..541969)
                     /locus_tag="PPUBIRD1_RS02320"
                     /old_locus_tag="PPUBIRD1_0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008089529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589465.1"
                     /db_xref="GI:504402363"
                     /translation="MLYLWIKALHIVSVVCWFAGLFYLPRLFVYHAQSQDSISQERFV
                     TMERKLYRGIMNPAMIATYIFGAWMLYLTPGWLSQGWLHAKLTLVILLTGYHHVCGAQ
                     RKRFANGTNTRSHVYYRWFNEVPVLILLAIVILVVVKPF"
     gene            542112..543146
                     /locus_tag="PPUBIRD1_RS02325"
                     /old_locus_tag="PPUBIRD1_0469"
     CDS             542112..543146
                     /locus_tag="PPUBIRD1_RS02325"
                     /old_locus_tag="PPUBIRD1_0469"
                     /EC_number="1.2.1.38"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472953.1"
                     /note="N-acetyl-gamma-glutamyl-phosphate reductase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="n-acetyl-gamma-glutamyl-phosphate reductase"
                     /protein_id="WP_014589466.1"
                     /db_xref="GI:504402364"
                     /translation="MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVAD
                     MYPNLRGHYDGLAFSVPDSKALAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADF
                     RLQDAAEWGKWYGQPHGAPELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFL
                     PLLEAGLADPSRLIADCKSGVSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQG
                     LRLAAGKDIGLTFVPHLTPMIRGIHATLYANVVDTSVDLQALFEKRYADEPFVDVMPA
                     GSHPETRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDER
                     MGLAHAGLLP"
     gene            543293..543643
                     /locus_tag="PPUBIRD1_RS02330"
                     /old_locus_tag="PPUBIRD1_0470"
     CDS             543293..543643
                     /locus_tag="PPUBIRD1_RS02330"
                     /old_locus_tag="PPUBIRD1_0470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009408529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster insertion protein ErpA"
                     /protein_id="WP_003255511.1"
                     /db_xref="GI:489348402"
                     /translation="MSVETFTPTGLEFTHGAAQKVKNLVNEEGNERLKLRVFVTGGGC
                     SGFQYGFTFDEDVAEDDTIVEREGVSLVVDPMSFQYLAGAEVDYQEGLEGSRFVIKNP
                     NAATTCGCGSSFSI"
     gene            complement(543703..544794)
                     /locus_tag="PPUBIRD1_RS02335"
                     /old_locus_tag="PPUBIRD1_0471"
     CDS             complement(543703..544794)
                     /locus_tag="PPUBIRD1_RS02335"
                     /old_locus_tag="PPUBIRD1_0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anhydro-N-acetylmuramic acid kinase"
                     /protein_id="WP_014589467.1"
                     /db_xref="GI:504402365"
                     /translation="MALYLGVMSGTSLDGLDIALIEQGEQLELLATHYLPMPDDLRQE
                     LLVLCSSGPDEIARAALAENRWASLAGEGINQLLARQGLKAEAIRAIGSHGQTIRHEP
                     ARGFTVQIGNPALLAELTGISVVADFRRRDVAAGGQGAPLVPAFHETLFNHLGQRLAI
                     LNVGGFSNLSLIEQDKPVHGFDCGPGNVLLDAWIEREHGHAYDADGAWAASGVVQPRL
                     LSVLMADPFFAGSGPKSTGREVFNLPWLDRHLATLPAYRAQDVQATLLELTARSIIDS
                     LGKAQQGTEALLVCGGGARNGALMARLGQLLPAARVASTGAYGVDPDWVEAMAFAWLA
                     HCCLEGIAANRPSVTAAKGLRVLGAIYPA"
     gene            complement(544798..546219)
                     /locus_tag="PPUBIRD1_RS02340"
                     /old_locus_tag="PPUBIRD1_0472"
     CDS             complement(544798..546219)
                     /locus_tag="PPUBIRD1_RS02340"
                     /old_locus_tag="PPUBIRD1_0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_019436722.1"
                     /db_xref="GI:518266514"
                     /translation="MTNEPPKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKKT
                     TLNLELESPAEQLKDESRAAPLVQSESEQGSPFAQIEEATPETQKADQQAPAAEPVAE
                     AAKEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHGQVLQFEL
                     DKDGQLASLHSKVSNLETIQLTKTAKGYTFNREISKPVVRTAYAHGVIKSSLSASAQR
                     AGLSHSMTMSLARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKVVGTGNILSARFTNR
                     GKTYTAVRYTNKQGNTAYYTADGNSLRKAFIRTPVDFARISSRFSAGRKHPILNKIRA
                     HKGVDYAAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLYGHMQGFAKGIK
                     TGSTVKQGQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKNERQRFL
                     QQSQPLIARMDQEKATMLAANKR"
     gene            546433..547632
                     /locus_tag="PPUBIRD1_RS02345"
                     /old_locus_tag="PPUBIRD1_0473"
     CDS             546433..547632
                     /locus_tag="PPUBIRD1_RS02345"
                     /old_locus_tag="PPUBIRD1_0473"
                     /EC_number="6.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004574941.1"
                     /note="Tyrosyl-tRNA synthetase; catalyzes the formation of
                     tyrosyl-tRNA(Tyr) from tyrosine and tRNA(Tyr); Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="WP_014589469.1"
                     /db_xref="GI:504402367"
                     /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTA
                     PDLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLENAE
                     TYKQQVFKILDPAKTEVAFNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQ
                     PIAIHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRSYGQEAQNIVTMPLL
                     EGLDGVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDTLMWRYFELLSFRSMEEIEQFRA
                     DVANGANPRDIKIKLAEEIVARFHGEEAAANAHRAAGNRMKEGELPEGLPEIEVAAAE
                     DLPIAAVLNRAGLVKNSAQARDLLNSGAVKVDGAVVDKDFMFVLGATHVCQAGKKSFG
                     RVTLKAE"
     gene            548206..549752
                     /locus_tag="PPUBIRD1_RS02350"
                     /old_locus_tag="PPUBIRD1_r0008"
     rRNA            548206..549752
                     /locus_tag="PPUBIRD1_RS02350"
                     /old_locus_tag="PPUBIRD1_r0008"
                     /product="16S ribosomal RNA"
     gene            550028..552941
                     /locus_tag="PPUBIRD1_RS02355"
                     /old_locus_tag="PPUBIRD1_r0009"
     rRNA            550028..552941
                     /locus_tag="PPUBIRD1_RS02355"
                     /old_locus_tag="PPUBIRD1_r0009"
                     /product="23S ribosomal RNA"
     gene            553058..553173
                     /locus_tag="PPUBIRD1_RS02360"
                     /old_locus_tag="PPUBIRD1_r0010"
     rRNA            553058..553173
                     /locus_tag="PPUBIRD1_RS02360"
                     /old_locus_tag="PPUBIRD1_r0010"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            553359..554318
                     /locus_tag="PPUBIRD1_RS02365"
                     /old_locus_tag="PPUBIRD1_0474"
     CDS             553359..554318
                     /locus_tag="PPUBIRD1_RS02365"
                     /old_locus_tag="PPUBIRD1_0474"
                     /EC_number="6.3.4.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin--protein ligase"
                     /protein_id="WP_014589470.1"
                     /db_xref="GI:504402368"
                     /translation="MLKLLNLLKDGRFHSGEALGAALGVSRSAVWKQLQHLESELNLT
                     IHKVRGRGYQLAAPLALLETQAIAGFAVGEQWPVFIHETIDSTNAEGLRLASEGQAAP
                     FLVLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDGGMRQLEGLSLVVGLAVMRTLQ
                     AFGVKDVGLKWPNDVLVRGQKITGILLELVGDPADVCHVVLGIGINVNMQVNEQVDQQ
                     WTSMRREVGVVIDRNHLVALLSQQLQHELARHRRYGFAAFQEEWEQAHLWQGRNVSLV
                     AGNTRIDGVVLGVDGQGGLRLEVDGMEKSFSGGELSLRLRDDS"
     gene            554308..555057
                     /locus_tag="PPUBIRD1_RS02370"
                     /old_locus_tag="PPUBIRD1_0475"
     CDS             554308..555057
                     /locus_tag="PPUBIRD1_RS02370"
                     /old_locus_tag="PPUBIRD1_0475"
                     /EC_number="2.7.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019473699.1"
                     /note="type III; catalyzes the formation of
                     (R)-4'-phosphopantothenate from (R)-pantothenate in
                     coenzyme A biosynthesis; type III pantothenate kinases are
                     not subject to feedback inhibition from coenzyme A and
                     have a high Km for ATP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_014589471.1"
                     /db_xref="GI:504402369"
                     /translation="MILELDCGNSFIKWRVIHVADAVIEGGGIVDSDQALVAEVAALA
                     SVRLTGCRIVSVRSEEETDALCALIAQAFAVQAKVAHPVREMAGVRNGYDDYQRLGMD
                     RWLAALGAFHLAKGACLVIDLGTAAKADFVSADGEHLGGYICPGMPLMRSQLRTHTRR
                     IRYDDASAERALNSLSPGRSTVEAVERGCVLMLQGFAYTQLEQARVLWGEEFTVFLTG
                     GDAPLVRAALPQARVVPDLVFVGLAMACPLD"
     gene            555065..555490
                     /locus_tag="PPUBIRD1_RS02375"
                     /old_locus_tag="PPUBIRD1_0476"
     CDS             555065..555490
                     /locus_tag="PPUBIRD1_RS02375"
                     /old_locus_tag="PPUBIRD1_0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589472.1"
                     /db_xref="GI:504402370"
                     /translation="MRWLFLLLLVLNVFYYVWHQQEAPLKVKEVAPLSLYKGNQQEIR
                     LLRETGVSAPPKRRDECLVVGGVKGQEQLDALRQRLLSLDIATLPVSGQLPGADGRWL
                     KVAPESERLLDQTVLLALSNDFKDLKHKIIFCQGIATDE"
     gene            555643..555726
                     /locus_tag="PPUBIRD1_RS02380"
                     /old_locus_tag="PPUBIRD1_t0001"
     tRNA            555643..555726
                     /locus_tag="PPUBIRD1_RS02380"
                     /old_locus_tag="PPUBIRD1_t0001"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555677..555679,aa:Tyr,seq:gta)
     gene            555751..555824
                     /locus_tag="PPUBIRD1_RS02385"
                     /old_locus_tag="PPUBIRD1_t0002"
     tRNA            555751..555824
                     /locus_tag="PPUBIRD1_RS02385"
                     /old_locus_tag="PPUBIRD1_t0002"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555783..555785,aa:Gly,seq:tcc)
     gene            555854..555929
                     /locus_tag="PPUBIRD1_RS02390"
                     /old_locus_tag="PPUBIRD1_t0003"
     tRNA            555854..555929
                     /locus_tag="PPUBIRD1_RS02390"
                     /old_locus_tag="PPUBIRD1_t0003"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:555887..555889,aa:Thr,seq:ggt)
     gene            556008..557201
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02395"
                     /old_locus_tag="PPUBIRD1_0477"
     CDS             556008..557201
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02395"
                     /old_locus_tag="PPUBIRD1_0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005791980.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_003255489.1"
                     /db_xref="GI:489348380"
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAI
                     VEFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     gene            557256..557331
                     /locus_tag="PPUBIRD1_RS02400"
                     /old_locus_tag="PPUBIRD1_t0004"
     tRNA            557256..557331
                     /locus_tag="PPUBIRD1_RS02400"
                     /old_locus_tag="PPUBIRD1_t0004"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:557289..557291,aa:Trp,seq:cca)
     gene            557376..557744
                     /locus_tag="PPUBIRD1_RS02405"
                     /old_locus_tag="PPUBIRD1_0478"
     CDS             557376..557744
                     /locus_tag="PPUBIRD1_RS02405"
                     /old_locus_tag="PPUBIRD1_0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009397378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_014589473.1"
                     /db_xref="GI:504402371"
                     /translation="MTPKTEAQESRFDLFKWLAVVALVVVGVVGNQYYSSSPILYRVL
                     VLLVLAAVAGFVALQTAKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVM
                     ALLLWGLDSLLGWAVSLIVG"
     gene            557754..558287
                     /locus_tag="PPUBIRD1_RS02410"
                     /old_locus_tag="PPUBIRD1_0479"
     CDS             557754..558287
                     /locus_tag="PPUBIRD1_RS02410"
                     /old_locus_tag="PPUBIRD1_0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007984405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_003255501.1"
                     /db_xref="GI:489348392"
                     /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEE
                     VVEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDK
                     EAEAILRRVADGSDKPKPKTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLI
                     FGRSTPVELEFSQVEKV"
     gene            558407..558838
                     /locus_tag="PPUBIRD1_RS02415"
     CDS             558407..558838
                     /locus_tag="PPUBIRD1_RS02415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008374187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_003255500.1"
                     /db_xref="GI:489348391"
                     /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNA
                     RTQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVT
                     RAQLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
     gene            558838..559533
                     /locus_tag="PPUBIRD1_RS02420"
                     /old_locus_tag="PPUBIRD1_0481"
     CDS             558838..559533
                     /locus_tag="PPUBIRD1_RS02420"
                     /old_locus_tag="PPUBIRD1_0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B0KK57.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_003255499.1"
                     /db_xref="GI:489348390"
                     /translation="MAKLTKRQKAIAEKIEAGKAYNFEEAATLLASLPAAKFVESYDI
                     AVNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQGPAAEAALAAGADRVGMDDLAA
                     EMKGGDLNYDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQ
                     VRYRTDKNGIIHTSVGKIGFEADKLKENVEALIADLKRIKPASSKGIYVKRVTLSTTM
                     GPGLVIDQSSLNV"
     gene            559731..560231
                     /gene="rplJ"
                     /locus_tag="PPUBIRD1_RS02425"
                     /old_locus_tag="PPUBIRD1_0482"
     CDS             559731..560231
                     /gene="rplJ"
                     /locus_tag="PPUBIRD1_RS02425"
                     /old_locus_tag="PPUBIRD1_0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QP3.1"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_003255497.1"
                     /db_xref="GI:489348388"
                     /translation="MAIKLEDKKAIVAEVNEAAKVALSAVVADARGVTVSAMTGLRKE
                     AREAGVYVRVVRNTLLKRAVEGTEFSILNDAFKGPTLIAFSNEHPGAAARLFKEFAKG
                     QDKFEIKAAAFDGNFIAANQIDVLATLPTRDEAIARLMSVIQGATSKLARTLAAIRDQ
                     KEATAA"
     gene            560308..560673
                     /gene="rplL"
                     /locus_tag="PPUBIRD1_RS02430"
                     /old_locus_tag="PPUBIRD1_0483"
     CDS             560308..560673
                     /gene="rplL"
                     /locus_tag="PPUBIRD1_RS02430"
                     /old_locus_tag="PPUBIRD1_0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003228750.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_003255496.1"
                     /db_xref="GI:489348387"
                     /translation="MSLTNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPAA
                     AAAVVEEQTEFNVVLVEAGDKKVNVIKAVRELTGLGLKEAKEKVDGAPQVVAEGVSKE
                     AAEDAKKKLEEAGAKVELK"
     gene            560894..564967
                     /gene="rpoB"
                     /locus_tag="PPUBIRD1_RS02435"
                     /old_locus_tag="PPUBIRD1_0484"
     CDS             560894..564967
                     /gene="rpoB"
                     /locus_tag="PPUBIRD1_RS02435"
                     /old_locus_tag="PPUBIRD1_0484"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003232409.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_003255495.1"
                     /db_xref="GI:489348386"
                     /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGAS
                     KDHFRDVGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRV
                     KVRLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVF
                     FDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALG
                     YSTEEVLNTFYTTNVFHISGEKLSLELVPQRLRGEVAVMDIHDETGKVIVEQGRRITA
                     RHINQLEKAGVKQLDVPMEYVLGRTTAKAIVHPATGEILAECNTEMTTELLIKVAKAQ
                     VVRIETLYTNDIDCGPFISDTLKIDTTSNQLEALVEIYRMMRPGEPPTKDAAETLFNN
                     LFFSAERYDLSAVGRMKFNRRIGRTEIEGSGVLSKEDIVEVLKTLVDIRNGKGIVDDI
                     DHLGNRRVRCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVK
                     EFFGSSQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPI
                     ETPEGPNIGLINSLAAYARTNQYGFLESPYRVVKEGVVSDDIVFLSAIEEADHVIAQA
                     SAAMNDKKQLIDELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDAN
                     RALMGSNMQRQAVPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVR
                     VADDEVETGEAGVDIYNLTKYTRSNQNTCINQRPLVSKGDKVQRGDIMADGPSTDMGE
                     LALGQNMRIAFMAWNGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEIT
                     ADIPNVGEAALNKLDEAGIVYVGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEK
                     ASDVKDTSLRVPTGTKGTVIDVQVFTRDGVERDSRALAIEKMQLDEIRKDLNEEFRIV
                     EGATFERLRSALNGQVVDGGAGLKKGTVITDEVLDGLEHGQWFKLRMAEDALNEQLEK
                     AQQYIVDRRRLLDDKFEDKKRKLQQGDDLAPGVLKIVKVYLAIRRRIQPGDKMAGRHG
                     NKGVVSVIMPVEDMPHDANGTPVDVVLNPLGVPSRMNVGQILETHLGLAAKGLGEKID
                     RMLEEQRKAAELRVFLTEVYNEIGGRQENLDEFTDEEILALANNLKKGVPMATPVFDG
                     AKEREIKAMLKLADLPESGQMVLFDGRTGNKFERPVTVGYMYMLKLNHLVDDKMHARS
                     TGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMY
                     KNIVDGDHRMEPGMPESFNVLIKEIRSLGIDIDLETE"
     gene            565032..569231
                     /locus_tag="PPUBIRD1_RS02440"
                     /old_locus_tag="PPUBIRD1_0485"
     CDS             565032..569231
                     /locus_tag="PPUBIRD1_RS02440"
                     /old_locus_tag="PPUBIRD1_0485"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013789754.1"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_014589475.1"
                     /db_xref="GI:504402373"
                     /translation="MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERM
                     AHIELASPVAHIWFLKSLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLL
                     NDEQYFEALEEFGDDFDARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLS
                     KRLKLMEAFQGSGNLPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLSAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLAT
                     TIKAAKKMVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTREAINAKGEGRVFADLQEVDRVFRAGEAALHAKIKVRINETVKERDGSVVKN
                     TRIVDTTVGRALLFQVVPAGLPYDVVNQPMKKKAISKLINQCYRVVGLKETVIFADQL
                     MYTGFAYSTISGVSIGVNDFVIPDEKARIIGNATDEVKEIESQYASGLVTQGEKYNKV
                     IDLWSKANDEVSKAMMANLSKEKVIDREGKEVEQESFNSMYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLSVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEIDCGTDQGLVMTPHIEGGDVVEPLGERVLGRVIARDVFKPGTEDV
                     IVPAGTLVDEQWVEFIELNSIDEVIVRSPINCETRYGICAKCYGRDLARGHQVNIGEA
                     VGVIAAQSIGEPGTQLTMRTFHIGGAASRTSAADSVQVKNGGMVRLHNLKQVERADGN
                     LVAVSRSGELAIADEFGRERERYKLPYGAVISVKEGEKVEAGAIVAKWDPHTHPIVTE
                     LKGTVTFVGMEENITIKRQTDELTGLTNIEVLDVKDRPAAGKEIRPAIKMVDAAGKDL
                     YLPGTDVPAQYFLPANALVGVADGAQIGVGDVIARIPQETSKTRDITGGLPRVADLFE
                     ARRPKEASILAEVSGTIAFGKETKGKRRLVITPTDGSDPYEELIPKWRHLNVFEGEQV
                     NRGEVISDGPSDPHDILRLLGVSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLR
                     KVEISESGDSSFIKGDQMELTQVLVENERLASEDKFISKFTRVLLGITKASLSTESFI
                     SAASFQETTRVLTEAAVTGKRDYLRGLKENVVVGRLIPAGTGLAYHSERKRRRDADKP
                     LRVSASEVEAALTEALNSSGN"
     gene            569443..569814
                     /locus_tag="PPUBIRD1_RS02445"
                     /old_locus_tag="PPUBIRD1_0486"
     CDS             569443..569814
                     /locus_tag="PPUBIRD1_RS02445"
                     /old_locus_tag="PPUBIRD1_0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007253313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_003255492.1"
                     /db_xref="GI:489348383"
                     /translation="MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKK
                     PNSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSL
                     DTSGVKGRNQGRSKYGTKRPK"
     gene            569921..570391
                     /locus_tag="PPUBIRD1_RS02450"
                     /old_locus_tag="PPUBIRD1_0487"
     CDS             569921..570391
                     /locus_tag="PPUBIRD1_RS02450"
                     /old_locus_tag="PPUBIRD1_0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003369032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_003246741.1"
                     /db_xref="GI:489339551"
                     /translation="MPRRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVY
                     GALDTVKARKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMR
                     WLVDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
     gene            570422..572569
                     /gene="fusA"
                     /locus_tag="PPUBIRD1_RS02455"
                     /old_locus_tag="PPUBIRD1_0488"
     CDS             570422..572569
                     /gene="fusA"
                     /locus_tag="PPUBIRD1_RS02455"
                     /old_locus_tag="PPUBIRD1_0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011531886.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G 1"
                     /protein_id="WP_003255490.1"
                     /db_xref="GI:489348381"
                     /translation="MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVH
                     DGAATTDWMVQEQERGITITSAAVTTFWKGSRGQYDNYRVNVIDTPGHVDFTIEVERS
                     LRVLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKN
                     RLGHTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMVELANEW
                     RNNMVEAAAEATEELMNKYLEEGELSVEEIKAGLRARTLASEIVPAVCGSSFKNKGVP
                     LVLDAVIDFLPAPTEIPAIKGIHPDLIDVPKDEVKPEQFDERHADDDEPFSALAFKIA
                     TDPFVGTLTFVRVYSGFLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIA
                     ALIGMKDVTTGDTLCNADKPIILERMDFPEPVISLSVEPKTKQDQEKMGIALGKLAQE
                     DPSFRVKTDEETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNV
                     EIEGKFVRQSGGRGQFGHCWVRFSEPDVDDKGNITEGLVFSNEVVGGVIPKEYIPAIQ
                     KGIEEQMKNGVVAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGGVV
                     LEPIMKVEVVTPEDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDV
                     RSMSQGRASYSMEFSKYAEAPSNIVEALVKKQG"
     gene            572597..573790
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02460"
                     /old_locus_tag="PPUBIRD1_0489"
     CDS             572597..573790
                     /gene="tuf"
                     /locus_tag="PPUBIRD1_RS02460"
                     /old_locus_tag="PPUBIRD1_0489"
                     /EC_number="3.6.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005791980.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_010951775.1"
                     /db_xref="GI:499254235"
                     /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAV
                     VEFDKIDSAPEEKARGITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLST
                     YDFPGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDAYIPEPVRAIDQPFLMPI
                     EDVFSISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGE
                     NCGVLLRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQF
                     YFRTTDVTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVV
                     AKIIE"
     gene            573932..574243
                     /gene="rpsJ"
                     /locus_tag="PPUBIRD1_RS02465"
                     /old_locus_tag="PPUBIRD1_0490"
                     /gene_synonym="nusE"
     CDS             573932..574243
                     /gene="rpsJ"
                     /locus_tag="PPUBIRD1_RS02465"
                     /old_locus_tag="PPUBIRD1_0490"
                     /gene_synonym="nusE"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009834626.1"
                     /note="NusE; involved in assembly of the 30S subunit; in
                     the ribosome, this protein is involved in the binding of
                     tRNA; in Escherichia coli this protein was also found to
                     be involved in transcription antitermination; NusB/S10
                     heterodimers bind boxA sequences in the leader RNA of rrn
                     operons which is required for antitermination; binding of
                     NusB/S10 to boxA nucleates assembly of the antitermination
                     complex; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_003186070.1"
                     /db_xref="GI:489278403"
                     /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPT
                     RKERFTVLVSPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISL
                     G"
     gene            574324..574959
                     /locus_tag="PPUBIRD1_RS02470"
                     /old_locus_tag="PPUBIRD1_0491"
     CDS             574324..574959
                     /locus_tag="PPUBIRD1_RS02470"
                     /old_locus_tag="PPUBIRD1_0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_003255486.1"
                     /db_xref="GI:489348377"
                     /translation="MTIGVIGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKTEETD
                     GYRAVQVTVGERRASRVTAAQAGHFAKANVAAGRGVWEFRLEEGDFQAGDLIKAELFT
                     AGQLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKK
                     MSGHMGAERVTVQSLEVVRVDAERNLLLIKGAVPGATGGDVVVRPAVKARG"
     gene            574972..575574
                     /gene="rplD"
                     /locus_tag="PPUBIRD1_RS02475"
                     /old_locus_tag="PPUBIRD1_0492"
     CDS             574972..575574
                     /gene="rplD"
                     /locus_tag="PPUBIRD1_RS02475"
                     /old_locus_tag="PPUBIRD1_0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010486975.1"
                     /note="L4 is important during the early stages of 50S
                     assembly; it initially binds near the 5' end of the 23S
                     rRNA; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_003255485.1"
                     /db_xref="GI:489348376"
                     /translation="MQLNVNDAQAIEVSELTFGGEFNETLVHQAVVAYMAGGRQGTKQ
                     QKTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTFAARPQDHSQKLNKKMYRA
                     ALRSILAELVRSDRLVVVQDFAVEAPKTKDLLNKLNGMGLSDVLIVSDAVDQNLYLAA
                     RNLPHVDVRDVQGSDPVSLIAYEKVLITVSAVKKFEELLG"
     gene            575571..575870
                     /gene="rplW"
                     /locus_tag="PPUBIRD1_RS02480"
                     /old_locus_tag="PPUBIRD1_0493"
     CDS             575571..575870
                     /gene="rplW"
                     /locus_tag="PPUBIRD1_RS02480"
                     /old_locus_tag="PPUBIRD1_0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q48D38.1"
                     /note="binds third domain of 23S rRNA and protein L29;
                     part of exit tunnel; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_003255484.1"
                     /db_xref="GI:489348375"
                     /translation="MNQERVFKVLLGPHVSEKATVLAEKKGQFVFKVATDATKLEIKK
                     AVEGLFNVKVENVSTVNVLGKTKRTARGLGKRNDWKKAIVSLQPGQDLDFSSSAE"
     gene            575885..576709
                     /locus_tag="PPUBIRD1_RS02485"
                     /old_locus_tag="PPUBIRD1_0494"
     CDS             575885..576709
                     /locus_tag="PPUBIRD1_RS02485"
                     /old_locus_tag="PPUBIRD1_0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002555487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_003255483.1"
                     /db_xref="GI:489348374"
                     /translation="MAIVKCKPTSPGRRFVVKVVNKELHKGAPHAPLIEKKSKSGGRN
                     NNGRITTRHVGGGHKQHYRLVDFRRNDKDGIPATVERIEYDPNRTAHIALLCYADGER
                     RYIIAPKGVSAGDQLIAGALAPIKAGNSLQLRNIPVGSTIHGIELKPGKGAQIARSAG
                     ASAQLIAREGVYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVR
                     PTVRGVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRGNKRTDNMIVRRRK"
     gene            576726..577001
                     /locus_tag="PPUBIRD1_RS02490"
                     /old_locus_tag="PPUBIRD1_0495"
     CDS             576726..577001
                     /locus_tag="PPUBIRD1_RS02490"
                     /old_locus_tag="PPUBIRD1_0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013789761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_003255482.1"
                     /db_xref="GI:489348373"
                     /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQM
                     VGLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHVADKKAKR"
     gene            577013..577345
                     /locus_tag="PPUBIRD1_RS02495"
     CDS             577013..577345
                     /locus_tag="PPUBIRD1_RS02495"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A4VHN5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_003103908.1"
                     /db_xref="GI:489194586"
                     /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAA
                     EIMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCH
                     ITVKVADK"
     gene            577359..578045
                     /locus_tag="PPUBIRD1_RS02500"
                     /old_locus_tag="PPUBIRD1_0497"
     CDS             577359..578045
                     /locus_tag="PPUBIRD1_RS02500"
                     /old_locus_tag="PPUBIRD1_0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q889W5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_003255481.1"
                     /db_xref="GI:489348372"
                     /translation="MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQ
                     DKLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHIN
                     IEEIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGA
                     EIARTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQ
                     APAPRKKAAK"
     gene            578058..578471
                     /locus_tag="PPUBIRD1_RS02505"
                     /old_locus_tag="PPUBIRD1_0498"
     CDS             578058..578471
                     /locus_tag="PPUBIRD1_RS02505"
                     /old_locus_tag="PPUBIRD1_0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003448731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_003255479.1"
                     /db_xref="GI:489348370"
                     /translation="MLQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTA
                     RQIESARRALTRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGKV
                     LYEIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
     gene            578471..578662
                     /locus_tag="PPUBIRD1_RS02510"
                     /old_locus_tag="PPUBIRD1_0499"
     CDS             578471..578662
                     /locus_tag="PPUBIRD1_RS02510"
                     /old_locus_tag="PPUBIRD1_0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q889W3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_002555481.1"
                     /db_xref="GI:488618632"
                     /translation="MKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLS
                     QVKRDIARVKTVLNQQAGK"
     gene            578665..578931
                     /locus_tag="PPUBIRD1_RS02515"
                     /old_locus_tag="PPUBIRD1_0500"
     CDS             578665..578931
                     /locus_tag="PPUBIRD1_RS02515"
                     /old_locus_tag="PPUBIRD1_0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013717345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_003255478.1"
                     /db_xref="GI:489348369"
                     /translation="MAEAEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRS
                     TKLHAHDEANQCKIGDKVSIRETRPLAKTKSWALVEVLERAVEV"
     gene            578955..579323
                     /locus_tag="PPUBIRD1_RS02520"
                     /old_locus_tag="PPUBIRD1_0501"
     CDS             578955..579323
                     /locus_tag="PPUBIRD1_RS02520"
                     /old_locus_tag="PPUBIRD1_0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009877111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_002555479.1"
                     /db_xref="GI:488618630"
                     /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVK
                     EAIPRGKVKKGQVMTAVVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPV
                     TRELRTEKFMKIVSLAPEVL"
     gene            579335..579649
                     /gene="rplX"
                     /locus_tag="PPUBIRD1_RS02525"
                     /old_locus_tag="PPUBIRD1_0502"
     CDS             579335..579649
                     /gene="rplX"
                     /locus_tag="PPUBIRD1_RS02525"
                     /old_locus_tag="PPUBIRD1_0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010486994.1"
                     /note="assembly initiator protein; binds to 5' end of 23S
                     rRNA and nucleates assembly of the 50S; surrounds
                     polypeptide exit tunnel; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_003255476.1"
                     /db_xref="GI:489348367"
                     /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVIGGVNLVKRH
                     TKPNPMAGVQGGIVEKEAPLHASNVAIFNGETNKADRVGFKVEDGKKIRVFKSTQKAV
                     DA"
     gene            579670..580209
                     /locus_tag="PPUBIRD1_RS02530"
                     /old_locus_tag="PPUBIRD1_0503"
     CDS             579670..580209
                     /locus_tag="PPUBIRD1_RS02530"
                     /old_locus_tag="PPUBIRD1_0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007924186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_003255474.1"
                     /db_xref="GI:489348365"
                     /translation="MARLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAI
                     GDKKVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFLDR
                     LLAISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTA
                     RSDDEGRALLRAFKFPFRN"
     gene            580223..580528
                     /locus_tag="PPUBIRD1_RS02535"
                     /old_locus_tag="PPUBIRD1_0504"
     CDS             580223..580528
                     /locus_tag="PPUBIRD1_RS02535"
                     /old_locus_tag="PPUBIRD1_0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q4ZMQ7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_003255472.1"
                     /db_xref="GI:489348363"
                     /translation="MAKKSMKNRELKRQLTVAKFAKKRAELKATIVNLNASPEERFAA
                     VVALQKQPRDASASRLRNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW"
     gene            580737..581129
                     /locus_tag="PPUBIRD1_RS02540"
                     /old_locus_tag="PPUBIRD1_0505"
     CDS             580737..581129
                     /locus_tag="PPUBIRD1_RS02540"
                     /old_locus_tag="PPUBIRD1_0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013694337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_003255471.1"
                     /db_xref="GI:489348362"
                     /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSTLKVAVAKVLKDEG
                     YIAGYQVTGEAKPSLSIELKYFEGRPVIEELKRSSRPGLRQYKAVTDLPKVRGGLGVS
                     IVSTNKGVMTDRAARAAGVGGEVLCTVF"
     gene            581142..581675
                     /locus_tag="PPUBIRD1_RS02545"
                     /old_locus_tag="PPUBIRD1_0506"
     CDS             581142..581675
                     /locus_tag="PPUBIRD1_RS02545"
                     /old_locus_tag="PPUBIRD1_0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q48D51.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_003255469.1"
                     /db_xref="GI:489348360"
                     /translation="MSRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVT
                     EESGELRFVARNGDQQARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTV
                     LNLALGFSHPVDYELPAGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGK
                     GVRYADEVVRRKEAKKK"
     gene            581686..582036
                     /locus_tag="PPUBIRD1_RS02550"
                     /old_locus_tag="PPUBIRD1_0507"
     CDS             581686..582036
                     /locus_tag="PPUBIRD1_RS02550"
                     /old_locus_tag="PPUBIRD1_0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003463284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_003255467.1"
                     /db_xref="GI:489348358"
                     /translation="MTDKKVIRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISAD
                     GSKVLASASTLDKDLRDGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRV
                     KALADAAREGGLEF"
     gene            582040..582540
                     /locus_tag="PPUBIRD1_RS02555"
                     /old_locus_tag="PPUBIRD1_0508"
     CDS             582040..582540
                     /locus_tag="PPUBIRD1_RS02555"
                     /old_locus_tag="PPUBIRD1_0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QL8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_003255465.1"
                     /db_xref="GI:489348356"
                     /translation="MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGK
                     GRVGFGRGKSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASE
                     GTGIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGK
                     SVEEIF"
     gene            582543..582719
                     /locus_tag="PPUBIRD1_RS02560"
                     /old_locus_tag="PPUBIRD1_0509"
     CDS             582543..582719
                     /locus_tag="PPUBIRD1_RS02560"
                     /old_locus_tag="PPUBIRD1_0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1IFU8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_003255463.1"
                     /db_xref="GI:489348354"
                     /translation="MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENR
                     GMINKAYYMLKVEG"
     gene            582723..583157
                     /locus_tag="PPUBIRD1_RS02565"
                     /old_locus_tag="PPUBIRD1_0510"
     CDS             582723..583157
                     /locus_tag="PPUBIRD1_RS02565"
                     /old_locus_tag="PPUBIRD1_0510"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QL6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_003255461.1"
                     /db_xref="GI:489348352"
                     /translation="MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGG
                     SIAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRLSELAKVEGDVISVQSLKDANVIN
                     QHIQRVKIMLSGEVTRAVTIKGIAATKGARAAIEAAGGKFEE"
     gene            583158..584489
                     /gene="secY"
                     /locus_tag="PPUBIRD1_RS02570"
                     /old_locus_tag="PPUBIRD1_0511"
     CDS             583158..584489
                     /gene="secY"
                     /locus_tag="PPUBIRD1_RS02570"
                     /old_locus_tag="PPUBIRD1_0511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255459.1"
                     /note="forms heterotrimeric complex in the membrane; in
                     bacteria the complex consists of SecY which forms the
                     channel pore and SecE and SecG; the SecG subunit is not
                     essential; in bacteria translocation is driven via the
                     SecA ATPase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_003257108.1"
                     /db_xref="GI:489350020"
                     /translation="MAKQGALSSLGKGGMSELWARLRFLFMAIIVYRIGAHIPVPGIN
                     PDRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLE
                     QLKKEGEAGRRKISQYTRYGTVILALVQAIGMSIGLANQGVAFSVGLGFHVVAVSTFV
                     AGAMFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARTGDINIFALVAI
                     GLLAVAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFAS
                     SILLFPASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNP
                     KDVAENLKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMMAVCLLPQFLVVAANV
                     PFYLGGTSLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGGSGLLR"
     gene            584518..584634
                     /locus_tag="PPUBIRD1_RS02575"
                     /old_locus_tag="PPUBIRD1_0512"
     CDS             584518..584634
                     /locus_tag="PPUBIRD1_RS02575"
                     /old_locus_tag="PPUBIRD1_0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P61113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_002555468.1"
                     /db_xref="GI:488618619"
                     /translation="MKVRASVKKLCRNCKIIRREGVVRVICSAEPRHKQRQG"
     gene            584766..585122
                     /locus_tag="PPUBIRD1_RS02580"
                     /old_locus_tag="PPUBIRD1_0513"
     CDS             584766..585122
                     /locus_tag="PPUBIRD1_RS02580"
                     /old_locus_tag="PPUBIRD1_0513"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017939147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_003255457.1"
                     /db_xref="GI:489348347"
                     /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICADAGVNPAAK
                     IKDLSDEQIETLRGEVAKFTTEGDLRRDINMKIKRLMDLGCYRGLRHRKGLPVRGQRT
                     KTNARTRKGPRKPIRK"
     gene            585141..585530
                     /locus_tag="PPUBIRD1_RS02585"
                     /old_locus_tag="PPUBIRD1_0514"
     CDS             585141..585530
                     /locus_tag="PPUBIRD1_RS02585"
                     /old_locus_tag="PPUBIRD1_0514"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017939146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_003255454.1"
                     /db_xref="GI:489348344"
                     /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSW
                     ATSGGSGFRGSRKSTPFAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNS
                     CGYKIASITDVTPIPHNGCRPPKKRRV"
     gene            585546..586166
                     /locus_tag="PPUBIRD1_RS02590"
                     /old_locus_tag="PPUBIRD1_0515"
     CDS             585546..586166
                     /locus_tag="PPUBIRD1_RS02590"
                     /old_locus_tag="PPUBIRD1_0515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005781973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_003255453.1"
                     /db_xref="GI:489348343"
                     /translation="MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEAAPGIHGQR
                     RGRQSDYGTQLREKQKVRRIYGVLERQFRGYYQAAASKKGATGENLLQLLECRLDNVV
                     YRMGFGSTRSESRQLVSHKAISVNGKTVNIPSYQVRPGDVVAVREKSLGQLRIVQALE
                     LCAQRGRVEWVDVDAAKKSGVFKNVPARSDLSADINENLIVELYSK"
     gene            586189..587190
                     /locus_tag="PPUBIRD1_RS02595"
                     /old_locus_tag="PPUBIRD1_0516"
     CDS             586189..587190
                     /locus_tag="PPUBIRD1_RS02595"
                     /old_locus_tag="PPUBIRD1_0516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017901544.1"
                     /note="catalyzes the transcription of DNA into RNA using
                     the four ribonucleoside triphosphates as substrates.
                     Dimerization of the alpha subunit is the first step in the
                     sequential assembly of subunits to form the holoenzyme;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_003255452.1"
                     /db_xref="GI:489348342"
                     /translation="MQISVNEFLTPRHIDVQVVSPTRAKITLEPLERGFGHTLGNALR
                     RILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTL
                     SKKGSGVVTAADIQLDHDVEIVNPDHVIANLASNGALNMKLTVARGRGYEPADSRQTD
                     EDESRSIGRLQLDASFSPVRRIAYVVENARVEQRTNLDKLVIDLETNGTLDPEEAIRR
                     AATILQQQLAAFVDLKGDSEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYY
                     IGDLIQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
     gene            587233..587619
                     /gene="rplQ"
                     /locus_tag="PPUBIRD1_RS02600"
                     /old_locus_tag="PPUBIRD1_0517"
     CDS             587233..587619
                     /gene="rplQ"
                     /locus_tag="PPUBIRD1_RS02600"
                     /old_locus_tag="PPUBIRD1_0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017278734.1"
                     /note="is a component of the macrolide binding site in the
                     peptidyl transferase center; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_003255451.1"
                     /db_xref="GI:489348341"
                     /translation="MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEHELIKTTLPKAKEL
                     RRVAEPLITLAKEDSVANRRLAFDRTRSKSAVGKLFNDLGKRYATRQGGYLRILKCGF
                     RAGDNAPMAYVELVDRPVGGAVEAAE"
     gene            587792..589231
                     /locus_tag="PPUBIRD1_RS02605"
                     /old_locus_tag="PPUBIRD1_0518"
     CDS             587792..589231
                     /locus_tag="PPUBIRD1_RS02605"
                     /old_locus_tag="PPUBIRD1_0518"
                     /EC_number="1.11.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589477.1"
                     /note="Catalase; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_014589477.1"
                     /db_xref="GI:504402375"
                     /translation="MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNR
                     ENIPERRVHAKGSGAYGTFTVTHDITGYTSAKLFEEVGKQTETFLRFSTVGGERGSAD
                     TERDPRGFAVKFYTEEGNWDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMM
                     WDFWSHSPEALHQVTILFSDRGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQ
                     GIKNLTPADAARLAGTDPDYAQRDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFD
                     VTKTWSQKDYPLIEVGVLELNRNPLNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVF
                     AYADAHRYRVGTNHQQLPVNAPRCPVNSYQRDGSMATGSYGSAPNYEPNSYSDAPKQS
                     PRHVEPALAMNGSADRYDHREDTDYFSHAGALFRLMNDEQKALLISNIAGTMAGVSED
                     VIQRQLQYFFKADPAYGEGIAKALGINLA"
     gene            589395..589859
                     /locus_tag="PPUBIRD1_RS02610"
                     /old_locus_tag="PPUBIRD1_0519"
     CDS             589395..589859
                     /locus_tag="PPUBIRD1_RS02610"
                     /old_locus_tag="PPUBIRD1_0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P77930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin"
                     /protein_id="WP_003255449.1"
                     /db_xref="GI:489348339"
                     /translation="MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLSKLYERI
                     NHEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCK
                     GIELCELHKDYVSRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM"
     gene            complement(589932..592766)
                     /locus_tag="PPUBIRD1_RS02615"
                     /old_locus_tag="PPUBIRD1_0520"
     CDS             complement(589932..592766)
                     /locus_tag="PPUBIRD1_RS02615"
                     /old_locus_tag="PPUBIRD1_0520"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004883700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UvrABC system protein A"
                     /protein_id="WP_014589478.1"
                     /db_xref="GI:504402376"
                     /translation="MDKILIRGARTHNLKNIDLTLPRDKLIVITGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIYDYLRLLYARVGTPRCPDHDIPLEAQTISQMVDLVLERPEGSKLMLLAPVVRERKG
                     EHLAVFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDVVVDRFKVRADLQQRLA
                     ESFETALKLADGIALVAPMDDEQGEETIFSARFACPVCGHAISELEPKLFSFNNPAGA
                     CPTCDGLGVKQFFDTKRLVNTELTLAEGAIRGWDRRNVYYFQMLGSLAAHYGFSLEEP
                     FGELSAEHQKVILQGSGKQSVDFKYLNDRGDIVKRSHPFEGIVPNLERRYRETESATV
                     REELAKFLGTQPCPDCRGTRLRREARHVWVGEKTLPAVTNMPIGEASNYFGQLTLTGR
                     RGEIAAKILKEICERLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVM
                     YILDEPSIGLHQRDNDRLLATLNHLRDLGNTVIVVEHDEDAIRLADYVVDIGPGAGVH
                     GGQIVAEGSPQEVMDHPDSLTGKYLSGRKKIVVPAKRTPRNKKLQLKLKGARGNNLQN
                     VDLEVPIGLLTCVTGVSGSGKSTLINNTLYPLAATALNGASSLEAAPHSSMDGLQHLD
                     KVVDIDQSPIGRTPRSNPATYTGIFTPIRELFSGVPESRSRGYGPGRFSFNVKGGRCE
                     ACQGDGLIKVEMHFLPDIYVPCDVCKSKRYNRETLEIKYKGKNIHEVLEMTIEDAREF
                     FDAVPALARKLQTLMDVGLSYIKLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILD
                     EPTTGLHFADIQQLLDVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSKGGQI
                     IACGTPEELSEMKQSYTGHYLKPLLERDRA"
     gene            592896..594290
                     /locus_tag="PPUBIRD1_RS02620"
                     /old_locus_tag="PPUBIRD1_0521"
     CDS             592896..594290
                     /locus_tag="PPUBIRD1_RS02620"
                     /old_locus_tag="PPUBIRD1_0521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589479.1"
                     /db_xref="GI:504402377"
                     /translation="MHDTHNERMSSGETRAAGGLALVFAFRMLGMFMVLPVLATYGMD
                     LAGATPALIGLAIGAYGLTQAVLQIPFGMISDRIGRRPVIYLGLVIFALGSVLAAQAD
                     SIWGVIAGRILQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPL
                     LTSAFGLSGLFLVTAGLALVGMLLIAFVVPNTHSILQHRESGVARQAIGPTLRHPDLL
                     RLDVSIFILHAVLMASFVALPLAFVERGGLPKEQHWWVYLTALFISFFAMVPFIIYGE
                     KKRKMKRVLAGAVSVLLLTEIYFWEWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKV
                     SPAGGKGTAMGVYSTSQFLGAALGGILGGWLFQHGGLNTVFLGSAVLCAIWLIVALRM
                     NEPPYVTSLRMPLAPEAVREAGLTERLMAVPGVTDAVVVEEEAAIYIKLDTKILDRAT
                     LERLVNPASSACEA"
     gene            594300..594845
                     /locus_tag="PPUBIRD1_RS02625"
                     /old_locus_tag="PPUBIRD1_0522"
     CDS             594300..594845
                     /locus_tag="PPUBIRD1_RS02625"
                     /old_locus_tag="PPUBIRD1_0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_003255446.1"
                     /db_xref="GI:489348336"
                     /translation="MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQ
                     SGQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIEGKLQTREWEKDGIKRYTTEIIV
                     DINGTMQLLGGRPQGQQQGGDPYNQGGGNYGGGQQQQYNQAPPRQQAQRPQQAPQRPA
                     PQQPAPQPAADFDSFDDDIPF"
     gene            complement(594934..596316)
                     /locus_tag="PPUBIRD1_RS02630"
                     /old_locus_tag="PPUBIRD1_0523"
     CDS             complement(594934..596316)
                     /locus_tag="PPUBIRD1_RS02630"
                     /old_locus_tag="PPUBIRD1_0523"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_014589480.1"
                     /db_xref="GI:504402378"
                     /translation="MWIPQYSHQTQPVYLMIADALEQDIESGRLAEGDRLPTLKDLAE
                     ALNVTPGTVGRAYDEAAKRGLVAGEVGRGTFVRQLRQPLPAPSVPTSVAGESNQIDLS
                     IIKPNDAHMSEWLGTAISELASSSNLGQVLDYVTEGGHTSHKQAGATWIQRWLPDARW
                     QQVVLTAGAQHGLLVAISSLSKSDDVVLCESLCYPGIISLAHSLGRRLRGVAMDEHGL
                     IPEALRAACLEHRPSLLVCVTTHQNPTNSIMPPARRQAIAEIAREFDLFIVDDDIYGF
                     LEPSPDYKPLAAYAPERSVYLTSLSKSVLPALRIGYLYAPPQTLSRLSSMVRSSVWMP
                     SPLMAQLASNLINSGKADQLVRMQQQEAAARQHMAREILGQYKIRSQPHSFHIWLELP
                     EPWTSDEFANLARDNGVTVVSGSQFLPERSHATSGVRIALMAPSRQALGFALTKLASL
                     LDSPEPRLFY"
     gene            596517..597302
                     /locus_tag="PPUBIRD1_RS02635"
                     /old_locus_tag="PPUBIRD1_0525"
     CDS             596517..597302
                     /locus_tag="PPUBIRD1_RS02635"
                     /old_locus_tag="PPUBIRD1_0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589481.1"
                     /db_xref="GI:504402379"
                     /translation="MEMLGSYWAEHWLLAVLILGAIAFVAGFVDSIAGGGGLFLVPGF
                     LLVGMPPQVALGQEKLVSTLGTLAAIRNFLANSRMVWQVALVGVPFSLLGAYLGAHLI
                     VSISQETVGKIILALIPLGILIFLTPKDRPVEERKLSSRMLYTVVPLTCLAIGFYDGF
                     FGPGTGSMFIIAFHYLLRMDLVSSSANSKTFNFASNIGALVAFVSAGKVVYLLALPLV
                     AYNILGNHLGSSLALRKGNDVVRKALVFSMLCLFTSLGVKYLT"
     gene            597324..598085
                     /locus_tag="PPUBIRD1_RS02640"
                     /old_locus_tag="PPUBIRD1_0526"
     CDS             597324..598085
                     /locus_tag="PPUBIRD1_RS02640"
                     /old_locus_tag="PPUBIRD1_0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576896.1"
                     /note="NADP(+)-dependent; catalyzes the formation of
                     3-hydroxypropionate from the toxic malonic semialdehyde,
                     catalyzes the formation of 2-aminomalonate-semialdehyde
                     from L-serine; can also use 3-hydroxybutyrate,
                     3-hydroxy-isobutyrate, D-threonine,
                     L-allo-threonine,D-serine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_014589482.1"
                     /db_xref="GI:504402380"
                     /translation="MKTAFVTGASSGFGRAICCTLIGKGYRVIGGARRMDKLKALEAE
                     LGVNFIPLALDVTDSVSLEKAVEQMREASLQIDLLVNNAGLALGVDRAQTSSAANWQQ
                     MIDTNITGLAMVTHKILPQMVAADSGMIINIGSIAGTYPYPGGNVYGASKAFVRQFSL
                     NLRADLAGTRVRVSNIEPGLCSGTDFSVVRLNGDMDAVQALYRDVEALLPEDIAATVA
                     WVAEQPAHVNINTIEIMPVAQSSAALNVVRNLPRA"
     gene            598233..598823
                     /locus_tag="PPUBIRD1_RS02645"
                     /old_locus_tag="PPUBIRD1_0527"
     CDS             598233..598823
                     /locus_tag="PPUBIRD1_RS02645"
                     /old_locus_tag="PPUBIRD1_0527"
                     /EC_number="1.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007970083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_014589483.1"
                     /db_xref="GI:504402381"
                     /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHT
                     KETRNTCPYCSVGCGLILYSQGDAGKNVKQNIIHIEGDADHPVNRGTLCPKGAGLLDF
                     IHSPSRLQYPEVRKPGSKEWVRVSWDEALDRVADLMKQDRDANFIEKNAQGQTVNRWL
                     STGFLAASAASSEAGYLTHKVIRATGMLGFDNQARV"
     gene            598872..601301
                     /locus_tag="PPUBIRD1_RS02650"
                     /old_locus_tag="PPUBIRD1_0528"
     CDS             598872..601301
                     /locus_tag="PPUBIRD1_RS02650"
                     /old_locus_tag="PPUBIRD1_0528"
                     /EC_number="1.2.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_014589484.1"
                     /db_xref="GI:504402382"
                     /translation="MTNHWSDIANANLVLVMGGNAAEAHPCGFKWVTEAKAHNKARLI
                     VVDPRFTRTASVADYYAPIRTGTDIAFMGGLINYLLSNDKIQHEYVRNYTDVSFIVKE
                     NYGFEDGLFSGYDEAKRVYADKSGWGYELGEDGYAKVDPTLQHPRCVFQLMKQHYSRY
                     TPELASMTCGMPQDAMLKVWEEIASCSVPGKTMTILYALGWTQHSIGAQIIRSAAMVQ
                     LLLGNVGMPGGGVNALRGHSNIQGLTDLGLLSNSLPGYLTLAGDAEQDYAAYIDKRAS
                     KPLRPGQLSYWQNYGKFHVSLMKAWYGANATAENNWGYDWLPKLDVPAYDVLRMFEMM
                     GQGKVNGYMCQGFNPIAALPDKNRVTAALGKLKWLVVMDPLATETSEFWRNAGPFNDV
                     DTASIQTEVIRLPTTCFAEEDGSLVNSSRWLQWHWKGADGPGETRTDVQIMSELFLRL
                     RQRYQAEGGAYPDAIMNISWPYKIPEEPSPEELAKEMNGWAVADVTDPTGAVIKAGQQ
                     LAGFGQLKDDGSTASGCWIFAGSWTEQGNQMARRDNSDPYGMHQVQNWAWAWPANRRI
                     LYNRASSDPQGKPWDPEKKRLVWWNGKAWTGTDVPDFKVDSPPEAGMNPFIMNPEGVA
                     RFFAIDKMAEGPFPEHYEPFETPIGINPLHPQNKKATSNPAGRIFDSVWDTLGTHDEF
                     PYAATTYRLTEHFHFWSKHCRLNAIAQPEQFVEIGEVLANEKGIKAGDRVRVSSKRGH
                     IDAVAVVTKRIRPLQVNNQTVHQIGIPLHWGFTGATRHGYLTNTLVPFLGDGNTQTPE
                     SKSFLVKVEKL"
     gene            601301..602251
                     /locus_tag="PPUBIRD1_RS02655"
                     /old_locus_tag="PPUBIRD1_0529"
     CDS             601301..602251
                     /locus_tag="PPUBIRD1_RS02655"
                     /old_locus_tag="PPUBIRD1_0529"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012312486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit beta"
                     /protein_id="WP_003255436.1"
                     /db_xref="GI:489348326"
                     /translation="MASQDIIARSATTTVPPSVRQQEEVAKLIDTTKCIGCKACQVAC
                     SEWNELRDEVGHNHGTYDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADP
                     GCLKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCS
                     DRVSVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGT
                     HVMYVLHHADTPKLYAGLPDQPVISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRIG
                     PQRVEEDEHPTPPDESVHQVDPSVHVYDPKQPGGQGEQRP"
     gene            602248..602904
                     /locus_tag="PPUBIRD1_RS02660"
                     /old_locus_tag="PPUBIRD1_0530"
     CDS             602248..602904
                     /locus_tag="PPUBIRD1_RS02660"
                     /old_locus_tag="PPUBIRD1_0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951783.1"
                     /note="cytochrome b556(FDO) component; heme containing;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase-N subunit gamma"
                     /protein_id="WP_011953329.1"
                     /db_xref="GI:500575331"
                     /translation="MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLS
                     NLFGGGPWTRILHPFIGVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEG
                     VPPIGKYNAGQKLLFWTLLVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAF
                     VLILSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG
                     "
     gene            602909..603835
                     /locus_tag="PPUBIRD1_RS02665"
                     /old_locus_tag="PPUBIRD1_0531"
     CDS             602909..603835
                     /locus_tag="PPUBIRD1_RS02665"
                     /old_locus_tag="PPUBIRD1_0531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase accessory protein FdhE"
                     /protein_id="WP_014589485.1"
                     /db_xref="GI:504402383"
                     /translation="MSTLLEPGQIEASAVTPPFLHLPAANLFELRAARLEYLAEGNAL
                     GDYLRLIARLCRIQQQLVDNPPSGLPVAEERQRLCMDHGLPPLAADSLVREGPWLVWL
                     QALLEHLSGERSGPLGEALQVLRGSDDNQRKGWGIALLAGQYNGVPAALVPFLGAALQ
                     AAWSSWLLALPAHQLEPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWH
                     VVRVKCVYCESSKDLRYTSLEDDRHAPGKAPLRAECCPGCDSYLKQNYLENDAAAEPL
                     ADDLATLALDIRLDGEGFHRLAPNLMLAPGSG"
     gene            603975..605402
                     /locus_tag="PPUBIRD1_RS02670"
                     /old_locus_tag="PPUBIRD1_0532"
     CDS             603975..605402
                     /locus_tag="PPUBIRD1_RS02670"
                     /old_locus_tag="PPUBIRD1_0532"
                     /EC_number="2.9.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QJ8.1"
                     /note="L-seryl-tRNA(Sec) selenium transferase; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine synthase"
                     /protein_id="WP_014589486.1"
                     /db_xref="GI:504402384"
                     /translation="MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLL
                     DDLREPARNGELGSAELAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALL
                     PDEAIEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVL
                     LALNSLGARKEGIISRGELIEIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIG
                     PRTGLLMRVHCSNYSIQGFTTQVPTAKLARIAHQHELPLLEDLGSGSLLDLTRWGLPA
                     EPTVRQALADGADIVTFSGDKLLGGPQAGIIVGHKDLITRIKKNPLKRALRVDKIILA
                     ALEAVLALYRNPDRLAERLPSLRLLTRSQAEIQAQAERLAPELQARLGEQWAIRVEPA
                     LGMIGSGSQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRDLPVPVLGRIDDDALW
                     LDLRQLDDEAQWLAQLPALQLGPVQ"
     gene            605399..607321
                     /locus_tag="PPUBIRD1_RS02675"
                     /old_locus_tag="PPUBIRD1_0533"
     CDS             605399..607321
                     /locus_tag="PPUBIRD1_RS02675"
                     /old_locus_tag="PPUBIRD1_0533"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589487.1"
                     /note="selenocysteine-specific translation elongation
                     factor; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation elongation factor"
                     /protein_id="WP_014589487.1"
                     /db_xref="GI:504402385"
                     /translation="MIVGTAGHIDHGKTALLLALTGQAGDQRQEERARGMTIDLGYRY
                     VALSEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMPQTREHLAIIEL
                     LGIPQALVAISKCDRVEPSRLAEVQMQVSELLAPGPYAGARQFPLSSISGEGVEALRQ
                     ALLEAEAGTRQRSVHGGFRLAVDRAFAVTGAGVVVTGTALAGRVSAGDTLLLGKAGKV
                     VRVRGLHAQNQAALVAEAGQRVALNIAAERLAVEQVHRGDWLVPEWLHAPSVRVDIEL
                     NLLPDEKRAFEHFSAVHVHLGTQDVTARVALLEGESLAAGQRMFAQLLLNAPLQAVHG
                     DRLVLRDQRAQRTLGGGKVLDPFAPSRQRRSDTRLQQLQVLRDAADLEQALPALLASA
                     PGGISPQRLERQFNRLRETWQLPDDVRVVATRQGQLLFANAQWQALKQQVLEQLARFH
                     EQEPDQLGPDRDRLRRFVALPLERPAFVSLLDELLDDSAIASSGPWLHLPDHKVQLSE
                     ADSALWARLQPKLIAGQFDPPWVRALASEENRAEADVRLLLRKLARLGLVHQVVRDLF
                     YPEATLQRMAALMLGQASETTIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQ
                     RHIRADSALAQQHARH"
     gene            607328..607423
                     /locus_tag="PPUBIRD1_RS02680"
     tRNA            607328..607423
                     /locus_tag="PPUBIRD1_RS02680"
                     /product="tRNA-Sec"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:607362..607364,aa:Sec,seq:tca)
     gene            complement(607515..608504)
                     /locus_tag="PPUBIRD1_RS02685"
                     /old_locus_tag="PPUBIRD1_0534"
     CDS             complement(607515..608504)
                     /locus_tag="PPUBIRD1_RS02685"
                     /old_locus_tag="PPUBIRD1_0534"
                     /EC_number="3.5.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginase"
                     /protein_id="WP_014589488.1"
                     /db_xref="GI:504402386"
                     /translation="MRAVKNLLVLYTGGTIGMLETPEGLAPAGGFDARMREHFAQMAN
                     APQVQWTLHELNPLLDSANMQQHNWLAMRDAIVAAVDVAGHDGVLVLHGTDSMAYSAA
                     ALSFLLLGLPAPVVLTGSMLPAGAPDSDAWDNLCGALRQFEHGLEDGVQLYFHGQLLH
                     GCRASKLRSEAFDAFAELPRHRDAERADTIPAELGYKQPRKPVNLAVVPVFPGLQAGH
                     LQALIDSGVQGLLLECYGSGTGPSDDQALLNVLSTARQRGVMLAAISQCPEGSVVFDT
                     YAAGNRLRGAGLVSGGGMTREAALGKMMALLGAGLDADAADRWFVLDLCGERA"
     gene            complement(608577..610019)
                     /locus_tag="PPUBIRD1_RS02690"
                     /old_locus_tag="PPUBIRD1_0535"
     CDS             complement(608577..610019)
                     /locus_tag="PPUBIRD1_RS02690"
                     /old_locus_tag="PPUBIRD1_0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:alanine symporter"
                     /protein_id="WP_014589489.1"
                     /db_xref="GI:504402387"
                     /translation="MLEVINDFLSGKLLIVLIVGLGSYFTIRSRFVQFRHFTHMFSVF
                     KESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSS
                     SFFECTLAQVYKRADGDGLYRGGPAYYIQHGLKRKSMAIVFSILLLVTYGFAFIGLQS
                     YTVTHSLQNAFAFDPSHTGIVLAVLLAITFIGGIKRIAAVSDLLVPVKTLAYIGVTLY
                     VIGTQIEHVPAMLETIFKSAFGLDPAFAGLLGSAIVMGVKRGVFANEAGLGSAPNVAA
                     VAAVKHPGAQGVVQAFSVFLDTFLICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAV
                     VGDWGRVFVSVALSLFVFTCILYNYYLGENSLQFLSRNRVVLMVFRGLVLALVVWGSM
                     QDLSTVFAFADITMTCLAFVNLVALALLFKVGLRVMRDYDEQRKAGVKQPVFDSSKFA
                     DLDLDRNAWPANPQVETATDKAVGQVQTQR"
     gene            610198..611007
                     /locus_tag="PPUBIRD1_RS02695"
                     /old_locus_tag="PPUBIRD1_0537"
     CDS             610198..611007
                     /locus_tag="PPUBIRD1_RS02695"
                     /old_locus_tag="PPUBIRD1_0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_014589490.1"
                     /db_xref="GI:504402388"
                     /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPT
                     AFNLKRIGDFFGVEDYELNLPAEQFARLIGARVSPQAQQPSDPISELFRPLHEHGGNL
                     SRYCGYYFEYSNCMSVPGTILVSLVHLWEERGRFLFERQERQERSSATDQHAEVRCRY
                     LGAAFQLQDRMFLIDYESLTFNEMSQTILIPSFKSRITRLNGLKAGVSSGDRRNPACT
                     RVVWEYLGEEINRINAYRQVKLYRPDDPRIDDDVRERLSVAPLRNGLFEIE"
     gene            complement(611019..611864)
                     /locus_tag="PPUBIRD1_RS02700"
                     /old_locus_tag="PPUBIRD1_0538"
     CDS             complement(611019..611864)
                     /locus_tag="PPUBIRD1_RS02700"
                     /old_locus_tag="PPUBIRD1_0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951789.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589491.1"
                     /db_xref="GI:504402389"
                     /translation="MHIQKASPQRVKWQFDEPAPGKELFINEVFGNYQQQARLLVPDI
                     ERAAPAFVLGGARSDFTRLNPLLYRLQAAGIGSLTGNLSGHSLASEPGAMAPSLATNL
                     DEAQRFHAHIAPQCRTLIGHSLGAAITLKLAAQLPQVDSIVLICPAVYPDHAHQAPFG
                     PAFTAAINKPFGFLESDSYTFLNQFRGRVLMVIGEYDGLNSQRFGKGPGTSAGNLWLA
                     GTERYSPIPEEVNLALMRAVPASRLQCLFLTDCDHGIAAHLRSTPAIADQVADTVATF
                     ILDNA"
     gene            complement(611873..612664)
                     /locus_tag="PPUBIRD1_RS02705"
                     /old_locus_tag="PPUBIRD1_0539"
     CDS             complement(611873..612664)
                     /locus_tag="PPUBIRD1_RS02705"
                     /old_locus_tag="PPUBIRD1_0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589492.1"
                     /db_xref="GI:504402390"
                     /translation="MIEIDLTFVLLLALVALMAGFFDAIAGGGGLITLPVLFIAGVEP
                     LAAIATNKFQAASATVSATCAFARKGMIDWRRGSPMAVMAFIGGALGALSITYVPKSV
                     LQACVPPLLILIAAYFAFSPKPNEQARKAKVSTSLFCVTAAPIIGFYDGIFGPGVGSF
                     FMLACVVLLGQHLIQAVCTSKLLNAACNLGALSVFSLSGAIIWPLALAMALAAFMGAQ
                     LGARCAVRFGSRLIKPLLVSVCCIMALKLLLDTGNPLGEWLNQFF"
     gene            complement(612682..613722)
                     /locus_tag="PPUBIRD1_RS02710"
                     /old_locus_tag="PPUBIRD1_0540"
     CDS             complement(612682..613722)
                     /locus_tag="PPUBIRD1_RS02710"
                     /old_locus_tag="PPUBIRD1_0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589493.1"
                     /db_xref="GI:504402391"
                     /translation="MPHSEAAYLDFYPEQSQAITFASQTLADLGGPEAKGVALQARIF
                     ADQLEKALSEEQRALLLRFSEGHLSALMYRQMHCANEPIPEYLPDITAPAQSPRCQYL
                     ASRNQLLLELVRHRSFAFDIDNDGKQVRLVGNFKGGGRVPRPDEDPCLEVETSSHAGL
                     RLGPHTEAPYNCSTNASNAHSPAPSALILTARWNPANEPTNVFPLREIIERLSSLDTL
                     ALTSKSFDFTRSDCFAQGQGSAGKAVSVLQFEPNGGFSVRYNSYRFSLNERACSAAAR
                     AFNAFQKALSTAQPLTFALQPDSALLINNSRALHGRDKVQDNRRLLIRQFGYSPFAVP
                     LVLAEDPLLVRG"
     gene            613981..614865
                     /locus_tag="PPUBIRD1_RS02715"
                     /old_locus_tag="PPUBIRD1_0541"
     CDS             613981..614865
                     /locus_tag="PPUBIRD1_RS02715"
                     /old_locus_tag="PPUBIRD1_0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003257128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="WP_019439170.1"
                     /db_xref="GI:518268962"
                     /translation="MRMRLMLLGGGNALGQALIRLGAEEDIAFLAPRPPENGWAPSSL
                     TQLLDDHRPDALVNLAYYFDWFQAESVSEQRLAQQERAVERLAELCQHHQITLVQPSS
                     YRVFDGSRATAYSEKDEPVPLGMRGQALWRIEQSVRAACPQHVLLRFGWLLDESIDGA
                     LGRFLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCNAPLWGTYHYAGNEA
                     TTPLALGQAILAEAGQYRQLAVQAPTPQAHAARPDASEEPQHAVLACKKILHTFGIKP
                     RAWRAGLPPLLDRFYRHG"
     gene            614858..615790
                     /locus_tag="PPUBIRD1_RS02720"
                     /old_locus_tag="PPUBIRD1_0542"
     CDS             614858..615790
                     /locus_tag="PPUBIRD1_RS02720"
                     /old_locus_tag="PPUBIRD1_0542"
                     /EC_number="5.1.3.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent dehydratase"
                     /protein_id="WP_014589495.1"
                     /db_xref="GI:504402393"
                     /translation="MADAPILITGGAGFIGSHLCDALLDKGYAVRILDDFSTGRRSNL
                     QVDHPRLELIEGDVADAGLVTQAAAGCRAVVHLAAVASVQASVEDPVRTHQSNFIGTL
                     NVCEAMRVHGLRRVLFASSAAVYGNNGEGESISEDTPKAPLTPYAVDKLASEQYLDFY
                     RRQHGLEPVVFRFFNIFGPRQDPSSPYSGVISIFCERAVQGLPITVFGDGEQTRDFLY
                     VGDLVQVMVQALEQPQVEEGAVNIGLNQATSLNQLLAALGKVVGSLPAISYAAARSGD
                     IRHSRADNQRLLARFEFVQVTPMVEGLAKLLGKG"
     gene            complement(615821..616264)
                     /locus_tag="PPUBIRD1_RS02725"
                     /old_locus_tag="PPUBIRD1_0543"
     CDS             complement(615821..616264)
                     /locus_tag="PPUBIRD1_RS02725"
                     /old_locus_tag="PPUBIRD1_0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="WP_014589496.1"
                     /db_xref="GI:504402394"
                     /translation="MLDEKNAQCPVARALEVLGDRWALMILRDAFDGLRRFSEFQKNL
                     GLAKNILTSRLKLLVESGLLMTQPASDGSAYKEYVLTDKGRSVFPVVVGLRQWGERFL
                     FEAGEARSELVDGVTGQALEILQVRGQDGRVLHPEDCQRRRVRHG"
     gene            616368..617573
                     /locus_tag="PPUBIRD1_RS02730"
                     /old_locus_tag="PPUBIRD1_0544"
     CDS             616368..617573
                     /locus_tag="PPUBIRD1_RS02730"
                     /old_locus_tag="PPUBIRD1_0544"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="WP_014589497.1"
                     /db_xref="GI:504402395"
                     /translation="MTPSLTRWITLLLATTSAMAVATVYFAQPLLESMAAELGVAQQQ
                     IGWVVGATQAGYALGLLLIVPLGDLVDRKRLLLGQLLFAALALVGVGMAPNWAILLLA
                     LAITGLMAVMVQVMVAHAASLASPGQQGQAVGTVTSGVVLGILLARLASGGLADLAGW
                     RSVYLVAAGLLMLLALVLWRSLPGGQPMGSRPGYRALIVAQFSLYRHDRLLRQRGVFG
                     VLIFAAFSVLWSAMVMPLSAAPLTLSHTEIGLFGLAGVAGTLAASHAGRLADLGRGER
                     TTGVSLALLTLSWLPTAFVEHSLLAFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASR
                     LIGAYMCCYSLGSGLGAVLASWVFAHWGWVAVCGLGMGISAAALCYWLWLQRARAAEA
                     ALQCSGQNL"
     gene            complement(617561..618244)
                     /locus_tag="PPUBIRD1_RS02735"
                     /old_locus_tag="PPUBIRD1_0545"
     CDS             complement(617561..618244)
                     /locus_tag="PPUBIRD1_RS02735"
                     /old_locus_tag="PPUBIRD1_0545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092338.1"
                     /note="OmpW family protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein W"
                     /protein_id="WP_014589498.1"
                     /db_xref="GI:504402396"
                     /translation="MNKSLLGASLVALALAAPAAHAYQAGDMILRAGAITTAPNESSG
                     DLKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHIGLELLAATPFKHTVGVKGLGGGLD
                     GKLADIKQLPPTLSLQYYPMEPNSRFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKL
                     QDSVGIAGQLGMDYMLTDNLLVNASVWYVDIDTKASVNGPTALGYSKTKVDVDVDPWV
                     YMVGLGYKF"
     gene            complement(618354..618866)
                     /locus_tag="PPUBIRD1_RS02740"
                     /old_locus_tag="PPUBIRD1_0546"
     CDS             complement(618354..618866)
                     /locus_tag="PPUBIRD1_RS02740"
                     /old_locus_tag="PPUBIRD1_0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589499.1"
                     /db_xref="GI:504402397"
                     /translation="MHMLLALLLLVAMPLWAAEPKELDWPALIPEGAPVIPPQLTPLH
                     DMSQLSNALSAESAPPARQQAPDAPVVKSLDGQQVKLPGYIVPLEVSEEGRTTEFLLV
                     PYYGACIHVPPPPPNQIVHIFSEMGVRIEDLYQPYWIEGKMQVRASSSELADAGYQME
                     AEKIYAYELR"
     gene            complement(618993..620258)
                     /locus_tag="PPUBIRD1_RS02745"
                     /old_locus_tag="PPUBIRD1_0547"
     CDS             complement(618993..620258)
                     /locus_tag="PPUBIRD1_RS02745"
                     /old_locus_tag="PPUBIRD1_0547"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576905.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_014589500.1"
                     /db_xref="GI:504402398"
                     /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARA
                     SFASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFQHYAQDPRVKWAIPIS
                     LGDSHRGYRVMGTTTDYFSHYQYGRRQPLQLSQGREFANDPFEVVLGAEVAEALHYKL
                     GDKLVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHISLGGMEAIHIDWHNGV
                     PARGAGRISAEQARTMDLQPAAITAFMLGLNSKIATFSLQREINEYRSEPLLAILPGV
                     ALQELWSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWH
                     IAGLLVLEALSLASVGIVAGLGLLYAGIALAQGYVQANYGLYLPLAMPSPHEWTLLAI
                     ILGAALLMGSVPAWRAYRQSLADGLSIHL"
     gene            complement(620258..620968)
                     /locus_tag="PPUBIRD1_RS02750"
                     /old_locus_tag="PPUBIRD1_0548"
     CDS             complement(620258..620968)
                     /locus_tag="PPUBIRD1_RS02750"
                     /old_locus_tag="PPUBIRD1_0548"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine ABC transporter ATP-binding protein"
                     /protein_id="WP_014589501.1"
                     /db_xref="GI:504402399"
                     /translation="MNQPLIDLHDLVFAWPGHPPLLDIPALRLDAGEALFLKGPSGSG
                     KTTLLGLLGGVNVPVQGRIQLLGQDLGSLSQGARDRFRVDHTGYIFQQFNLLPFLSVR
                     ENVELPCRFSRSRKARAEQRHGSVGQAASTLLTHLGLGDPAMLARRADSLSIGQQQRV
                     AAARALIGQPELVIADEPTSALDADTREAFIRLLFDECRAAGASLLFVSHDQSLAPLF
                     DRHLSLAELNRAAKPREA"
     gene            complement(620969..621550)
                     /locus_tag="PPUBIRD1_RS02755"
                     /old_locus_tag="PPUBIRD1_0549"
     CDS             complement(620969..621550)
                     /locus_tag="PPUBIRD1_RS02755"
                     /old_locus_tag="PPUBIRD1_0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589502.1"
                     /db_xref="GI:504402400"
                     /translation="MRRLLLALPFALLPLAVAHAHDDHDHDHDHDHAHGSLGAHEHGV
                     AKLNAVLDGNTLELELDSPAMNLVGFEHAASSDADNAKVAAVRQQLEQPLKLFGLSAA
                     AGCKEDQQALESPLFGDASKADDEGDEHGHQHSDIGAHYQLTCANPDKLTELDLAPLF
                     KAFPATQKINVQLIGPNGQKGVETTPAKAAVAF"
     gene            621681..622025
                     /locus_tag="PPUBIRD1_RS02760"
                     /old_locus_tag="PPUBIRD1_0550"
     CDS             621681..622025
                     /locus_tag="PPUBIRD1_RS02760"
                     /old_locus_tag="PPUBIRD1_0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255407.1"
                     /db_xref="GI:489348297"
                     /translation="MRIRGQIGDWPVDLTIELTPEEWAQLGRQTEVPMVAQAAATAAV
                     VAPRQDDGQWAAARDVLRLAGQMSGPELLDRLEGLAGSTAAGKRLLVRLRHSSEVKVE
                     SGVDAPMYHWVG"
     gene            complement(622343..623215)
                     /locus_tag="PPUBIRD1_RS02765"
                     /old_locus_tag="PPUBIRD1_0551"
     CDS             complement(622343..623215)
                     /locus_tag="PPUBIRD1_RS02765"
                     /old_locus_tag="PPUBIRD1_0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_014589503.1"
                     /db_xref="GI:504402401"
                     /translation="MTQDTPYIFDATDTNFQQLVIENSFHKPVLVDFWAEWCAPCKAL
                     MPLLAKIAEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPE
                     SAIRAMLEPHVQMPAAPTAAPLEQAKALFAESRFAETEALLQALLGEDNSNVEALILY
                     ARCLAERGELGEAQVVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQN
                     PQDDEAAYQLSIQQLARQQYEAALEGLLKLFQRNRGYENGLPQKALLQVFELLGGDHP
                     LVGVYRRKLSAAMF"
     gene            complement(623247..623903)
                     /locus_tag="PPUBIRD1_RS02770"
                     /old_locus_tag="PPUBIRD1_0552"
     CDS             complement(623247..623903)
                     /locus_tag="PPUBIRD1_RS02770"
                     /old_locus_tag="PPUBIRD1_0552"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_014589504.1"
                     /db_xref="GI:504402402"
                     /translation="MPLALQQALSGLIGEARLIVSELPDCDLKLWLIDDQNMDRAFSS
                     EETRRILEEPPYWSFCWASGLAMARYLAERPEWVAGKRVLDFGAGSGIAGIAAARAGA
                     REVVACDLDPLALDACRANAALNGVTLSYSSDFFAEEDRFDLILVADVLYDRANLPLL
                     DAFLSRGRQALVADSRVRDFRHPLYQQLGVLEALTLPDLAEPHEFRRVSLYHASRDTL
                     "
     gene            complement(623907..624353)
                     /locus_tag="PPUBIRD1_RS02775"
                     /old_locus_tag="PPUBIRD1_0553"
     CDS             complement(623907..624353)
                     /locus_tag="PPUBIRD1_RS02775"
                     /old_locus_tag="PPUBIRD1_0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020191400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589505.1"
                     /db_xref="GI:504402403"
                     /translation="MHYRALVVLCCAALLAACGSNRPKTDNPVPAPAPSAKAEVLGPL
                     PAYQRELSGTLLEIPAGAEVELALLVIDERDRPQRLLASSNLTGTGQALPYHLRFNPE
                     AFPPGARVELRGRASNSGQLIMHLPPVRITQAQTQATGPLRFEKAP"
     gene            624460..624924
                     /locus_tag="PPUBIRD1_RS02780"
                     /old_locus_tag="PPUBIRD1_0554"
     CDS             624460..624924
                     /locus_tag="PPUBIRD1_RS02780"
                     /old_locus_tag="PPUBIRD1_0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QI0.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NrdR"
                     /protein_id="WP_003255402.1"
                     /db_xref="GI:489348292"
                     /translation="MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETA
                     ELVLPRLIKQDGTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGERE
                     VKSLVVGEMVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE"
     gene            624927..626057
                     /locus_tag="PPUBIRD1_RS02785"
                     /old_locus_tag="PPUBIRD1_0555"
     CDS             624927..626057
                     /locus_tag="PPUBIRD1_RS02785"
                     /old_locus_tag="PPUBIRD1_0555"
                     /EC_number="3.5.4.26"
                     /EC_number="1.1.1.193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951801.1"
                     /note="riboflavin biosynthesis protein RibD; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminohydroxyphosphoribosylaminopyrimidine
                     deaminase"
                     /protein_id="WP_014589507.1"
                     /db_xref="GI:504402405"
                     /translation="MPSQAAILDAHYMARALELARKGLYTTHPNPRVGCVIVRDGEVV
                     GEGWHVRAGEPHAEVHALRQAGELARGACAYVTLEPCSHHGRTPPCAEALVKAGVARV
                     VAAMQDPNPQVAGQGLRRLAEAGIEVASGVLEAEARALNPGFLKRMEHGLPFVRAKLA
                     MSLDGRTAMASGESQWITGPAARSAVQRLRARSSVVLTSAASVLADNARMTVRGAELG
                     LDAETTALALSRTPLRVLVDGRLRLSLASPFFQAGPALVVTAVADDPRYAAAGHELLS
                     LPGDNGQVDLGALLHALAARGVNEILLEAGAGLVGAFARQGLVDEYQLFVAGTFLGSQ
                     ARPLLDWPMDKMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
     gene            626100..626765
                     /locus_tag="PPUBIRD1_RS02790"
                     /old_locus_tag="PPUBIRD1_0556"
     CDS             626100..626765
                     /locus_tag="PPUBIRD1_RS02790"
                     /old_locus_tag="PPUBIRD1_0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008092354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="riboflavin synthase subunit alpha"
                     /protein_id="WP_012312508.1"
                     /db_xref="GI:501269490"
                     /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAV
                     NGVCLTAVELPGDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGH
                     VDGVGEIISRSDSARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTI
                     VPHTLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGF
                     LKS"
     gene            626784..627875
                     /locus_tag="PPUBIRD1_RS02795"
                     /old_locus_tag="PPUBIRD1_0557"
     CDS             626784..627875
                     /locus_tag="PPUBIRD1_RS02795"
                     /old_locus_tag="PPUBIRD1_0557"
                     /EC_number="4.1.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019581380.1"
                     /note="bifunctional enzyme DHBP synthase/GTP
                     cyclohydrolase II-like protein; functions in riboflavin
                     synthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-Dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="WP_003255398.1"
                     /db_xref="GI:489348288"
                     /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCQPEH
                     INFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAA
                     DRARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSG
                     VICEVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQSVESEL
                     GEFNLVTYRDAVEGDVHMALTLGKICAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAA
                     MAAVAEAGSGVVLLLGHPLDGDVLLAHIRESAGDAPAKAPTTYSTVGAGSQILRDLGV
                     RKMRLMSSPMKFNAISGFDLEVVEYVPSE"
     gene            627967..628443
                     /gene="ribH"
                     /locus_tag="PPUBIRD1_RS02800"
                     /old_locus_tag="PPUBIRD1_0558"
     CDS             627967..628443
                     /gene="ribH"
                     /locus_tag="PPUBIRD1_RS02800"
                     /old_locus_tag="PPUBIRD1_0558"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016490611.1"
                     /note="RibE; 6,7-diimethyl-8-ribityllumazine synthase;
                     DMRL synthase; lumazine synthase; beta subunit of
                     riboflavin synthase; condenses
                     5-amino-6-(1'-D)-ribityl-amino-2,4(1H,3H)-pyrimidinedione
                     with L-3,4-dihydrohy-2-butanone-4-phosphate to generate
                     6,6-dimethyl-8-lumazine (DMRL); riboflavin synthase then
                     uses 2 molecules of DMRL to produce riboflavin (vitamin
                     B12); involved in the last steps of riboflavin
                     biosynthesis; forms a 60mer (icosahedral shell) in both
                     Bacillus subtilis and Escherichia coli; in Bacillus
                     subtilis this 60mer is associated with the riboflavin
                     synthase subunit (alpha) while in Escherichia coli it is
                     not; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="WP_003255395.1"
                     /db_xref="GI:489348285"
                     /translation="MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHG
                     VSESDITIIRAPGAFEIPLVAQKVAQQGAYDAIIALGAVIRGGTPHFEYVAGECTKGL
                     AQVSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK"
     gene            628440..628940
                     /locus_tag="PPUBIRD1_RS02805"
                     /old_locus_tag="PPUBIRD1_0559"
     CDS             628440..628940
                     /locus_tag="PPUBIRD1_RS02805"
                     /old_locus_tag="PPUBIRD1_0559"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N utilization substance protein B homolog"
                     /protein_id="WP_003255393.1"
                     /db_xref="GI:489348283"
                     /translation="MISDESDRFNPRDPKPADAGKPSKSAKRREARKLATQALYQWHM
                     AQHSLNEIEAQFRVDNDFTDVDGAYFREILHGVPAIKGEIDKALVPCMTIALEELDPV
                     ELAVLRLSTWELIKRVDVPYRVVINEGVELAKVFGATDGHKFVNGVLDKLAPALREAE
                     VKANKR"
     gene            628959..629927
                     /locus_tag="PPUBIRD1_RS02810"
                     /old_locus_tag="PPUBIRD1_0560"
     CDS             628959..629927
                     /locus_tag="PPUBIRD1_RS02810"
                     /old_locus_tag="PPUBIRD1_0560"
                     /EC_number="2.7.4.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011953348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine monophosphate kinase"
                     /protein_id="WP_014589508.1"
                     /db_xref="GI:504402406"
                     /translation="MGEFELINHYFAAAPCAQGGEGVALGIGDDCALLDLPPGEQLAV
                     STDTLVAGVHFPAVCDPLLLGQRSLAVAASDLAAMGATAIGFTLALTLPDVGSDWLAA
                     YADGLGRMAHRCRMSLIGGDTTRGPLSITVTVFGRVPAGQALRRSGARPGDLLCVGGS
                     LGKAAGALPLVLGEREAPAAQAEPLLAHYWSPMPQLTLGALLRGKATAALDISDGLLA
                     DCGHIAKASGVALEVNLAQVPVSPALEAFLGREAALQAALTGGDDYVLAFTLPPEALA
                     PLAGLGCIEVHIIGRVLEGQGVTLRDSQGQDITPVQRGYQHFRERP"
     gene            629924..630427
                     /locus_tag="PPUBIRD1_RS02815"
                     /old_locus_tag="PPUBIRD1_0561"
     CDS             629924..630427
                     /locus_tag="PPUBIRD1_RS02815"
                     /old_locus_tag="PPUBIRD1_0561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009685716.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="WP_010951803.1"
                     /db_xref="GI:499254263"
                     /translation="MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSL
                     VAIPFIPLWQLLPDWGYWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWIT
                     LWLVPEGWQWLLAGFLMFRFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQ
                     VLVWAVA"
     gene            630444..631187
                     /locus_tag="PPUBIRD1_RS02820"
                     /old_locus_tag="PPUBIRD1_0562"
     CDS             630444..631187
                     /locus_tag="PPUBIRD1_RS02820"
                     /old_locus_tag="PPUBIRD1_0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019439174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_014589509.1"
                     /db_xref="GI:504402407"
                     /translation="MTIRTVLLAMLLSIAPWVTAAEGIPKQIHLVSEEWLDYTNADGT
                     GVAWDVLRKVFEPAGVEVITQSAPYSRAVGLVKRGEADAWVGSYKEENDDNLYPRWHF
                     DMDHIYALGLASKPVPTLETIGKYRLAWVRGYDYGSYLPNVREFREIQRREGILPMLE
                     HDRVDYYIDALTEVDYVLGQTSQPERFRRTHVAELPLYLAFARNDQAKALCELFDKRM
                     KELIRSGELKPIFEHWTQPYPFSTDSHPH"
     gene            631368..631985
                     /locus_tag="PPUBIRD1_RS02825"
                     /old_locus_tag="PPUBIRD1_0563"
     CDS             631368..631985
                     /locus_tag="PPUBIRD1_RS02825"
                     /old_locus_tag="PPUBIRD1_0563"
                     /EC_number="3.5.4.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase-2"
                     /protein_id="WP_003255389.1"
                     /db_xref="GI:489348279"
                     /translation="MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQ
                     PVLGRLHSECLTGDALFSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKI
                     RAYELQDGGADTVEANERLGFAADQRDYAICLPMLEHLGVKSLRLMTNNPRKVKALTD
                     MNIVVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQGEVPQA"
     gene            631982..632401
                     /locus_tag="PPUBIRD1_RS02830"
                     /old_locus_tag="PPUBIRD1_0564"
     CDS             631982..632401
                     /locus_tag="PPUBIRD1_RS02830"
                     /old_locus_tag="PPUBIRD1_0564"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255388.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_014589510.1"
                     /db_xref="GI:504402408"
                     /translation="MTRAEVKRRLALAWWQYLAVGLVPLPVMAWAFGGGDALIPVLAM
                     PLFIAGAATMFLSLPRFGAYKRALIATSKVLGTGEEATAWIELARVRRMAMLYACFPA
                     WVAALSVLVGLEAVPQILLALSTVVVLYLYRIPRQLG"
     gene            632401..633213
                     /locus_tag="PPUBIRD1_RS02835"
                     /old_locus_tag="PPUBIRD1_0565"
     CDS             632401..633213
                     /locus_tag="PPUBIRD1_RS02835"
                     /old_locus_tag="PPUBIRD1_0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-hydroxamate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_041166827.1"
                     /db_xref="GI:752477551"
                     /translation="MRLLPGLLALLACTVLAAEPLRVVSLAPSMSEIMLELQADDLLV
                     GVLDGGERPAALRHLPSVGRQGQLDMERLLSLRPDLLLLWPGSVPPAQRDQLKRLGIA
                     TFSAEPHDISQLIEQIEAIAERVGRAEQGHSYARALRERLQQLRQQYRRDEPLQVFYQ
                     VWDRPLYTLGGRQVVTDALAVCGARNVFADLGQPAPQVNVESVLLRNPQVILAADEAQ
                     LANWKAWPQIRAVADGRLLVVPDKGLERPSGQMIEATARLCALLDAKAPVSR"
     gene            complement(633191..635062)
                     /locus_tag="PPUBIRD1_RS02840"
                     /old_locus_tag="PPUBIRD1_0566"
     CDS             complement(633191..635062)
                     /locus_tag="PPUBIRD1_RS02840"
                     /old_locus_tag="PPUBIRD1_0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_041166828.1"
                     /db_xref="GI:752477552"
                     /translation="MKKLACTTILCAPTFLLAAERDDALKLPDVLISASRQVESRTAT
                     SAANTVFTRTDIDRLQPSSVTDLLSRVPGLQVAPTGGRGSLPGIFIRGTKAAQSLVLV
                     DGVRIANATSGDSGLQFLDIDQIERIEVLRGSRSAVYGSDAIGGVIQIFTRRSSGPGL
                     QPRLRMAAGSNQTFQRSLGLSGGNDSTRFNLGASLDETAGIDSTGPSFASDGDHDAYR
                     NKALNLSLSHTFGERFEAGLNLLDSRGRSEYDNPFGGFDPVTFESFGQQPYTDFSVSS
                     LGSYVDVQVTETWHSRLELAHSENRDDKRDKLSAERFVFNTYRDQATWQNDLALGERN
                     TVLIGGDWYEDRVHGTTDFTDDSRWNRAVFAQHRYRGEQFSTELGVRHDRNQQFGGQT
                     TWSGSLTVPLNANNDVLLSYSEGFRAPTFNDLYYPQFSNPNLDPEHSRSYELQWRSQL
                     TAESRLETSLYRTDLRDAIIFGQDSIPRNVASARINGVEMALAQQWGAWHSQLGLALI
                     DPRDRDTGHTLARRARRTLSLDLDREFGRFSVGASWQAVSNSYDDEANRNRIGGYGLL
                     GLRGSWAASDELKLEAKLDNLLDRSYSRALYSYEGAYHPYREEGRTVLLSITWTPAL"
     gene            complement(635605..637500)
                     /locus_tag="PPUBIRD1_RS02845"
                     /old_locus_tag="PPUBIRD1_0567"
     CDS             complement(635605..637500)
                     /locus_tag="PPUBIRD1_RS02845"
                     /old_locus_tag="PPUBIRD1_0567"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497788.1"
                     /note="catalyzes the formation of 1-deoxy-D-xylulose
                     5-phosphate from pyruvate and D-glyceraldehyde
                     3-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_014589513.1"
                     /db_xref="GI:504402411"
                     /translation="MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQ
                     ELLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRM
                     LSLRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDG
                     ALTAGMAFEALNHAQEVNADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREG
                     SKKVLSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNM
                     RDLKGPQFLHVVTKKGKGFAPAEIDPIGYHAITKLEPADKPAAPKKASGPKYSAVFGQ
                     WLCDMAAADNRLVGITPAMKEGSDLVDFSERYPERYFDVAIAEQHAVTLAAGMACEGS
                     KPVVAIYSTFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSYDLSYLRCI
                     PGMLVMTPSDENELRKMLSTGHLYNGPAAVRYPRGTGPNAPISGDLQPLEIGKGVVRR
                     QGEKVALLVFGVQLAEAMQVAEQINATVVDMRFVKPLDEALVLELAGNHELLVTIEEN
                     AIMGGAGAAVGEFLASQAVLKPLLHLGLPDIYVEHAKPAQMLAECGLDAAGIEASVKA
                     RMVKLGL"
     gene            complement(637678..638565)
                     /locus_tag="PPUBIRD1_RS02850"
                     /old_locus_tag="PPUBIRD1_0568"
     CDS             complement(637678..638565)
                     /locus_tag="PPUBIRD1_RS02850"
                     /old_locus_tag="PPUBIRD1_0568"
                     /EC_number="2.5.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019097894.1"
                     /note="polyprenyl synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="farnesyl-diphosphate synthase"
                     /protein_id="WP_014589514.1"
                     /db_xref="GI:504402412"
                     /translation="MIGTYQAGCQARVDAALEPLFIAPSKELERLYAAMRYSVMNGGK
                     RVRPLLAYAACEALGAPAEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHK
                     AFDEACAILAGDGLQSLAFSALLDPCLSPQIDSIRLAMVQVLAKAAGPAGMVGGQAID
                     LGSVGQKLDQQALEFMHRHKTGALIEASVRLGALASARAEPAQLDALQTYAQAIGLAF
                     QVQDDILDVESDTATLGKRQGADIARDKPTYPALLGLEAAKVYAIELRDQALAALQGF
                     GETAEPLRALARYIVERRN"
     gene            complement(638562..638804)
                     /locus_tag="PPUBIRD1_RS02855"
                     /old_locus_tag="PPUBIRD1_0569"
     CDS             complement(638562..638804)
                     /locus_tag="PPUBIRD1_RS02855"
                     /old_locus_tag="PPUBIRD1_0569"
                     /EC_number="3.1.11.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1IFK9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease 7 small subunit"
                     /protein_id="WP_003255380.1"
                     /db_xref="GI:489348269"
                     /translation="MARKKASLDFEQSLADLQALVERLENGELSLEESLAAFEQGIAL
                     TRDCQGALAQAEQKVQILLERDGELAAQPFDAEPEA"
     gene            complement(638966..639616)
                     /locus_tag="PPUBIRD1_RS02860"
                     /old_locus_tag="PPUBIRD1_0570"
     CDS             complement(638966..639616)
                     /locus_tag="PPUBIRD1_RS02860"
                     /old_locus_tag="PPUBIRD1_0570"
                     /EC_number="4.1.99.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589515.1"
                     /note="3,4-dihydroxy-2-butanone 4-phosphate synthase;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-Dihydroxy-2-butanone 4-phosphate synthase"
                     /protein_id="WP_014589515.1"
                     /db_xref="GI:504402413"
                     /translation="MFTQHHAQFPNVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAE
                     NISLQTMAMMIRDCSGIVCLCLDEATVDELQLAPMVQNNQARHGTGFTVTIEAAEGIT
                     TGVSAQDRITTIAAALSSSAEQRHIVSPGHVFPLRARNGGVLTRRGHTEGSVDLARLA
                     GLRPAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYREAMLEREAEPA"
     gene            639988..640968
                     /locus_tag="PPUBIRD1_RS02865"
                     /old_locus_tag="PPUBIRD1_0571"
     CDS             639988..640968
                     /locus_tag="PPUBIRD1_RS02865"
                     /old_locus_tag="PPUBIRD1_0571"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zeta toxin family protein"
                     /protein_id="WP_014589516.1"
                     /db_xref="GI:504402414"
                     /translation="MSFLYPFTDTDLHLAFRKVADTLFDKKRDYVDGVLKPKMLIIAG
                     AQGSGKTYLLEKTLLKSGRYDNYVRLYETHFRELHPHYRAMEDKGVLHVYEHTESFIW
                     RLGAMVCTYAMENKYNIIMETALDSPHFADFPPEAARQGYQSEVHLVACQKEFSHWST
                     LDRVVNSVANHEIERVVSLTQIEEAQINGRSIIDAFENACIEVPGSEIVIYRRGLETE
                     KNSLPVCHSTCPEKGLLVPQQTYQGRAFFRGADLKINFKVQRSPQADFPCSYIQYAQV
                     VHAGLLGSEHRRAMAELNCKTLGQAQRLMSQLPVDVYRELCLYVLKYAQR"
     gene            complement(640990..641883)
                     /locus_tag="PPUBIRD1_RS02870"
                     /old_locus_tag="PPUBIRD1_0572"
     CDS             complement(640990..641883)
                     /locus_tag="PPUBIRD1_RS02870"
                     /old_locus_tag="PPUBIRD1_0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_014589517.1"
                     /db_xref="GI:504402415"
                     /translation="MSKKTLMLALALALAAPLVLAQPEHDQKMDTSVLQRQDLAYHFS
                     QLDLDSADGLRHYRLWVGKPNRPAPASGYPVLWMLDGNAALGTLDQQQLDRLAAGQAP
                     LLVAVGYPTELRIDRAGRTLDYTPALPEQAQQRDPLTGQPSGGVDAFLKLLTGRMRTM
                     VSAVAPIDPQRQTLWGHSYGGLAVLHALFTRPGAFSLYAAASPSLWWRDGVIVREAQG
                     LPSRLGEARPHLLLMRGGQEPASPHGSPHENDELPARQLAADLAAIKGLDVRFERFEG
                     LGHGPMLGASLRRVIEGMSGQ"
     gene            complement(641984..643312)
                     /locus_tag="PPUBIRD1_RS02875"
                     /old_locus_tag="PPUBIRD1_0573"
     CDS             complement(641984..643312)
                     /locus_tag="PPUBIRD1_RS02875"
                     /old_locus_tag="PPUBIRD1_0573"
                     /EC_number="2.7.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755185.1"
                     /note="sensor protein PfeS; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_014589518.1"
                     /db_xref="GI:504402416"
                     /translation="MRRHPLLWKLALLQVSFCLLLIWLIWTWGLSVERSTYFLSPADQ
                     DYLARYAQQAEQALEQDGAVGIEAWRKQVERAEDTWVAVIGPYLQSLGTTPLSAEEAS
                     HLTFMRKLDWPMSRRLQDELPYVSIEFPQHPEHGRLVLQLPERLLPTGLTPWTHVVTH
                     GVAPALLALLLGLALYRHLVVPLNRLRDRADALRADDLDSPALPLQERRDELGELAQA
                     FEHMAGRLRQSLEQQRLLLRTLSHELRTPLARLRIAHDSDLPPPQLRERLDREVGDMQ
                     KLLENTLDLAWMDTEQPSLATEPVLVLSVWEALCEDVCFESGWDRARLPCSLGTDCLV
                     QAHLDSLAQALENLLRNAIRHSPTEGRISLDGWRSGACWHLRLSDQGPGVPDTDLERI
                     FKPYQRLADSGAGFGLGLAIARRAIELQGGRLWASNGHPGLCLHMTLPAA"
     gene            complement(643312..644004)
                     /locus_tag="PPUBIRD1_RS02880"
                     /old_locus_tag="PPUBIRD1_0574"
     CDS             complement(643312..644004)
                     /locus_tag="PPUBIRD1_RS02880"
                     /old_locus_tag="PPUBIRD1_0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589519.1"
                     /db_xref="GI:504402417"
                     /translation="MPTSLLLAEDDPRLLQDLERHFRNRGFQVHACASGTQALNAIQQ
                     SQFELVLLDIMLPGIDGLSLLDALRRQQAVPVMLMSALGAEQDRISGFTRGADDYLPK
                     PFSLAELDARVDALLRRVAFDRGTALRADVGEVMLDHDRQDVIHNGNAAGLTASEFRL
                     LVTLLAHPDEALSKPFLYQTVLHRAYTRLDRGLDVHVCNLRRKLADISAQHLQIQAVR
                     GQGYILVDTEQA"
     gene            644186..646363
                     /locus_tag="PPUBIRD1_RS02885"
                     /old_locus_tag="PPUBIRD1_0575"
     CDS             644186..646363
                     /locus_tag="PPUBIRD1_RS02885"
                     /old_locus_tag="PPUBIRD1_0575"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-denpendent receptor"
                     /protein_id="WP_014589520.1"
                     /db_xref="GI:504402418"
                     /translation="MTGFKSVGSLQRVRGWLALGLLAPFSLSAVAETVATQAAAEDTS
                     LDLPALTIEGNRLYDMLPSEETGGYSVDAATVGTKTPAALKDIPQSITVYTQDYVKDR
                     QFVHLDDLAKYTAGLRTLTNDSGRSSIYARGYEYSEFNIDGLPAPMASIFGTVPSLAA
                     FDRVEIMRGPAGLFSSTSELGGIVNMVRKRPTAEFQGHIEGSYGTWDTNHEEIDLSGP
                     LDAGGRVRGRFIASRDDTNGEVDYNANTSNSYYGALDIDLDEATTLSFGLMHEVKNIT
                     PHNGYPATLSGEVPDFSHSRFLGADWNYFDGKTTDLVAELTHRFDNGGYGRVAARGSH
                     RDTNYLYAFTATNANTGANSERASARDFTQDTYSLDASYSQPFETFGQVSEFVVGSDY
                     KNYDTEYLNGTTNLGAINVNTYSPKQFAKPSPNYSTETGMQEEEYGLYSKVTFRPIER
                     LALIAGGRFSWYRGDFYTTTLSSGATTNDSKRVDGHFTPYGGLVYDLTENHALYASYS
                     QVFKPQSDTDSNGRVLKPREGEQYEFGLKSSYFGGDLNTRFSVFRLTDKNRATTVYDA
                     DGVATTDSVASGKTRVKGAEVEVSGKLTPNWELLAGYTWMETETVKGDAETTFFIMPR
                     NQASLWSKYTISQGPLTGLAIGGGISAMSNFYSENGGVRIDAPGYATVDAMLSYPVTS
                     KLTATLNVNNLFDRDYLSRVGSTSTFNFYGPSRSMMVGARYDF"
     gene            complement(646540..647004)
                     /locus_tag="PPUBIRD1_RS02890"
                     /old_locus_tag="PPUBIRD1_0576"
     CDS             complement(646540..647004)
                     /locus_tag="PPUBIRD1_RS02890"
                     /old_locus_tag="PPUBIRD1_0576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation-binding protein"
                     /protein_id="WP_014589521.1"
                     /db_xref="GI:504402419"
                     /translation="MNALLKELHAYHHEVAAKITQIKELLERIRHGSSGADDCKLLFK
                     QLEALHGDAERHHHENEELIRLVLLTTDAPIHQRVMAIEQDHKAFTRIAGQLKMLEQS
                     TQEARVIADTIEDFIKKYYDHMDAEENIFFPLADKWLSDTQWQEIKHQWHPS"
     gene            647516..648729
                     /locus_tag="PPUBIRD1_RS02895"
                     /old_locus_tag="PPUBIRD1_0577"
                     /note="integrase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            648748..649380
                     /locus_tag="PPUBIRD1_RS02900"
     CDS             648748..649380
                     /locus_tag="PPUBIRD1_RS02900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005888934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166829.1"
                     /db_xref="GI:752477553"
                     /translation="MRRDHQLLQWLSIDQALGNLCSITREPISEEDLFSLCEEGKCSA
                     YYQAGGIRGNTQVASLEEKPQEVFGAGYQKILNASDLRGALGTGAVQLSLVGPVFSTD
                     PDDYEESRCVWEAVVADSRRKIRFKTTDIQALADTITGPSKNEALDVRERRSLLALIA
                     VLAQMDSIDLTEPYKAAGIIETGASRLGLWVPGEDTIVKYLKLAVSAKQP"
     gene            649491..649736
                     /locus_tag="PPUBIRD1_RS02905"
     CDS             649491..649736
                     /locus_tag="PPUBIRD1_RS02905"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005888935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166830.1"
                     /db_xref="GI:752477554"
                     /translation="MERNLIDSHTQRRILRRPEVEMRTGFKRAHIYSLMSRGLFPKAV
                     PIGSRAVGWDSLEVERWIADRLAGTLTRLSVSVGGAV"
     gene            649733..>650083
                     /locus_tag="PPUBIRD1_RS02910"
     CDS             649733..>650083
                     /locus_tag="PPUBIRD1_RS02910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005888939.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167120.1"
                     /db_xref="GI:752477844"
                     /translation="MTIFAYVRVTATHPSGDAQRNEIAMAHRVERWFKDEELGESTSI
                     LELPGFSELFKLARKGDTVIVYANECLGSSVRAFLQALEALQKKGVQVMSVQGGDLSA
                     FGRQVFRTLNSIARL"
     gene            650277..650858
                     /locus_tag="PPUBIRD1_RS02915"
     CDS             650277..650858
                     /locus_tag="PPUBIRD1_RS02915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016980440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="WP_041166831.1"
                     /db_xref="GI:752477555"
                     /translation="MTILAYVRVSTEDQSTDAQRHSILQLHNVEHWYADEATSGAIKA
                     LQRPGFAELFKFARKGDTLIVSAIDRLGRDTIDVLETVEALKSKGVAVVSMREGFDLS
                     SPIGKAMLTMLAAAAELERSNIKARQMAGIERARALGQKLGAPKKVDDLAVSAWRAAN
                     SATIQETAAQFGISIASVKRACASKPSVTVKGE"
     gene            650906..>651409
                     /locus_tag="PPUBIRD1_RS02920"
     CDS             650906..>651409
                     /locus_tag="PPUBIRD1_RS02920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589524.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167121.1"
                     /db_xref="GI:752477845"
                     /translation="MLREAGWTVSAIAQRLCISISTTQRLLKKHNAVAGAGTQALIEK
                     AREELLTAAFSLDAVQQTAASLVVEELALNQQIRTKLANALEILDPAHPIAFRGLAAA
                     STTLKLTQDVTRRALPLEKLNQALDFEELPELKIHIMTDRDVTEMRAQQRLEEAESDG
                     NLEGVEDE"
     gene            652110..652484
                     /locus_tag="PPUBIRD1_RS02925"
     CDS             652110..652484
                     /locus_tag="PPUBIRD1_RS02925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012702807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167122.1"
                     /db_xref="GI:752477846"
                     /translation="MKKLGIETELAFNLEFNHTGSTENHPLHIHGAFCIPDERVEEVS
                     EALRKALALGYRQRYKNLAVHIEKPWNVHWWAAYCIKEYGITASRLEAEQGRKSRPEY
                     VTQTLTQAAKAFYEDISAWLNT"
     gene            complement(652658..655072)
                     /locus_tag="PPUBIRD1_RS02930"
                     /old_locus_tag="PPUBIRD1_0581"
     CDS             complement(652658..655072)
                     /locus_tag="PPUBIRD1_RS02930"
                     /old_locus_tag="PPUBIRD1_0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589526.1"
                     /db_xref="GI:504402424"
                     /translation="MSNSELRLAALSKLVDIKSEAVDQRLSDEFNRIEASLQQSSDYD
                     ELAGSLKVLAVLVPRFHMVTLPLLQAFVRSVPNRTLTQDGSPISGSRIRYRSTESLTR
                     EAIEVAEKVRYLHTEQVVDFLLEMSQVADKETNAKADRALESLATFDLDVFYGDSPLG
                     AEPQARMVAHLDGLRNDALMANANVILRVLAIVLSPTMEGTSWSYQSVTIRRGSIASY
                     GGVADMRLAAICLTQRIFGLDTSVEHRKQALLTLNSATRREGPVDHAETSAMFERDAI
                     MVLEFMLSLVGTEALPLVQKIEHLAYWDYYHGASQAIKNKALEIRDAIAEHAEYQVYK
                     QLIGFEGIFGDWEELKRSEQAWDYSDNKRRAAARQYLSEINEASYTMWRDRILEFSKT
                     RSNDLAMFPVYYDFLESIGKERSDLAMELLIDHEEVMAPFLIALMRGLWASTTPNHLE
                     AVVKRWIEAGKHLTSIAKSLYKVGAPRLEVLTEVAGRAAALDDKGAMIQVMGVAASLY
                     AEGEMGAKSIFMHTLRELVKRDDASWASEIWFSRDFKALLSTMEQSERAEVLASLTAL
                     PELDYQAEDILYEIGKHDLQALIDFLIGRLKHARMLAKRKRETNDSSQDRFEAIPFQL
                     TKLNELLAQAPAALLNAIRADFDSEDRYMFSYRGARTVKSAFPELRTTLEELMLGYVK
                     TGNDNDIEFVIGILRIYEGSPAILNVCREIIKAVPEHSRVWNEVAAAIESTGVVGGEY
                     GMVEAYNRRLEQVSCWTNDENERVRSFAIWLTEGLQSVIEQERQRVDRSIELRKYQYG
                     SDPKED"
     gene            complement(655069..655998)
                     /locus_tag="PPUBIRD1_RS02935"
                     /old_locus_tag="PPUBIRD1_0582"
     CDS             complement(655069..655998)
                     /locus_tag="PPUBIRD1_RS02935"
                     /old_locus_tag="PPUBIRD1_0582"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589527.1"
                     /db_xref="GI:504402425"
                     /translation="MDVFHLIIDTSMLRRLHFQHPDFNRLLQQSQMGKLKIYIPRIVL
                     EEERTAQLEKHLQMIEEIRTRYAKLQRGMQGLLVQGLAEAHIELWSAVDVEQNSRATF
                     SHFVVLNKIEVIEISKDQAANAWDRYFKVEPPFNPKEEREARRKDIPDSWILEAGIEV
                     KARNGQHCALVGDNKLTNAFEKEGLRVYQDVQTLLDDIEQATAIAPIQRPIVEEAPVP
                     LDQLRSLEFKDLDVIILGLIETLDIPHKEALFSALEAAGFKRDIAEHEARTLVLSGRL
                     KDADTHFIPTSRALARQAAATDTVTNVLLRIMG"
     gene            complement(656269..656673)
                     /locus_tag="PPUBIRD1_RS02940"
                     /old_locus_tag="PPUBIRD1_0583"
     CDS             complement(656269..656673)
                     /locus_tag="PPUBIRD1_RS02940"
                     /old_locus_tag="PPUBIRD1_0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589528.1"
                     /db_xref="GI:504402426"
                     /translation="MNKIAALAVSSMLLASVALAEVKEDCSAQLNGAVRCEFTNTGKK
                     KDSACVVVEMVRLYNADVYSRSSLGGKGAVLSSDKICSGLVEPQDVRERASSVSWAVN
                     GLPMTPYQFCDSNNPWFKAPENCLMKTTTVPD"
     gene            656773..657003
                     /locus_tag="PPUBIRD1_RS02945"
     CDS             656773..657003
                     /locus_tag="PPUBIRD1_RS02945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013213591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_041166832.1"
                     /db_xref="GI:752477556"
                     /translation="MPTKPSQCPLVAVFAANVRRIRLELKLSQEELAERAGVHRTYVG
                     MLERGEKNTTIYNIEKVAEALGVEPFVLLQKQ"
     gene            complement(657134..659215)
                     /locus_tag="PPUBIRD1_RS02950"
                     /old_locus_tag="PPUBIRD1_0585"
     CDS             complement(657134..659215)
                     /locus_tag="PPUBIRD1_RS02950"
                     /old_locus_tag="PPUBIRD1_0585"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589529.1"
                     /db_xref="GI:504402427"
                     /translation="MDLTTFRQIVDRSPPAIMACQENLQHLYDYVGLEHGSSYTRSAV
                     SNALYARIRDCFTSGHAEVWRACQSLRTDLIREHTLLNAPLDPYFEVLEHLRDAVRTD
                     DNSRTTIEGDWDTAVRTAFDHVQIQSWGSENRRMTYAREFMVAEAARALRDAGYSILF
                     EPGKLGFGPESETALVANIEQLVSSMGGVNVARRIFADISKDFDPEQQRYHIVRRISA
                     TGEGQPQVPWGYLLQLAAKHIQGRKPYITTDAHWHKLRAFAQAYAAVINVQPYAPTFY
                     GTMDAVDLVPYLQEMALYDTLFRIPQMRPSDVVKIARGMLGWFDLSEPTKGGWSVNQV
                     LEVIGYLLSPSLDARGPIFITETEIRRGCPDIPPNVVAKILDDVLSHPCTGANKNFSL
                     PTDAPTSAQKSSGQDFFLRPLIRSSGRQFILLDRSVCAPACLEALLTQLRADMKDLDE
                     KIGSSIEDFLKSEFASHGICSKGGDYDSGGKHGECDLALETDETIIFAEIKKKPLTRK
                     AKAGSDAHILLDLAGSLLAAQAQAGWHEVRLRKDGHLHLESKGAISCIDLNEREVERV
                     AVTLLDFGSFQDRILLKQFLEGTLNATFTPSDANLKKGFQRINEALAEIREQLIELRS
                     AGSDVRQPFFHCWFLSVPQLLVLLDNVTDSAGFRQALWSCRHVATGSSDLYFDLSYMK
                     RLRRETTASIN"
     gene            complement(659623..660324)
                     /locus_tag="PPUBIRD1_RS02955"
                     /old_locus_tag="PPUBIRD1_0586"
     CDS             complement(659623..660324)
                     /locus_tag="PPUBIRD1_RS02955"
                     /old_locus_tag="PPUBIRD1_0586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014589530.1"
                     /db_xref="GI:504402428"
                     /translation="MNTSGDRLRALLQECGLTPSDFAAQRSVTAQHVNNWFKRGVPLA
                     RLDELADLFCVHRRWLRTGEGPKHPNPLLRNGLPRPAPANPLTPLTEHRGRVLKVPYY
                     EVRNGLLSPVGSKHLRLPAKALKGLGVQAGNAICLAMPTSNMLPLIPLQATLAIDLGM
                     TQVVEGETYALLQNGMLRVNNLSLGPHDTLYLHSHDRRNYTVERYTAAQRQAQGLEIL
                     GWVFHWSHFRQQRPS"
     gene            complement(660511..661038)
                     /locus_tag="PPUBIRD1_RS02960"
                     /old_locus_tag="PPUBIRD1_0587"
     CDS             complement(660511..661038)
                     /locus_tag="PPUBIRD1_RS02960"
                     /old_locus_tag="PPUBIRD1_0587"
                     /EC_number="3.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020796295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_003255365.1"
                     /db_xref="GI:489348254"
                     /translation="MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDTLFVDR
                     FMATPMFYPANYGFIPNTLADDGDPLDVLVVTPYPVAPGSVIRARPVGVLNMTDDGGG
                     DAKVIAVPHDKLSQLYVDVKEYTDLPALLIQQIEHFFANYKDLEKGKWVKIEGWEGAD
                     AARAAITKSVAAYKG"
     gene            complement(661131..661946)
                     /locus_tag="PPUBIRD1_RS02965"
                     /old_locus_tag="PPUBIRD1_0588"
     CDS             complement(661131..661946)
                     /locus_tag="PPUBIRD1_RS02965"
                     /old_locus_tag="PPUBIRD1_0588"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589531.1"
                     /db_xref="GI:504402429"
                     /translation="MWSFSAWRRKRTLARYPITPQQWQTVRERLPMLDGISDAEDRWL
                     REACVLFLLDKHLTCLPGVELDDEQRLMLAAQAQLPLLHLGELNWYQGFHEIILYPDD
                     FKSPQRHRDASGVEHVWDGEHSGEAWQQGPIILAWNGVQASGGWEAYNLVIHELAHKL
                     DMLNGDANGLPPLHSSMPVDEWATAMQQAYDDLNQQLDANPDAETAIDPYAAENPAEF
                     FAVTSEYFFSAPDLLHQAYPQVYHQLSLFYRQDPLARLCRLQAEHPEYRESHA"
     gene            complement(661967..662614)
                     /locus_tag="PPUBIRD1_RS02970"
                     /old_locus_tag="PPUBIRD1_0589"
     CDS             complement(661967..662614)
                     /locus_tag="PPUBIRD1_RS02970"
                     /old_locus_tag="PPUBIRD1_0589"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970692.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589532.1"
                     /db_xref="GI:504402430"
                     /translation="MDFNPLDLILHLDAYLDLLVTNYGPWIYAILFTVIFCETGLVVM
                     PFLPGDSLLFIAGAVAAGGGMDPVLLAGLLMAAAILGDSTNYVIGRTAGERLFNNPNS
                     KIFRRDYLQRTHDFYERHGGKTVTMARFLPILRTFAPFVAGIAHMHYPRFLGFSIAGS
                     LLWVGGLVTLGYFFGNVPFIKQHLSLMVVGIIILSLVPMILGLLRGRLGRTAKAH"
     gene            complement(662849..663307)
                     /locus_tag="PPUBIRD1_RS02975"
                     /old_locus_tag="PPUBIRD1_0590"
     CDS             complement(662849..663307)
                     /locus_tag="PPUBIRD1_RS02975"
                     /old_locus_tag="PPUBIRD1_0590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019472363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GNAT family acetyltransferase"
                     /protein_id="WP_014589533.1"
                     /db_xref="GI:504402431"
                     /translation="MRIIKATLEHLDLLTPLFVKYREFYGQLPYPDSSRSFLEKRLKR
                     DESVIYLALPDDDDGKLLGFCQLYPSYSSLSLKRVWILNDIYVAEDSRRMLVADHLIR
                     EAKKMAKETNAVRMRVSTSANNEVAHKTYESIGFREDTEFKSYILHISQD"
     gene            complement(663415..664233)
                     /locus_tag="PPUBIRD1_RS02980"
                     /old_locus_tag="PPUBIRD1_0591"
     CDS             complement(663415..664233)
                     /locus_tag="PPUBIRD1_RS02980"
                     /old_locus_tag="PPUBIRD1_0591"
                     /EC_number="4.3.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88QF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia-lyase small subunit"
                     /protein_id="WP_014589534.1"
                     /db_xref="GI:504402432"
                     /translation="MDHRTPTPDNPWLALRNLTPARIALGRTGTSLPTGAQLDFQFAH
                     AQARDAVHLAFDHAGLASQLSDRGRESLVLHSAASDRHQYLQRPDLGRRLNEDSIATL
                     RQHAQANPGGVDLAIVVADGLSALAVHRHTLPFLTRFDEQAAADGWTSAPVVLVQQGR
                     VAVADEVGELLGARMTVMLIGERPGLSSPDSLGLYFTYAPKVGLTDAYRNCISNIRLE
                     GLSYGMAAHRLLYLMREACRRQLSGVNLKDEAEVHSLENEDSANQKGNFLLGKG"
     gene            complement(664242..665636)
                     /locus_tag="PPUBIRD1_RS02985"
                     /old_locus_tag="PPUBIRD1_0592"
     CDS             complement(664242..665636)
                     /locus_tag="PPUBIRD1_RS02985"
                     /old_locus_tag="PPUBIRD1_0592"
                     /EC_number="4.3.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193840.1"
                     /note="with EutC catalyzes the formation of acetaldehyde
                     and ammonia from ethanolamine; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ethanolamine ammonia lyase large subunit"
                     /protein_id="WP_014589535.1"
                     /db_xref="GI:504402433"
                     /translation="MASFVHTVGHLVYRFDSLKEVMAKASPARSGDCLAGVAASNDGE
                     RVAAQMALANIPLTHFLNEALIPYEADEVTRLIIDTHDAQAFAPVSHLTVGGLRDWLL
                     SEEADESSLRALAPGLTPEMAAAVSKIMRVQDLVLVAQKIRVVTRFRGTMGLRGRLST
                     RLQPNHPTDEPAGIAASILDGLLYGNGDAMIGINPATDSIASICALLEMLDAIIQRYD
                     IPTQSCVLTHVTTSIEAINRGVPLDLVFQSIAGTEAANAGFGINLNVLQEGYEAGLSL
                     KRGTLGQNLMYFETGQGSALSANAHHGVDQQTCETRAYAVARHFKPFLVNTVVGFIGP
                     EYLYNGKQIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGVAGINF
                     IMGIPGSDDIMLNYQTTSFHDALYARQTLGLKPGPEFEAWLARTGIFTQADGRVRFGD
                     NLPPAFRQALAQLA"
     gene            complement(665683..667131)
                     /locus_tag="PPUBIRD1_RS02990"
                     /old_locus_tag="PPUBIRD1_0593"
     CDS             complement(665683..667131)
                     /locus_tag="PPUBIRD1_RS02990"
                     /old_locus_tag="PPUBIRD1_0593"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015268800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ethanolamine transporter"
                     /protein_id="WP_014589536.1"
                     /db_xref="GI:504402434"
                     /translation="MPSEHSAGSPAGSSVDFEKVGSDYFQQRELKKGAAGWVLLVGLG
                     VAYVISGDYAGWNFGLAQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGF
                     ARSAFGPWGGFLTGTAILIEYAIAPAAIAVFIGAYCQSLFGIGGWMIYLAFYIVFIGI
                     HIFGVGEALKLMFIITAIAAIALAVFLIGMVPHFDAANLFDIAKTDAVGASSFLPFGY
                     VGVWAAIPYAIWFFLAVEGVPLAAEETKNPKRDLPRGLIGAMLVLLAFALLILVVGPG
                     GAGSEALKASGNPLVEALSKAYGGSTWMGGFVNLVGLAGLIASFFSIIYAYSRQIFAL
                     SRAGYLPRKLSETNKSKAPVMALVIPGIIGFALSLTGQGDLLILVAVFGATLSYVLMM
                     AAHITLRIRRPKMERPYRTPGGIFTSGLALVLACIAVVAGFLVDPRVVIGAAVIYAVL
                     IAYFAFYSRHHLVAGTPEEEFAAIQKAEEALH"
     gene            complement(667358..668878)
                     /locus_tag="PPUBIRD1_RS02995"
                     /old_locus_tag="PPUBIRD1_0594"
     CDS             complement(667358..668878)
                     /locus_tag="PPUBIRD1_RS02995"
                     /old_locus_tag="PPUBIRD1_0594"
                     /EC_number="1.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015095079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_014589537.1"
                     /db_xref="GI:504402435"
                     /translation="MRYAHPGTEGAKVSFKSRYGNYIGGEFVTPVKGQYFENTSPVNG
                     KLIAEFPRSTAEDIEKALDAAHAAADAWGRTSVQDRSNVLLKIADRIEQNLELLAITE
                     TWDNGKPIRETLNADIPLAVDHFRYFAGCIRAQEGGAAEINEGTVAYHIHEPLGVVGQ
                     IIPWNFPILMAAWKLAPALAAGNCVVLKPAEQTPLGITVLLEVIGDLLPPGVLNVVQG
                     YGREAGEALATSKRIAKIAFTGSTPVGSHIMKCAAENIIPSTVELGGKSPNVYFEDIM
                     QAEPSFIEKAAEGMVLAFFNQGEVCTCPSRALVQESIYPQFMEVVMKKVLQIKRGDPL
                     DTDTMVGAQASQQQFEKILSYLQIAQEEGAELLTGGKVEKLEGALATGYYIQPTLLKG
                     NNKMRVFQEEIFGPVVSVTTFKDEAEALAIANDTEFGLGAGVWTRDINRAYRMGRGIK
                     AGRVWTNCYHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNLLVSYDINPLGFF"
     gene            669133..671145
                     /locus_tag="PPUBIRD1_RS03000"
                     /old_locus_tag="PPUBIRD1_0595"
     CDS             669133..671145
                     /locus_tag="PPUBIRD1_RS03000"
                     /old_locus_tag="PPUBIRD1_0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_014589538.1"
                     /db_xref="GI:504402436"
                     /translation="MQSNHFTRHARQVHSVAHGGAGEGGSDPSIARSWLRCLEDYHLD
                     PTVIEAPVVLEHGRLLESRERLHQVLQIADHEMNSLHQQLSGAGHAVLLTDARGVILN
                     CVSAPAERRSFERAGLWLGADWSEAREGTNGIGTCLVERQALTIHQNEHFRGRHTGLT
                     CSASPVFDPHGDLLAVLDVSSARPDVSRQSQFHTMALVNLSAKMIESCYFLRHFEQQW
                     LLRFHLQAESVGLFSEGLLAFDGDGRICAANQSALNLLGTVRGGVLGKPLECFFACSH
                     DEMFSRATPGGSAVWPLRTLDGRQVFASLRGQARAPVWSVPAAHPRPAGEVEPLVCLL
                     DPALQNDFRRSVRVFERNVPLLLRGETGCGKEAFAQVVHQASERRGKPFVAINCASIP
                     ESLIESELFGYRGGSFTGARKEGMRGKLLQADGGTLLLDEIGDMPLALQTRLLRVLEE
                     RQVVPIGGEPQAVDVRIVSATHRDLLERVEQGSFREDLYYRLNGLEVALPAVRERSDK
                     AQLLDFLLRQETQGQWIDIEPRARQALLAFNWPGNVRQMRNVLRTLVALCEDARITFA
                     DLPAVIRTSPPPVGAGEPTMSDQAIEGEGVALVRGQARSHRSGGAAEIEGESVGTEVL
                     LDAERQALKEVLEAKHWHLTRVAEHLGISRNTLYRKLRKHGITRGD"
     gene            671212..672561
                     /locus_tag="PPUBIRD1_RS03005"
                     /old_locus_tag="PPUBIRD1_0596"
     CDS             671212..672561
                     /locus_tag="PPUBIRD1_RS03005"
                     /old_locus_tag="PPUBIRD1_0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970697.1"
                     /note="ligates
                     L-alanyl-gamma-D-glutamyl-meso-diaminopimelate to
                     UDP-N-acetylmuramic acid for reincorporation into
                     peptidoglycan; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase"
                     /protein_id="WP_014589539.1"
                     /db_xref="GI:504402437"
                     /translation="MHIHILGICGTFMGSLAVLAKELGHRVTGSDANVYPPMSTQLEA
                     QGIELTQGYDPAQLDPAPDLVVIGNAMSRGNPAVEYVLNKGLPYVSGPQWLADHVLQG
                     RWVLAVAGTHGKTTTSSMLAWVLEHAGMSPGFLIGGVPQNFSVSARLGDTPFFVVEAD
                     EYDSAFFDKRSKFVHYHPRTAILNNLEFDHADIFPDLASIERQFHHLVRTIPGEGLVI
                     HPTTEQALERVIGMGCWTPVQTTGEGGQWQARLLSPDGSRFEVLFEGEVQGVVDWALT
                     GQHNVANALATLAAARHVGVVPAMGIEGLSAFKSVKRRMEKVAEVQGVTIYDDFAHHP
                     TAIATTLDGLRKRVGEAPVIAVIEPRSNSMKLGAHRDGLPESVNDADQVIWYAPANLG
                     WDLAGTAAQCKVPSVVADSLEAIIERIKGQARPGTHVVIMSNGGFGGLHGKLAEALK"
     gene            672558..673187
                     /locus_tag="PPUBIRD1_RS03010"
                     /old_locus_tag="PPUBIRD1_0597"
     CDS             672558..673187
                     /locus_tag="PPUBIRD1_RS03010"
                     /old_locus_tag="PPUBIRD1_0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic acid decarboxylase"
                     /protein_id="WP_003255348.1"
                     /db_xref="GI:489348237"
                     /translation="MNGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQL
                     VMATETDVVLPAKPQAMQAFLTEYTGAADGQIRVYGKEDWMSPVASGSGAPAAMVVVP
                     CSTGTLSAIATGACNNLIERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAV
                     ILPAAPGFYHQPQTIDDLVDFVVARILNLLNIPQDMLPRWGEHHFGVDD"
     gene            673184..673471
                     /locus_tag="PPUBIRD1_RS03015"
                     /old_locus_tag="PPUBIRD1_0598"
     CDS             673184..673471
                     /locus_tag="PPUBIRD1_RS03015"
                     /old_locus_tag="PPUBIRD1_0598"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003255347.1"
                     /db_xref="GI:489348236"
                     /translation="MKRALAGLLALVMLGGCATVRTLDANKPGAPVVYAGTRLDLYVI
                     NGGCCPRDHYGADAPAYPRLDLPGSMLLDTLLLPLSLLTAAGIGFQASGGL"
     gene            complement(673498..674142)
                     /locus_tag="PPUBIRD1_RS03020"
                     /old_locus_tag="PPUBIRD1_0599"
     CDS             complement(673498..674142)
                     /locus_tag="PPUBIRD1_RS03020"
                     /old_locus_tag="PPUBIRD1_0599"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589540.1"
                     /db_xref="GI:504402438"
                     /translation="MYLTPQHVLLAGATGLTGEHLLDRLLNEPTITRVLAPTRRPLAE
                     HPHLENPVGDPAVFLPQLAGRVDIAYCCLGTTLKQAGSESAFRAVDLDMVVAFSKRAR
                     EMGARHLLVVSAVGADPKSSIFYNRVKGEMEEALKAQDWPQLTIVRPSFLLGERLEPR
                     LTEQLVAPFSRFIPGKYRGIEACTLARALWRLALEEEDGVRVVESDELRRLGRI"
     gene            complement(674170..675903)
                     /locus_tag="PPUBIRD1_RS03025"
                     /old_locus_tag="PPUBIRD1_0600"
     CDS             complement(674170..675903)
                     /locus_tag="PPUBIRD1_RS03025"
                     /old_locus_tag="PPUBIRD1_0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014859890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase C13"
                     /protein_id="WP_014589541.1"
                     /db_xref="GI:504402439"
                     /translation="MRPLLPITLVLLLAACGDGESLLPPDARLPDGGRYRGQVVDGLL
                     QGEGRIDYPNGSWYAGSFKDGQWHGQGEWHGQNGEVYRGQFAEGLFQGLGELTTPGSH
                     YSGTFRHGRRDGEGTLKQADQTYRGQFKDDLYDGAGQLELADGSRYQGLFAKGKPNGA
                     GVRSDASGNQFSGHFVNGQLQGAGTYDSVDGEQYIGEFKDNRLEGRGRYENADGDVWI
                     GEFKDGSLIGEGELLGSDGSHYRGEFADWRLSGQGSLQLADGSKYIGGFLNDAYHGHG
                     RLILPSGKVESGTWANGVRVRDQNGKLLPDPLDLALLNQGRLLDEALARVPRSAPPIQ
                     LYSLVVAGDGQQSVFLREADYVSNMLKVRFGARGQVTLVNHRDHMATRPMATRENLSR
                     AAATLAERSGPEDLVFIYLTSHGSQDHQLVLDQPRLQLADLAADELATALAPLKDRDK
                     VIVISACYSGGYIAPLKDERTVIMTAARADRVSFGCSEEADFTYFGDALFAEALNQTD
                     DLKQAFELARASVAEREQREGFEASEPQLWAPPAVLEHWHRLRQQQAEEALRNATQAN
                     VREQAKMPGTH"
     gene            complement(676111..677199)
                     /locus_tag="PPUBIRD1_RS03030"
                     /old_locus_tag="PPUBIRD1_0602"
     CDS             complement(676111..677199)
                     /locus_tag="PPUBIRD1_RS03030"
                     /old_locus_tag="PPUBIRD1_0602"
                     /EC_number="1.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="butanediol dehydrogenase"
                     /protein_id="WP_014589542.1"
                     /db_xref="GI:504402440"
                     /translation="MNGLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCG
                     ICGSDLHEYVAGPVFIPVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVA
                     ADACQHCGTCYYCTHGLYNICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAG
                     ALIEPLAVGMHAVKKAGSLLGQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARK
                     AKAKEVGANVVLDPSQCDALAEIRALTAGLGADVSFECIGNKHTAKLAIDTIRKAGKC
                     VLVGIFEEPSEFNFFELVSTEKQVLGALAYNGEFADVIAFIADGRLDIRPLVTGRIGL
                     EQIVELGFEELVNNKEENVKIIVSPGVR"
     gene            complement(677228..678334)
                     /locus_tag="PPUBIRD1_RS03035"
                     /old_locus_tag="PPUBIRD1_0603"
     CDS             complement(677228..678334)
                     /locus_tag="PPUBIRD1_RS03035"
                     /old_locus_tag="PPUBIRD1_0603"
                     /EC_number="2.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577009.1"
                     /note="branched-chain alpha-keto acid dehydrogenase
                     subunit E2; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin dehydrogenase"
                     /protein_id="WP_014589543.1"
                     /db_xref="GI:504402441"
                     /translation="MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETD
                     KISSSVEAPFSGVLRRQVAKPDETLPVGALLAVVVEGEAEEAEIDAVVQRFQAEFVAE
                     GGSDQSQGPAPQKAEVGGRLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERR
                     VIALDLPGHGESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARL
                     APQRVASLSLVASAGLGEAINGQYLQGFVTAANRNALKPQMVQLFADPALVTRQMLED
                     MLKFKRLEGVDQALQQLAGALADGDRQRHDLRGVLGNHPALVVWGGRDAIIPASHAEG
                     LEAEVQVLPEAGHMVQMEAAEQVNQQLLAFLRKH"
     gene            complement(678331..679353)
                     /locus_tag="PPUBIRD1_RS03040"
                     /old_locus_tag="PPUBIRD1_0604"
     CDS             complement(678331..679353)
                     /locus_tag="PPUBIRD1_RS03040"
                     /old_locus_tag="PPUBIRD1_0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate dehydrogenase subunit beta"
                     /protein_id="WP_010951829.1"
                     /db_xref="GI:499254289"
                     /translation="MARKISYQQAINEALAQEMRRDSTVFIIGEDVAGGAGAPGEDDA
                     WGGVLGVTKGLYHQFPGRVLDAPLSEIGYVGAAVGAATQGLRPVCELMFVDFAGCCLD
                     QILNQAAKFRYMFGGKAVTPLVMRTMYGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSS
                     PYDAKGLLIQAIRDNDPVIFCEHKLLYSMQGEVPEEVYTVPFGEANFLRDGDDVTLVT
                     YGRMVHVALEAANNLARQGIDCEVLDLRTTSPLDEDSILESVEKTGRLVVIDEANPRC
                     SMATDISALVAQKAFGALKGPIEMVTAPHTPVPFSDALEDLYIPDAAKIEAAVRKVIE
                     AARSAA"
     gene            complement(679387..680364)
                     /locus_tag="PPUBIRD1_RS03045"
                     /old_locus_tag="PPUBIRD1_0605"
     CDS             complement(679387..680364)
                     /locus_tag="PPUBIRD1_RS03045"
                     /old_locus_tag="PPUBIRD1_0605"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019097910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetoin:2,6-dichlorophenolindophenol
                     oxidoreductase subunit alpha"
                     /protein_id="WP_003255338.1"
                     /db_xref="GI:489348227"
                     /translation="MSNQLSTDQLLHAYEVMRTIRAFEERLHVEFATGEIPGFVHLYA
                     GEEASAAGVMAHLRDSDCIASTHRGHGHCIAKGVDVYGMMAEIYGKKTGVCGGKGGSM
                     HIADLEKGMLGANGIVGAGAPLVAGAALAAKLKGRDDVSVAFFGDGASNEGAVFEAMN
                     MASIMNLPCIFVAENNGYAEATASNWSVACDHIADRAAGFGMPGVTIDGFDFFAVYEA
                     AGAAIERARSGQGPSLIEVKLSRYYGHFEGDAQTYRAPDEVKNLRESRDCLMQFRNKT
                     TRAGLLTAEQLDAIDARVEDLIEDAVRRAKSDPKPQPADLLTDVYVAYP"
     gene            complement(680387..681442)
                     /locus_tag="PPUBIRD1_RS03050"
                     /old_locus_tag="PPUBIRD1_0606"
     CDS             complement(680387..681442)
                     /locus_tag="PPUBIRD1_RS03050"
                     /old_locus_tag="PPUBIRD1_0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014859888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-NAD kinase"
                     /protein_id="WP_014589544.1"
                     /db_xref="GI:504402442"
                     /translation="MPLPAPIVGIIANPASGRDLRRLTANAGLYSSTDKASAIQRLLA
                     AFGATGIGQVLLPIDMTGIAAAVLKASQGPGARDQHWPAIEILDLPLSQTVADTRLAT
                     RRMVERGVAMIAVLGGDGTHKAVAAEAGDVPLLTLSTGTNNAFPELREATSAGLAGGL
                     LASGRVPASIGLRRNKRLLVNVPEQQLIEWALVEVAVSPQRFIGARALSRSEDLCEVF
                     ACFAEPHAIGLSALCGLWCPVSRQDPHGAWVRLAPDAEQALLAPLAPGLLQACGITAC
                     GPLTPGVAQRLSLASGTLALDGEREIEFAEHDTPTITLDHQGPLSVDVEAVLAHAARH
                     HLLAVPRGHRLHPANPC"
     gene            681726..683579
                     /locus_tag="PPUBIRD1_RS03055"
                     /old_locus_tag="PPUBIRD1_0607"
     CDS             681726..683579
                     /locus_tag="PPUBIRD1_RS03055"
                     /old_locus_tag="PPUBIRD1_0607"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_019438039.1"
                     /db_xref="GI:518267831"
                     /translation="MLAANSRAHVDCVSRVLKNADRLPQAPVPPLILDSWRRSMDVYR
                     LDPGSQQGPRILSQSLLNECRERAELFLRIASDAVARLHERVRGADYCVLLTDAQGRT
                     IDYRVESAIRNDCRKAGLYLGTCWSEGEEGTCGVAAVLTSKAPVTVHKRDHFRAAFIG
                     LTCTAAPVFDPLGELLGVVDVSALQSPDDRRSQHLIRQLVEQTAREIENAFFMHSAQG
                     HWVMRAHGTPGYVESQPDYLLAWDADGRLQAINSLARQRLVERLGRLPEHIGELFDID
                     QLRRVSASSAQRLPGLGGLYGRVSAPQQRQRAQPLRQAQDTRIEQHLRLATRVKDCNL
                     AVLVLGETGAGKEVFARQLHQQSQRCDGPFVTLNCAAIPETLIESELFGYVAGAFTGA
                     SSKGMQGLLQQADGGTLFLDEIGDMPLNLQTRLLRVLAEGEVAPLGAARRERVDIQVI
                     CATHRDLAAMVEDGRFREDLYFRLANARFELPPLRERDDRLGLIHQLLDEEAAACGVD
                     VVLADDALQALLVYRWPGNLRQLRQVLRYACAVSEGGQVRLQDLPQEVRGEAVGSAES
                     GVSCPARQLLLDALIRHRWKPADAARALGISRATLYRRVHEHRIDMPRMKG"
     gene            complement(683670..685025)
                     /locus_tag="PPUBIRD1_RS03060"
                     /old_locus_tag="PPUBIRD1_0608"
     CDS             complement(683670..685025)
                     /locus_tag="PPUBIRD1_RS03060"
                     /old_locus_tag="PPUBIRD1_0608"
                     /EC_number="6.4.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011535872.1"
                     /note="an AccC homodimer forms the biotin carboxylase
                     subunit of the acetyl CoA carboxylase, an enzyme that
                     catalyzes the formation of malonyl-CoA, which in turn
                     controls the rate of fatty acid metabolism; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxylase
                     subunit"
                     /protein_id="WP_003255333.1"
                     /db_xref="GI:489348222"
                     /translation="MSGKLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMH
                     LGLADESVCIGPASSKDSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSG
                     FAFIGPKADTIRLMGDKVSAKDAMIKSGVPTVPGSDGPLPEDEEVALAIARDVGYPVI
                     IKAAGGGGGRGMRVVHKEEDLISSAKLTRTEAGAAFGNPMVYLEKFLTNPRHVEVQVL
                     SDGQGNAIHLGDRDCSLQRRHQKVLEEAPAPGIDEKARQEVFKRCVDACIEIGYRGAG
                     TFEFLYENGRFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNKLSFRQEDVVIR
                     GHSLECRINAEDPKKFIPSPGKVKHFHAPGGNGVRVDSHLYSGYSVPPNYDSLIGKLI
                     TYGKDRDEAMARMRNALDEIVVDGIKTNIPLHRDLVRDEGFCKGGVNIHYLEHKLANQ
                     E"
     gene            complement(685043..685504)
                     /locus_tag="PPUBIRD1_RS03065"
                     /old_locus_tag="PPUBIRD1_0609"
     CDS             complement(685043..685504)
                     /locus_tag="PPUBIRD1_RS03065"
                     /old_locus_tag="PPUBIRD1_0609"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951833.1"
                     /note="composes the biotin carboxyl carrier protein
                     subunit of the acetyl-CoA carboxylase complex, the enzyme
                     that catalyzes the carboxylation of acetyl-CoA to
                     malonyl-CoA, which in turn controls the rate of fatty acid
                     metabolism; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein"
                     /protein_id="WP_014589546.1"
                     /db_xref="GI:504402444"
                     /translation="MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTPAAQQF
                     YAPAPMAAAPAAAPVAAAAPAAEAAAAAPALKGTVVRSPMVGTFYRKPSPTSPNFAEV
                     GQSVKKGDTLCIVEAMKMMNHIEADVGGVIDAILVEDGQPVEFDQPLFTIV"
     gene            complement(685604..686059)
                     /locus_tag="PPUBIRD1_RS03070"
                     /old_locus_tag="PPUBIRD1_0610"
     CDS             complement(685604..686059)
                     /locus_tag="PPUBIRD1_RS03070"
                     /old_locus_tag="PPUBIRD1_0610"
                     /EC_number="4.2.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase 1"
                     /protein_id="WP_010951834.1"
                     /db_xref="GI:499254294"
                     /translation="MATLLVLHGPNLNLLGTREPGHYGAVTLAQINQDLEQRARAAGH
                     HLLYLQSNAEYELIDRIHAARNEGVDFILINPAAFTHTSVALRDALLAVSIPFIEVHL
                     SNVHKREPFRHHSYFSDVAVGVICGLGASGYRLALESALEQLAANAQPK"
     gene            complement(686239..688011)
                     /locus_tag="PPUBIRD1_RS03075"
                     /old_locus_tag="PPUBIRD1_0611"
     CDS             complement(686239..688011)
                     /locus_tag="PPUBIRD1_RS03075"
                     /old_locus_tag="PPUBIRD1_0611"
                     /EC_number="1.8.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051084.1"
                     /note="thiol:disulfide interchange protein precursor;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="WP_014589547.1"
                     /db_xref="GI:504402445"
                     /translation="MRRLFFMLFLLLASPAFAAGLLDNRPSATLGAASLANNADFLPV
                     HEAFKLNLVQADAQTIKLRFVATDGYYLYRHRFQFRTEPADITLGTPNIPKGEAKHDE
                     FFGDVEVYHGVLDIELPRKDPRAFTLLVGYQGCADKGLCYPPETARLSIDGEGAANTP
                     ATGEHGWNWKSLLLFFLAGVGLTFTPCVLPMLPILSGVVLRGQVGGVRGLALSLAYVL
                     PMAASFAVLGALMGLFGASLNLQARLQSAWVLVPFALFFVVFALAMFGLFELRLPQAL
                     SNRLNNVANHTRGGSLLGAAVLGVLSSLLVSPCVSAPLAGALLYISASGDALGGALKL
                     FTLGLGMGAPLLLVATGGAAWLPKSGPWMNTVKNAIGVLLLGLAIGLLSRVLPGPVTL
                     LLVGFLAAGVALFLGALEFVVKTTAQRLAQLLGLALLVYALACWYGALTGQGDPLRPL
                     PGASLAASGSLPAAKADAWQTITTPDALDAALAQAKAAGQPVLLDWYADWCISCKVIE
                     HEVLNAPQVQTQLAGFKLLRFDITDSNAEQRTLLDRYQLFGPPALLFFAANGSEITAD
                     RVIGEINAGEFAQILTRVRGKVGL"
     gene            complement(688200..690161)
                     /locus_tag="PPUBIRD1_RS03080"
                     /old_locus_tag="PPUBIRD1_0612"
     CDS             complement(688200..690161)
                     /locus_tag="PPUBIRD1_RS03080"
                     /old_locus_tag="PPUBIRD1_0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970711.1"
                     /note="methyl-accepting chemotaxis sensory transducer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="WP_014589548.1"
                     /db_xref="GI:504402446"
                     /translation="MRLKWLTNFNTLLLVTVCIALGVTLWWSQRALERPYQLMERYLG
                     LSQQFQNQAARNIQAYLGSGDALRQAAAMEANQQLQAALTDWPVELAEKLRPSLDSLQ
                     AFTANELLAAGKLAGDPQALLLQAERELGANFEQMASYARDSGNAEANRYLLPLLDAT
                     LHLGRLSLARDKLVSSGRPELADEVERELQLIRAQAQTVDGLPLLGVTRTAESGADDF
                     AAMMGLESQSSAQQEDIAVGLKRELQSLLNRYPAELQRTREQIERRAELAATTGQRLE
                     AVQQAIAALEPEVRGQHAKIAAEVRIIQGLMIGLILLIALLIDTLQRRLARTLTGLAP
                     ALSRWAEGDFAQAIALGKTNRELHDIQESLNRLRQYLVELVGTIRHNAEQVAGSSHAL
                     AGMSAALHGGAERQAGDTGQIRDALGELEATIQQVAGDASAAAEASRDAGRAVEQGQA
                     VIGQSLSGLRELVDEVQGNARMIEQLAEESATIGGVLTVIRAIAEQTNLLALNAAIEA
                     ARAGEMGRGFAVVADEVRSLAQRTTGATGEIQALIDRLQQAARSSVAGMRAQLEHAEA
                     TANQAQAADGALDEIVCAIRTIADTAVRIADVTAQQSGAVSEIRDHSERIHALGEDNL
                     QRIGEGREQGEQLLSLGGELNRAVRAFRV"
     gene            complement(690308..691663)
                     /locus_tag="PPUBIRD1_RS03085"
                     /old_locus_tag="PPUBIRD1_0613"
     CDS             complement(690308..691663)
                     /locus_tag="PPUBIRD1_RS03085"
                     /old_locus_tag="PPUBIRD1_0613"
                     /EC_number="2.7.7.65"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_014589549.1"
                     /db_xref="GI:504402447"
                     /translation="MSQAVEPSPQCPVQQLTRNGLRKDDPLDQLLLPVRKPVYILLQD
                     HERAQRLAQQLEFFGLVVQALPSAAAFLASISEYPPSAIIMDVDFTGAGLGLLLAAQV
                     QQGLARAIPLLFFSHHEADTPTRLAAVRAGGQDFLTGSLEASSLLEKVELLTNTAPHD
                     PLRVLIIDDSRTQAMYTERVLAGAGMLTRSLTDPIRTMAELADFQPDLIILDLYMPAC
                     TGPELAKVIRHSDRYVSVPIIYLSAEDDLDKQLDAMSEGGDDFLTKPFRSRHLITTVR
                     NRAARARHLKARMVRDSLTGLYNHTHILQLLEDCSFRARREQQPLSFAMLDIDHFKKI
                     NDRHGHPMGDRVIKSLALFLKQRLRKTDFIGRYGGEEFAIVMPNTALDAAHKVLDEIR
                     RRFAEILYPAQPRDLQCTFSAGVVQLDEGLDALTMASAADEALYRAKHAGRNCVVRVE
                     P"
     gene            691912..692979
                     /locus_tag="PPUBIRD1_RS03090"
                     /old_locus_tag="PPUBIRD1_0614"
     CDS             691912..692979
                     /locus_tag="PPUBIRD1_RS03090"
                     /old_locus_tag="PPUBIRD1_0614"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009685766.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589550.1"
                     /db_xref="GI:504402448"
                     /translation="MLDWKNREAKAEPRERVDGRGAAARSYLGGLWSRALGTLIGLYL
                     LVCIGLGWYWSQEPALFPVQQNAQAAAERAGQQMVVGYTTVETLKTVAGTLLNKPGGY
                     ISNDRFPPGLWMDNMPSWEYGVLVQVRDLSRALRKDFARSQSQSTEDADLAKAEPRFN
                     FDNKSWILPSSESEFEEGIKSLTRYQTRLAAGDKGAIFYTRADNLNNWLGDVATRLGS
                     LSQRLSASVGRVKLNTTLKTESVVAGQAPQVDEELVETPWLQIDNVFYEARGQAWALS
                     HLLRAIEVDFADVLAKKNATVSVRQIIRELEASQESLWSPMVLNGSGFGMWANHSLVM
                     ANYISRANAAVIDLRQLLSQG"
     gene            692982..693518
                     /locus_tag="PPUBIRD1_RS03095"
                     /old_locus_tag="PPUBIRD1_0615"
     CDS             692982..693518
                     /locus_tag="PPUBIRD1_RS03095"
                     /old_locus_tag="PPUBIRD1_0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="WP_014589551.1"
                     /db_xref="GI:504402449"
                     /translation="MAISPTEAAHRAASDRELVTWVDETDQVLGALPRAELRERGLIG
                     RCTFILLFNSAGELCVHRRTLSKALYPGYWDVAAGGMVTAGEAYAESAARELAEELGI
                     EGADLRFHERFYFDQPDNRLWCAVYSAVSDAPLRLQPEEVIEARFIGLEQAEQESLSK
                     PYCPDSLAALQRYKASLR"
     gene            693802..694173
                     /locus_tag="PPUBIRD1_RS03100"
                     /old_locus_tag="PPUBIRD1_0616"
     CDS             693802..694173
                     /locus_tag="PPUBIRD1_RS03100"
                     /old_locus_tag="PPUBIRD1_0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016715401.1"
                     /note="involved in start site selection during the
                     initiation of translation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor Sui1"
                     /protein_id="WP_003255318.1"
                     /db_xref="GI:489348207"
                     /translation="MAKKASSFSALGGLVYSTDAGRHCPDCGQPVDACTCKQQIIPEG
                     DGIARVRRESKGRGGKTVTTVTGVPLPPDQLKELATTLKRRCGTGGALKDGVIEIQGD
                     HVELLIGELTKQGFKAKKSGG"
     gene            694324..696237
                     /locus_tag="PPUBIRD1_RS03105"
                     /old_locus_tag="PPUBIRD1_0617"
     CDS             694324..696237
                     /locus_tag="PPUBIRD1_RS03105"
                     /old_locus_tag="PPUBIRD1_0617"
                     /EC_number="4.1.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270333.1"
                     /note="catalyzes the formation of agmatine from arginine
                     in putrescine and spermidine biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biosynthetic arginine decarboxylase"
                     /protein_id="WP_010951840.1"
                     /db_xref="GI:499254300"
                     /translation="MSVRRTRKDDGSQWTVADSRSVYGIRHWGAGYFAINEAGRVEVR
                     PNGPQSAPIDLFEQVDELRQSGLSLPLLVRFPDILQDRVRQLTGAFDANIARLEYQSQ
                     YTALYPIKVNQQEAVVENIIATQNVSIGLEAGSKPELLAVLALAPKGGTIVCNGYKDR
                     EFIRLALMGQKLGHNVFIVIEKESEVALVIEEAAELKVKPQVGLRVRLSSLASSKWAD
                     TGGEKSKFGLSAAQLLSVVQRFRDAGLDQGIRLLHFHMGSQIANLADYQHGFKEAIRY
                     YGELRALGLPVDHIDVGGGLGVDYDGTHSRNASSINYDMDDYAGVVVGMLKEFCDAQG
                     LPHPHIFSESGRSLTAHHAMLVIQVTDVEKHNDDVPTIENKEALPETVQWLVDLLGPT
                     DIEMVTETYWRATHYMGDVAAQYADGKLSLGEKALAEQCYFAVCRRLHNSLKARQRSH
                     RQVLDELNDKLADKYICNFSVFQSLPDTWAIGQVLPIIPLHRLDEEPMRRAVLQDLTC
                     DSDGKINQYVDEQSIETSMPVHAVKEGEDYLLGVFLVGAYQEILGDMHNLFGDTDSVN
                     IYQNADGSVYHAGIETHDTIEDMLRYVHLSPEELMTHYRDKVASAKITARERTQYLDA
                     LRLGLTRSSYLSS"
     gene            696446..696901
                     /locus_tag="PPUBIRD1_RS03110"
                     /old_locus_tag="PPUBIRD1_0618"
     CDS             696446..696901
                     /locus_tag="PPUBIRD1_RS03110"
                     /old_locus_tag="PPUBIRD1_0618"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589552.1"
                     /db_xref="GI:504402450"
                     /translation="MDRHGNHRLRQGRFSEPGRLYLLTTITRDRLPLFKNLLFARTVI
                     QQLRLSDHEGGCRSLAWVLMPDHLHWLIELGPTSLGNLMCAFKSRSSCALYRKGIDRR
                     HIWQPGFHDRALRKEEDVKAAARYIIANPIRAGLVRGAGEYPHWDCVWL"
     gene            complement(696975..698312)
                     /locus_tag="PPUBIRD1_RS03115"
                     /old_locus_tag="PPUBIRD1_0619"
     CDS             complement(696975..698312)
                     /locus_tag="PPUBIRD1_RS03115"
                     /old_locus_tag="PPUBIRD1_0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589553.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_014589553.1"
                     /db_xref="GI:504402451"
                     /translation="MPQLAADWRHRPTHRKVWALAAPMILSNISVPLVALVDSTVIGH
                     LPHAHQLGAVAVGATLFTFMVGLMGFLRMGSTGFAAQAAGRGDGAALRQVLVQGLLLA
                     VGFALLIGLLALPFSQLALHAMQPSAALQQSTEDFFHTRLLGLPAALASYALVGWFLG
                     TQNARAPLAILLTTNLLNIALNLWFVLGLDWGVLGSARASVIAEWSAALLGLALTRPA
                     LRAYPGQIMWAALKRWQAWRPLLAVNRDIFLRSLALQLVFLLITVQGARLGEATVAAN
                     ALLLNGLLLTAYALDGLAHAVEALCGHAIGARNRDTLRRSLVVACGWSLITSLGFAGL
                     FLLGGHLFIDLQTDIESVRAAAYPYLPYLALLPLIAVWSYLLDGLFIGATRAGEMRNA
                     MLVSVLIALPVAVGMSGFGNHGLWMAFLGFMGLRAVTLGWVGWRLQQKGEWIA"
     gene            698590..703485
                     /locus_tag="PPUBIRD1_RS03120"
                     /old_locus_tag="PPUBIRD1_0620"
     CDS             698590..703485
                     /locus_tag="PPUBIRD1_RS03120"
                     /old_locus_tag="PPUBIRD1_0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein yfhM"
                     /protein_id="WP_014589554.1"
                     /db_xref="GI:504402452"
                     /translation="MFNKGLLLACALALLSACDSSTPGKPAPVEKTVAPAEAPAPKRE
                     DPAVLAKRYEGRELTVLDVSEVQLDGAATLSISFSVPLDAKQDFATKVHLVDTVKGKL
                     DGAWELSDNQMELRLRHLEPQRKLVLTVDKGLLAVNGKQLDNESITRLETRDMQPTIG
                     FASRGSLLPTRLAEGLPVIALNVDKVDVEFFRVKPDMLSTFLANWGRNSSLYYYQSKE
                     TLDMAELVYSGRFDLNPARNTRETVLLPIAGIKPLQAPGVYLAVMRASGTYDYSQPAT
                     LFTLSDIGVSAHRYRDRIDVFAQALEGGKALSGVNLEIHDEKGKLLAQATTDGKGHAQ
                     LPITPKADTLIATQGVHTTLLRLNTAALDLAEFDITGPQANPLQFFIFGPRDLYRPGE
                     TVLLNGLLRDQDGKPVKAQPVSVEVRRPDEQVSRKFVWEADGNGLYQYQLQLATEAPT
                     GRWQLLLDLGGGRKQVYEFLVEDFLPERLALELKGSSTPLSPDEDARIQVNGRYLYGA
                     PAAGNRLSGQAYVRPLREAVPALPGYQFGSVTETELNQDLELDEVTLDQAGKAVVDIE
                     SRWAEARSPLQLTVQASLQESGGRPITRRLEQPIWPAERLPGLRGLFEGEETDSDGPV
                     EFEFLVADRDGNKLAADALKVRLVRERRDYYWNYSQSDGWSYAYNEKFLTQNEETISV
                     KAGSTAKLSFQVEWGPYRVEVEDPQTGLVSSERFWAGYRAQDNAEGGAVRPDQVKLAL
                     DKPSYTDGATAKVTVTPPAAGSGYLMIESSDGPLWWQEIDVPAEGKTFDVQLDKAWAR
                     HDLYVSALVIRPGERKANATPKRAVGVLHLPLDRAERKLALSLQAPEKMRPKQPLTVK
                     IKAANADGSVPKQVHVLLSAVDVGILNITDFKTPDPFASLFGRKAYGADQLDIYGQLI
                     EAGQGRLASLAFGGDAAMAKGGKRPNTTVTIVAQQSLPVTLDDKGEGQATVDIPDFNG
                     ELRLMAQAWTEEHFGMAEGKTVVAAPLIAELSAPRFLAGGDRTSLALDLANLSGRAQQ
                     LSVEITTDGQLSLAANAVQSINLAEGQRSTLMIPVQAQGGLGQGKVHVRVTGLQLPNE
                     PVNAFEREWTLGVRPAYPAMLKHYRVALKDQPWTLPEADLAAFEPAGLEASLALSSRP
                     PLNLAEQIRALQAYPYGCLEQTTSGLYPSLYADADSLKRLGIKGEPADVRKRKIEMGI
                     EHLLGMQRYNGSFGLWSSDSEEEYWLTAYVTDFLLRARDQGYGVPAEALKKASERLLR
                     YLQERNLIEVDYSENADHTRFAVQAYAALVLSRSQQAPLGALRGLFERRADARSGLPL
                     VQLAVALDKMGDKPRAEQALQAGLGISRGKGWLADYGSALRDQALILALLQESNLASS
                     QVDQRLFALSDELAANRWLSTQERNALFLAGRGLLGKPEGQWQARLDSAGEVRELNNA
                     EAGMKLEGPLLASPLSVQNQGPETLYQQLTLSGYPRQAPAAGGNGMQIHREYLGMNGQ
                     PLDLHNLRSGDLVLVHLALKAEDRVPDALVVDLLPAGLELENQNLAQSAASLDNASSA
                     VKAWRESMQNASVVHQEYRDDRYVAALKLDGYGTTHLLYLARAVTPGTYRVPPPQVES
                     MYRPNLQAVGDGQGEMTVKAR"
     gene            complement(703637..703930)
                     /locus_tag="PPUBIRD1_RS03125"
                     /old_locus_tag="PPUBIRD1_0621"
     CDS             complement(703637..703930)
                     /locus_tag="PPUBIRD1_RS03125"
                     /old_locus_tag="PPUBIRD1_0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970720.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004577004.1"
                     /db_xref="GI:490714258"
                     /translation="MHVEGFFEWLGQALGSLIRFIVDALSGLFNLLANAGGNFIDGLS
                     RTLGMDTSLLSILALIIGLMLLYSAIRAFMRASIILGIIWLVLGLWVMSWVIH"
     gene            704008..706362
                     /locus_tag="PPUBIRD1_RS03130"
                     /old_locus_tag="PPUBIRD1_0622"
     CDS             704008..706362
                     /locus_tag="PPUBIRD1_RS03130"
                     /old_locus_tag="PPUBIRD1_0622"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438044.1"
                     /note="penicillin-insensitive
                     transglycosylase/transpeptidase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1C"
                     /protein_id="WP_041166833.1"
                     /db_xref="GI:752477557"
                     /translation="MPSLARPRCRAGRLLRATLISLLVLGGLFWLADRVWPLPLPGDD
                     LARVVLAEDGTPLWRFADADGVWRYPVSPEEVSPLYLQALLTYEDRWFYNHPGVNPLA
                     LARAAWLNLRGGRVVSGGSTLSMQVARLLDPHDRTLVGKLRQLWRTLQLEWHLSKRDI
                     LQIYLNRAPFGGTLQGVAAASWAYLGKSPLHLTPAEAALLAVLPQAPSRLRPDRHPER
                     AQRARDKVLQRLAEYQVWPTRQIREAAEEPLVLAPRQEPALAPLLARRLNSADSPPLI
                     RTTLDAALQRRLEDLLLGWRARLPERTSAAILVVEAQSMAVRAYLGSIDLSDERRFGH
                     VDMVRSLRSPGSTLKPFLYGMALDDGLIHSESLLQDVPRRYGDYRPGNFSMGFSGPVS
                     ASSALALSLNLPAVQLLEAYGPKRFAAQLRMAGMPLILPPLAEPNLSLILGGAGSRLE
                     DLVGGYAALARGGNSAQVRLQPQAPLVEHRLLSPGAAWIIRRILSGQARPDRDPHAEL
                     VQRPLLAWKTGTSYGFRDAWSIGVGPRYLIGVWIGRPDGTPVPGQFGLASAAPLMLQV
                     HDLLSNRDSQRGISVPVAPVPANIGVAAICWPLGQPMSKQDTNCRRQRFAWTLDGTTP
                     PTLQAADQPLGLGLREKVWVNEQGLRVDGSCPGAKARDIALWPAPLEPWLPRVERRIA
                     RLPAIDPACPPQAPASAPPLSIVGVRPGDNLRRPATSTEPLQLQVSALGGGGRRWWFL
                     NGQPLGETQGQDSLLLRLPQVGQAELSALDESGQTARVAFQVSE"
     gene            706455..708119
                     /locus_tag="PPUBIRD1_RS03135"
                     /old_locus_tag="PPUBIRD1_0623"
     CDS             706455..708119
                     /locus_tag="PPUBIRD1_RS03135"
                     /old_locus_tag="PPUBIRD1_0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium-transporting ATPase subunit A"
                     /protein_id="WP_014589556.1"
                     /db_xref="GI:504402454"
                     /translation="MRPLVVPLMLLLWALAAQADPLPGFLDSHEYERRLPSANLPMTD
                     YSPVSPHIRLAGAAIENPDWAPANTRLVLHKVRFEGGTVFPLGDLREHYQPLIGRETT
                     LGELQQYTQCLTQRYRQEGYLLSYAYLPPQDVADGRVNVVLVEGYVRDYRVDGDIGPA
                     SEYLQQLLARIEAERPLTRETLERYLGLATRMPGVVIEAELAVARAADGVARLTVHAR
                     RTPLSAAVTVADSSRDAAQALITVASTAQTRHGERVTASWLLPPGNDRVYYQRLDYSQ
                     YLDAAGSQLLLSASRYRSEPGTRIRLDDGRDITREHDSERYAIGLRQPVVVRPNEWLA
                     VQGHLYSVSEHDEDRMAEQPPSRKYDTYVRALSFEGDWRKVEQGRLRIVSAGVHQGLD
                     YLGARSDADYDLDFLRLRLSGLQSDTLLENWQGVVSGVFYWSDDRLPDSERAGFGGQN
                     FGRGYPRDQADGDKGWGVAYELNYSVRSSWLARVQPYAVVDTAQAWHNRGPVEDAHLA
                     SVALGVRLGGGHMFNVALEVAKPLADVALDSLDRRPRLSLNLAIQL"
     gene            complement(708192..708968)
                     /locus_tag="PPUBIRD1_RS03140"
                     /old_locus_tag="PPUBIRD1_0624"
     CDS             complement(708192..708968)
                     /locus_tag="PPUBIRD1_RS03140"
                     /old_locus_tag="PPUBIRD1_0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_041167123.1"
                     /db_xref="GI:752477847"
                     /translation="MSRPVSDVKVLVVDDQPVIVEQLSEFLETKGYTCVTALSTDEAI
                     EHYVADPSIGLLICDLHMPERDGVELVRALKEINGNKRMFEAIMLTGRAEKQDLIRAL
                     REGFADYYQKPMDLDELLAGVRRQEEALLERQRNLRDLGGLNQRLQELAESVDELYQD
                     LEKARGQGTHRRASDAEESESELPPAFEKLSPRQLEVARLVSKGNTNYQIACELGITE
                     NTVKLYVSQVLRLTHMHNRTQLALALTPSSSPVHQRFTTH"
     gene            complement(709088..709558)
                     /locus_tag="PPUBIRD1_RS03145"
                     /old_locus_tag="PPUBIRD1_0625"
     CDS             complement(709088..709558)
                     /locus_tag="PPUBIRD1_RS03145"
                     /old_locus_tag="PPUBIRD1_0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase A24"
                     /protein_id="WP_010951848.1"
                     /db_xref="GI:499254308"
                     /translation="MQSIVLLLWLALCSEQDVRQRQISNVLTLGAAGCALAWLFSTGH
                     SWIGAEASEAGWALAIVMLLTLPGYMLGRFGADDVKLMGALALATSPQYVLGTFIGAG
                     VTVLVWLLTRRRLWTLLNPKVKKRLQALTEEMGDKQAFVPYVLSGFLLTAVWIQ"
     gene            complement(709864..710433)
                     /locus_tag="PPUBIRD1_RS03150"
                     /old_locus_tag="PPUBIRD1_0626"
     CDS             complement(709864..710433)
                     /locus_tag="PPUBIRD1_RS03150"
                     /old_locus_tag="PPUBIRD1_0626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_010951849.1"
                     /db_xref="GI:499254309"
                     /translation="MLRRLVLLSFALLLAACSSNNVQQDFDASRDFAAYRSWAWQEPG
                     LQYRPDDPRIKSDLTEQRIRQAVADQLDQRGLRPVQGGARPDLTVRTYLIVEQRQQQI
                     TTNYGGGWGGYWGGYWGGPMYNETRSVDYKVATIQVDMFDGRDGKLVWRGSAEQIMNN
                     YPPSPEERNSAIRNTVAKVLGNYPPGSKK"
     gene            complement(710453..711088)
                     /locus_tag="PPUBIRD1_RS03155"
                     /old_locus_tag="PPUBIRD1_0627"
     CDS             complement(710453..711088)
                     /locus_tag="PPUBIRD1_RS03155"
                     /old_locus_tag="PPUBIRD1_0627"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016715411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589558.1"
                     /db_xref="GI:504402456"
                     /translation="MPYRLLCLALLPIALAGCQGSNPYVASSRPLPPAPAQAATTFDA
                     SAYPAPARDYGHYRSWSWRNGQLPSGAVDADPAQLADAVSGALDQHGLRPSRAGPGDL
                     LVSADMRLEKRLRQVRDYDTYDPYYGPYPYGGVGYGGYRHGYGGYASVPIVRTYEVEV
                     LVVRIDLYDARSGQPVWSASAESSSNKDSPRERESALRDSVHKALSGYPPS"
     gene            complement(711111..711860)
                     /locus_tag="PPUBIRD1_RS03160"
                     /old_locus_tag="PPUBIRD1_0628"
     CDS             complement(711111..711860)
                     /locus_tag="PPUBIRD1_RS03160"
                     /old_locus_tag="PPUBIRD1_0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008093119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Methyltransferase, putative"
                     /protein_id="WP_014589559.1"
                     /db_xref="GI:504402457"
                     /translation="MNDRHFDELATRFAEKIYGGAKGAIRLAVLQADLAEALPDRPLR
                     ILDIGAGLGHMALWLAERGHQLTLAEPAAPMLDGARARFAEAGQTATFIQAPWQDLLG
                     QLTERYDLVLCHAVLEWLADPESILPVLHQLTAPDGWLSLAFYNRDALVYRNLLKGHF
                     RKLRSNRLEGEKQSLTPQKPLDPRELKAQLEPMWLVESESGVRVFHDYMPKEFQGKAE
                     LLDLLEMELAHRRHPTFAGLGRYLHWVCRPR"
     gene            complement(711857..712162)
                     /locus_tag="PPUBIRD1_RS03165"
                     /old_locus_tag="PPUBIRD1_0629"
     CDS             complement(711857..712162)
                     /locus_tag="PPUBIRD1_RS03165"
                     /old_locus_tag="PPUBIRD1_0629"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrophosphatase"
                     /protein_id="WP_003255298.1"
                     /db_xref="GI:489348186"
                     /translation="MNLQELTQRLHQIRDTNDWRGFHSPKNLAMAASVEMAELVEIFQ
                     WLSEDESRQLPADKLAHAGQEIGDVVLYLLLLCSELGLDMDQVVRAKLADSERRFAR"
     gene            complement(712239..713090)
                     /locus_tag="PPUBIRD1_RS03170"
                     /old_locus_tag="PPUBIRD1_0630"
     CDS             complement(712239..713090)
                     /locus_tag="PPUBIRD1_RS03170"
                     /old_locus_tag="PPUBIRD1_0630"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl dehydratase"
                     /protein_id="WP_041166834.1"
                     /db_xref="GI:752477558"
                     /translation="MSRQWHDLHNPAARASLYLRAASKRSISGDRLPDDGLRCFIRVQ
                     PGNLGAYRRLCHFPDDGRLPGTYPHVMAFALQLQLMTADEFPFPLLGLVHLHNRIEVL
                     RPLGAVEGLRFAVYAHNLQRHAKGGTFDLVTEAEDGIGLLWRETSRMLVRGLALEGEA
                     SEPADPEPGPLPEATRWYADSDIGRRYAKVCGDYNPIHLSAVSARLFGFPTAIAHGMW
                     TKAMALAALRGHLPHSGYAFEVDFRKPVRLPSEVVLSASEAGPSGQLRLDGHGDVLHM
                     VGRWECL"
     gene            complement(713093..714445)
                     /gene="fabG"
                     /locus_tag="PPUBIRD1_RS03175"
                     /old_locus_tag="PPUBIRD1_0631"
     CDS             complement(713093..714445)
                     /gene="fabG"
                     /locus_tag="PPUBIRD1_RS03175"
                     /old_locus_tag="PPUBIRD1_0631"
                     /EC_number="1.1.1.100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255294.1"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Catalyzes the first of the two reduction steps in the
                     elongation cycle of fatty acid synthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="WP_014589561.1"
                     /db_xref="GI:504402459"
                     /translation="MSDRYLGFANSNLGRRLVDALGLPHPAPLERWQAGRLRPVEGAL
                     VLGGGPLAKQIEAIAPRLTDEVYSFNADNLQAEAWVAGLGPKIKALVFDASHLSDSDA
                     LKQLREFFQPLLRSLAPCAHVLVLGRAPEGLDDPLASVAQRALEGFSRSLAKELRNGA
                     TAQLLYVAPGAEDQLEGALRFFLSPKSAFISGQVLRLQACTSQVEDWTRPLGGRRALV
                     TGAARGIGAAIAETLARDGADVLLLDVPQASQDLDALAARLGGKALPLDICASDAATQ
                     LLAALPDGIDIVVHNAGITRDKTLANMTPEYWDAVLAVNLKAPQVLTQALYDNGALGE
                     SARITLLASVSGIAGNRGQANYAASKAGLIGLAQAWAPRLAERGGSINAIAPGFIETH
                     MTAAMPMGLREAGRRLSSLGQGGRPQDVAEAIAWLSQPGSGSVNGQVLRVCGQALMGA
                     "
     gene            714563..715840
                     /locus_tag="PPUBIRD1_RS03180"
                     /old_locus_tag="PPUBIRD1_0632"
     CDS             714563..715840
                     /locus_tag="PPUBIRD1_RS03180"
                     /old_locus_tag="PPUBIRD1_0632"
                     /EC_number="2.3.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019470370.1"
                     /note="Catalyzes the synthesis of acetoacetyl coenzyme A
                     from two molecules of acetyl coenzyme A. It can also act
                     as a thiolase, catalyzing the reverse reaction and
                     generating two-carbon units from the four-carbon product
                     of fatty acid oxidation; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_014589562.1"
                     /db_xref="GI:504402460"
                     /translation="MRSTRRVAILGGNRIPFARSNGAYATASNQAMLTAALEGLIERY
                     RLHGLRLGEVVAGAVLKHSRDMNLTRECVLGSRLSPQTPAYDIQQACGTGLEAALLVA
                     NKIALGQIDCGIAGGVDSTSDAPIAVNEGLRHILLQANRGKSLGERFKPFLKLRPHHL
                     KPELPRNSEPRTGLSMGEHCERMAHTWRVARAEQDELAVLSHQKLAAAYAEGWQDDLL
                     TPFLSLIRDNNLRPDLSLEQLARLKPAFDRSGQGTLTAGNSTPLTDGASLVLLSSEAW
                     AQQQGLQVLAYLVDGETAAVDFVTGREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHE
                     AFAAQVLCTLKAWEDADYCRERLGLEAPLGAIDRSKLNVKGSSLAAGHPFAATGGRIL
                     ASLAKLLATAGKGRGLISICAAGGQGVTVIVER"
     gene            715930..716709
                     /locus_tag="PPUBIRD1_RS03185"
                     /old_locus_tag="PPUBIRD1_0633"
     CDS             715930..716709
                     /locus_tag="PPUBIRD1_RS03185"
                     /old_locus_tag="PPUBIRD1_0633"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="WP_014589563.1"
                     /db_xref="GI:504402461"
                     /translation="MPMIGHPRAIPALEHLPRPLYARAESLGAGSWTTRHQHDWVQFS
                     YAISGVLGVYTRDGSYFAPPQWGVWVPADAEHEVITSMQAEMRSLYVRRDACPWAPEQ
                     CRVLEVTPLARELIKQFCLFPADYPEGDSAEARLVAVLLDQLRTLPEVGFSLPLPRHP
                     GLLALCNGLIAAPDKPQTLQQWARELGCSEKTLMRLFQRETGLSFRNWRQRMRLLSSL
                     ALLEAGENVTEAALGCGYDSTSAYIAAFKQLFGATPGELKL"
     gene            complement(716802..718745)
                     /locus_tag="PPUBIRD1_RS03190"
                     /old_locus_tag="PPUBIRD1_0634"
     CDS             complement(716802..718745)
                     /locus_tag="PPUBIRD1_RS03190"
                     /old_locus_tag="PPUBIRD1_0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019099767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_014589564.1"
                     /db_xref="GI:504402462"
                     /translation="MSIKQKLTWAFAVIAGLPIVLVATLVVINLRGEARDGFLDSSSR
                     EIRQVSNAMNIFFQGINQNVEYMASQPMVAATGSELNKYMSATPSYELGEQASKILDF
                     MTRLANSHPAYAYLSYGVNDGGYTGWPAGQKFVNYDPRTRPWYQLAMANPGKTLRTGA
                     YYWAADDAVLVSTVRTVANQLGNPGGVVNIDVSLKGLTEIVKQIKLGESGYLMLVESN
                     GNVMVDPRDAAHNFKQLGSFGDGYAKLAKAGKGLVEVELNGVHYMANVYPDQQLGWTF
                     IGLIEQSEVMQTTTRLTWLIGIVAVVLAALFAVVGATFAKLIVRPINSVTNGLEDIAQ
                     GEGDLTRNLEIRGRDETAQLASWFNQFLGAIRSLIQHIGTAASKILSTSSSSTRVSSD
                     MAEAAGRQREAVDMVSTAFHEMVATANEVARSCSQAAQSADSGQQQAREGQQQIDAAV
                     HSVDRLSHEIEQSAQSIQQLERDSNAIQSILGTIRSIAEQTNLLALNAAIEAARAGEQ
                     GRGFAVVADEVRALAKRTADSTAEIDGLLGNLASRTAEVAEQMHASLEVSQQSVSRIG
                     LARDSFGQIRESVDVIRDMNTQIATAAEEQHQVAEDINRHISQIHGDAQLVAELAQAA
                     RQDSESLAGLSNELDTLVRRFRT"
     gene            complement(718913..719323)
                     /locus_tag="PPUBIRD1_RS03195"
                     /old_locus_tag="PPUBIRD1_0635"
     CDS             complement(718913..719323)
                     /locus_tag="PPUBIRD1_RS03195"
                     /old_locus_tag="PPUBIRD1_0635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014589565.1"
                     /db_xref="GI:504402463"
                     /translation="MNIGQAARRSGLSTKMIRYYESIGLLKPATRSDSGYRLYQAQDL
                     HNLAFIKRSRDLGFSLEEVGKLLTLWQDRQRASADVKALAMHHIDELNRRIEELVSLR
                     DTLGELVSHCQGDDRPDCPILKDLANGAGGSCCH"
     gene            complement(719320..721719)
                     /locus_tag="PPUBIRD1_RS03200"
                     /old_locus_tag="PPUBIRD1_0636"
     CDS             complement(719320..721719)
                     /locus_tag="PPUBIRD1_RS03200"
                     /old_locus_tag="PPUBIRD1_0636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal translocating P-type ATPase"
                     /protein_id="WP_014589566.1"
                     /db_xref="GI:504402464"
                     /translation="MPASTTYNLPISGMTCASCAGRVERALRKVTGAEQVSVNLTTEK
                     ARVLAPPASLPALVEAVREAGYGVPTRTLELQIGGMTCASCVGRVERALGKLAGVERV
                     SVNLASERAHLEVLAALDENLLIDAVQKAGYSASLPQSTKDDQSTVQRRLRNERLAVG
                     AALLLALPLVLPMLVQPFGLHWMLPAWAQFLLATPVQFILGARFYIAAWKAVRAGAGN
                     MDLLVALGTSAGYGLSLYQWAQAPAGMAPHLYFEASAVVIALVLLGKYLESRAKRQTA
                     SAIRALEALRPERALRVVDGVEEDVAIAQLRLGDLVLVKPGERFPVDGVVEDGSSHAD
                     EALISGESLPVPKQPGDSVTGGAINGEGRLLVRTQALGTETVLARIIRLVEDAQAAKA
                     PIQKLVDRVSQVFVPAVLLLALITLIGWWLAGVPLETALINAVAVLVIACPCALGLAT
                     PAAIMAGTGVAARHGILIKDAEALERAHAVNRVVFDKTGTLTSGSPRVVHSQALDGNS
                     ANLHRLAGALQRGSEHPLAKAVLVACAEQGLDVPSVADSQSLTGRGIAGRVEGRELAL
                     GNRRLLDESGLQPGELAAQAQAWEAEGRTLSWLIERSAQPRVVGLFAFGDSLKPGAAQ
                     AIETLHAQHISSHLLTGDNRGSAKVVAEALGIDDVHAEVLPADKAATVAALKQDGVVA
                     MVGDGINDAPALAAADIGIAMGGGTDVAMQAAGITLMRGDPRLVPAALEISRKTYAKI
                     RQNLFWAFIYNLIGIPLAALGYLNPVLAGAAMALSSVSVVSNALWLKTWKPTSSTQEA
                     P"
     gene            complement(721772..722158)
                     /locus_tag="PPUBIRD1_RS03205"
                     /old_locus_tag="PPUBIRD1_0637"
     CDS             complement(721772..722158)
                     /locus_tag="PPUBIRD1_RS03205"
                     /old_locus_tag="PPUBIRD1_0637"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019438053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589567.1"
                     /db_xref="GI:504402465"
                     /translation="MFRAALGVVGLLGALAVVPPAFAEGNSAYSVLIISRERLEVATS
                     CEIGVYLNDQLAGRVFQEQSTSFNLPPGPVDVRLRLLPGQMPGCAAGIEDQRSTRLNL
                     QAGQINKYRIAMGQYGLELKRADLGY"
     gene            722304..722501
                     /locus_tag="PPUBIRD1_RS03210"
                     /old_locus_tag="PPUBIRD1_0638"
     CDS             722304..722501
                     /locus_tag="PPUBIRD1_RS03210"
                     /old_locus_tag="PPUBIRD1_0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal transport/detoxification protein"
                     /protein_id="WP_014589568.1"
                     /db_xref="GI:504402466"
                     /translation="MQVFNVQGMTCGHCVKAVTRAVQEQDAAARVEVDLAGKQVRVQS
                     ELAQEQILTAIRDEGYQAELA"
     gene            722609..723790
                     /locus_tag="PPUBIRD1_RS03215"
                     /old_locus_tag="PPUBIRD1_0639"
     CDS             722609..723790
                     /locus_tag="PPUBIRD1_RS03215"
                     /old_locus_tag="PPUBIRD1_0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Bcr/CflA family drug resistance efflux
                     transporter"
                     /protein_id="WP_003255285.1"
                     /db_xref="GI:489348173"
                     /translation="MNLRMVLILGALSAFGPLAIDFYLPAFPAMAQAFATDEKHVQAT
                     LAAYFLGLSIGQLAYGPVADRFGRRKPLMFGVTLFTLASLACAYAPNLDTLVVARFIQ
                     ALGGCAGMVLSRAIVSDKCDPVASAKVFSQLMLVMGLAPILAPMLGGVLVNLAGWQSI
                     FLALSLFSAGCLLAVSLGLPESLPEHIPRQPLSGALRQYLRLLADRVFLGHALTGGIA
                     IAGMFAYIAGSPFVFIKLYGVPAEHYGWLFGTNAAGFILVAQVNARLLAKRGPAFLLG
                     RAVWLYLVAGLVLLGVAALRPAQLWPLLVPLFICIASLGCIIPNASACAMSGQGARAG
                     SASALMGCVQFSVAAGAAALVGLLHDGSAVPMAIVISLCGALVVSVALLTRRLQAKAP
                     A"
     gene            724428..725141
                     /locus_tag="PPUBIRD1_RS03220"
                     /old_locus_tag="PPUBIRD1_0640"
     CDS             724428..725141
                     /locus_tag="PPUBIRD1_RS03220"
                     /old_locus_tag="PPUBIRD1_0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="WP_019438054.1"
                     /db_xref="GI:518267846"
                     /translation="MNAASSISQIASLMADPKRSAMLWALIDGTPRLANELAIMTGLT
                     SSSACAHLSLLSSAGLLRHEARGRKRYFCLATPQVGAAVEALASVQLESARGERAEAP
                     VSSLPLSMRRARRCGDHLGGELASELYHRMVVAGWLEGSGRHLRVSDEGRAQLALVGV
                     YIDALAPHQQRGCVICRCTEWNDQGPHLGGVLGQALFRLFLQSGWMRELEDSRALHIS
                     ALGIQQINRIARVATLQVG"
     gene            complement(725162..726109)
                     /locus_tag="PPUBIRD1_RS03225"
                     /old_locus_tag="PPUBIRD1_0641"
     CDS             complement(725162..726109)
                     /locus_tag="PPUBIRD1_RS03225"
                     /old_locus_tag="PPUBIRD1_0641"
                     /EC_number="3.5.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B0KLE3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine deaminase"
                     /protein_id="WP_014589570.1"
                     /db_xref="GI:504402468"
                     /translation="MYDWLNALPKAELHLHLEGSLEPELLFSLAERNKIALPWADVET
                     LRGAYAFNNLQEFLDLYYQGADVLRTEQDFYDLTWAYLQRCKAQNVIHTEPFFDPQTH
                     TDRGIAFEVVLNGISQALKDGREQLGISSGLILSFLRHLSEDEAHKTLDQALPFRDAF
                     IAVGLDSSEMGHPPSKFQRVFDRARSEGFVAVAHAGEEGPPEYIWEALDLLKIKRIDH
                     GVRAIEDERLMQRIIDEQIPLTVCPLSNTKLCVFDHMSQHNILDMLERGVKVTVNSDD
                     PAYFGGYVTENFHALHTHLGMTEDQARRLAQNSLDARLV"
     gene            complement(726196..726882)
                     /locus_tag="PPUBIRD1_RS03230"
                     /old_locus_tag="PPUBIRD1_0642"
     CDS             complement(726196..726882)
                     /locus_tag="PPUBIRD1_RS03230"
                     /old_locus_tag="PPUBIRD1_0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_014589571.1"
                     /db_xref="GI:504402469"
                     /translation="MANSRTALIIGASRGLGLGLVQRLHEDGWHITATVRNPQQPGDL
                     ANVPGVRIEQLEMNDTVQLDSLQQRLQGQVFDLIFVNAGVMGPLPQDLEAVHNSDIGD
                     LFMTNAVAPIRVARRLVGQIREGSGVLAFMSSILGSVTIPDGGEVCLYKASKAALNSM
                     INSFFVEQQRPDLCVLAMHPGWVKTDMGGENADIDVLTSTRGMIEQIKAQSGKGGLRF
                     INYKGDPLVW"
     gene            complement(727250..727834)
                     /locus_tag="PPUBIRD1_RS03235"
                     /old_locus_tag="PPUBIRD1_0643"
     CDS             complement(727250..727834)
                     /locus_tag="PPUBIRD1_RS03235"
                     /old_locus_tag="PPUBIRD1_0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thymidylate synthase"
                     /protein_id="WP_014589572.1"
                     /db_xref="GI:504402470"
                     /translation="MPSTLLDLCEYREEIRKSRFITLAGPISSAAEAMSFIERHSDMA
                     ATHNCWAWKLGAQYRSSDDGEPGGTAGRPILAAIEAQDCDQVVVLVIRWYGGIQLGTG
                     GLARAYGGGANKCLQQAPKRLLVQRSHFSCSCSFSELALVKLRLAEVDGLVLDEQFTA
                     NGVDLVIALGDAHLAPLQQQLADLSRGRILLEAH"
     gene            complement(727844..728506)
                     /locus_tag="PPUBIRD1_RS03240"
                     /old_locus_tag="PPUBIRD1_0644"
     CDS             complement(727844..728506)
                     /locus_tag="PPUBIRD1_RS03240"
                     /old_locus_tag="PPUBIRD1_0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003257076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_003255279.1"
                     /db_xref="GI:489348167"
                     /translation="MTLEVPAHRLSASGKPAGRIRQKNEQAIIQAAEDEFARHGFKGT
                     SMNTIALKAGLPKANLHYYFTNKLGLYIAVLSNIIELWDSTFNALSVDDDPGEALSQY
                     IRTKMEFSRRNPQASRIFAMEVISGGTCLTEYFSADYREWFRGRAAVFQAWIEAGKMD
                     PVDPVHLIFLLWGSTQHYADFATQICQVTGRSRLTKQDMEDASNNLIHIILKGCGIKP
                     AA"
     gene            complement(728597..729514)
                     /locus_tag="PPUBIRD1_RS03245"
                     /old_locus_tag="PPUBIRD1_0645"
     CDS             complement(728597..729514)
                     /locus_tag="PPUBIRD1_RS03245"
                     /old_locus_tag="PPUBIRD1_0645"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016497891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589573.1"
                     /db_xref="GI:504402471"
                     /translation="MSRRPDPLAQVSDFDIRLLKIYRSVVECGGFSAAENVLGIGRSA
                     ISQQMNDLEQRLGLRLCQRGRAGFSLTEEGREVYHSALQLLSALESFRTEVNGLHQHL
                     RGELNIGLTDNLVTLPHMRITHALAELKDRGPDVRIQIRMIAPSQVEHGVLDGSLHVG
                     VVPQTSPLSGLEYQPLYSERSLLYCAVGHPLFYADDQQIDDQRLNSQEAITPTFRLPT
                     DIQAHYQALNCTASASDREGMAFLILTGRYIGYLPDHYAMFWVQQGRLRALKPKERFY
                     DLSLSWVTRKGRRPNLVLESFLESLAATR"
     gene            729633..730979
                     /locus_tag="PPUBIRD1_RS03250"
                     /old_locus_tag="PPUBIRD1_0646"
     CDS             729633..730979
                     /locus_tag="PPUBIRD1_RS03250"
                     /old_locus_tag="PPUBIRD1_0646"
                     /EC_number="2.6.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004576992.1"
                     /note="catalyze the conversion of beta amino acids to the
                     corresponding beta keto acid with pyruvate as the amine
                     acceptor; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="omega amino acid--pyruvate aminotransferase"
                     /protein_id="WP_014589574.1"
                     /db_xref="GI:504402472"
                     /translation="MNMPETAPAGIASQLKLDAHWMPYTANRNFQRDPRLIVAAEGNY
                     LVDDHGRKIFDALSGLWTCGAGHTRKEIADAVTRQLSTLDYSPAFQFGHPLSFQLAEK
                     IAELVPGNLNHVFYTNSGSECADTALKMVRAYWRLKGQATKTKIIGRARGYHGVNIAG
                     TSLGGVNGNRKMFGQLLDVDHLPHTVLPVNAFSKGMPEEGGIALADEMLKLIELHDAS
                     NIAAVIVEPLAGSAGVLPPPKGYLKRLREICTQHNILLIFDEVITGFGRMGAMTGSEA
                     FGVTPDLMCIAKQVTNGAIPMGAVIASSEIYQTFMNQPTPEYAVEFPHGYTYSAHPVA
                     CAAGLAALDLLQKENLVQSAAELAPHFEKLLHGVKGTKNIVDIRNYGLAGAIQIAARD
                     GDAIVRPYEAAMKLWKAGFYVRFGGDTLQFGPTFNTKPQELDRLFDAVGETLNLID"
     gene            731049..732542
                     /locus_tag="PPUBIRD1_RS03255"
                     /old_locus_tag="PPUBIRD1_0647"
     CDS             731049..732542
                     /locus_tag="PPUBIRD1_RS03255"
                     /old_locus_tag="PPUBIRD1_0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003255276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylmalonate-semialdehyde dehydrogenase"
                     /protein_id="WP_003255276.1"
                     /db_xref="GI:489348164"
                     /translation="MSIVQHLIHGELVTKGERTADVFNPSTGQAVRKVELASRATVQE
                     AIDSAKAAFPAWRNTPPAKRAQVMFRFKQLLEQNEAKISQMISEEHGKTLEDAAGELK
                     RGIENVEFACAAPEVLKGEYSRNVGPNIDAWSDFQPLGVVAGITPFNFPAMVPLWMYP
                     LAIACGNAFILKPSERDPSSTLYIAQLLLEAGLPKGILNVVHGDKEAVDALIEAPEVK
                     ALSFVGSTPIAEYIYAEGTKRGKRVQALGGAKNHAVLMPDADLDNAVSALMGAAYGSC
                     GERCMAISVAVCVGDQVADALIAKLEPQIKALKIGAGTSCGLDMGPLVTAAARDKVVG
                     YIDDGVAAGAKLVVDGRGFRVAGNEDGYFVGGTLFDKVTPEMRIYKEEIFGPVLCVVR
                     VNSLEQAMQLINDHEYGNGTCIFTRDGEAARLFCDEIEVGMVGVNVPLPVPVAYHSFG
                     GWKRSLFGDLHAYGPDGVRFYTRRKAITQRWPQRASHEASQFAFPSL"
     gene            733289..734835
                     /locus_tag="PPUBIRD1_RS03260"
                     /old_locus_tag="PPUBIRD1_r0011"
     rRNA            733289..734835
                     /locus_tag="PPUBIRD1_RS03260"
                     /old_locus_tag="PPUBIRD1_r0011"
                     /product="16S ribosomal RNA"
     gene            734911..734987
                     /locus_tag="PPUBIRD1_RS03265"
                     /old_locus_tag="PPUBIRD1_t0005"
     tRNA            734911..734987
                     /locus_tag="PPUBIRD1_RS03265"
                     /old_locus_tag="PPUBIRD1_t0005"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:734945..734947,aa:Ile,seq:gat)
     gene            735012..735087
                     /locus_tag="PPUBIRD1_RS03270"
                     /old_locus_tag="PPUBIRD1_t0006"
     tRNA            735012..735087
                     /locus_tag="PPUBIRD1_RS03270"
                     /old_locus_tag="PPUBIRD1_t0006"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:735045..735047,aa:Ala,seq:tgc)
     gene            735324..738237
                     /locus_tag="PPUBIRD1_RS03275"
                     /old_locus_tag="PPUBIRD1_r0012"
     rRNA            735324..738237
                     /locus_tag="PPUBIRD1_RS03275"
                     /old_locus_tag="PPUBIRD1_r0012"
                     /product="23S ribosomal RNA"
     gene            738366..738481
                     /locus_tag="PPUBIRD1_RS03280"
                     /old_locus_tag="PPUBIRD1_r0013"
     rRNA            738366..738481
                     /locus_tag="PPUBIRD1_RS03280"
                     /old_locus_tag="PPUBIRD1_r0013"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            738739..739398
                     /locus_tag="PPUBIRD1_RS03285"
                     /old_locus_tag="PPUBIRD1_0648"
     CDS             738739..739398
                     /locus_tag="PPUBIRD1_RS03285"
                     /old_locus_tag="PPUBIRD1_0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009682077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="WP_014589575.1"
                     /db_xref="GI:504402473"
                     /translation="MSNSVEPETLAQLPLDELVACHECDLLLRKPVLQHDEKAQCPRC
                     GYELYAHRHNVVNRSLALVLTALLLFVPANFLPIMQLHLLGQTSDDTVWSGVLGLYNS
                     GMRGVAVVVLLCSMVIPLAKLLCQLAVLLSIRLNFGRDYGLIFYRIYHHLRDWGMLEV
                     YFMGVLVAIVKLVDLAELTVGLGLFCFISLLLIQVWLEVVMSPHQIWSALSGEDLHAG
                     D"
     gene            739385..740008
                     /locus_tag="PPUBIRD1_RS03290"
                     /old_locus_tag="PPUBIRD1_0649"
     CDS             739385..740008
                     /locus_tag="PPUBIRD1_RS03290"
                     /old_locus_tag="PPUBIRD1_0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016392923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="paraquat-inducible protein A"
                     /protein_id="WP_014589576.1"
                     /db_xref="GI:504402474"
                     /translation="MRAIDAGIVVCNECHELNRQEPDSTSQTCTRCGAIVHARRPNSI
                     VRTWALLIAASILYIPANILPIMTVSTLGQGSPDTIMSGVITLLKHGMVPIAAVVFIA
                     SILVPTFKLVGIGLLLYSVQRRQPLSARQRILMYRFIEFIGRWSMLDIFVIAILVAVV
                     NFGRIASVEANLGAVAFATVVILTMLAALTFDPRLIWDNTESDDDHE"
     gene            740001..742301
                     /locus_tag="PPUBIRD1_RS03295"
                     /old_locus_tag="PPUBIRD1_0650"
     CDS             740001..742301
                     /locus_tag="PPUBIRD1_RS03295"
                     /old_locus_tag="PPUBIRD1_0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mammalian cell entry protein"
                     /protein_id="WP_014589577.1"
                     /db_xref="GI:504402475"
                     /translation="MSDLPTAKTRPASNWSAIWILPLIALMIGGWLAWQAYRDAGVEI
                     EVRFESGEGIVANKTEVIYKGMPVGKVKSLVLDAKGDTQGVIATIEMNKAAEPHLTKG
                     TRFWLVKPSVSLAGISGLETLVSGNYIAVSPGEGERTKRFVALKVAPPLSDSEPGLHL
                     TLKADRLGSLNRDSPVFYKQIQVGRVKSYRLSEDQSTVEVKVFIEPAYASLVRKHTRF
                     WNASGVSIDASLSGVKVRSESLSSIVAGGIAFATPEYRKDSPPTDPSLPFRLYEDFDA
                     AQAGIRVKVKLSDYEGLQAGRTPVMYKGIQVGSLKALKMEDNLASASAELTLDPLTED
                     YLVDGTQFWVVKPSISLAGITGLEALVKGNYIAIRPGEKGARPEREFEARAKAPPLDL
                     KAPGLHMVLFADTLGSLEIGSPVTYRQVKVGSVQSYQFARNSNRILIGVHIEKEYEKL
                     VNGSSRFWNVSGITLTGGLSGIKIKSESLQTLMAGGIAFDTPRPDVPLKRHIPRFRLH
                     DSQEAVNRAGTLITIRVERADGLKPGTAIRFRGLDVGSIESVDLTDDLQAVLLRARIT
                     EAADRIARAGTQFWVVKPALGLVRTENLDTLIGGQYLEVQPAAKNRGPQRDFIALAEA
                     PEVAGPEVGLPLTLSAPRRGSIKPGVPVTYREVTVGKVTGFELGQSADRVLIHILIEP
                     RYAALVRSGSRFWNSSGFGFDWGLFKGATVRTESVETLIDGGIAFATPDGEQMGNPAR
                     PQQTFALFEKAEDEWLQWAPKIQIAK"
     gene            complement(742536..742814)
                     /locus_tag="PPUBIRD1_RS03300"
                     /old_locus_tag="PPUBIRD1_0651"
     CDS             complement(742536..742814)
                     /locus_tag="PPUBIRD1_RS03300"
                     /old_locus_tag="PPUBIRD1_0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019099330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_003247625.1"
                     /db_xref="GI:489340446"
                     /translation="MANTPSAKKRAKQAEKRRSHNASLRSMVRTYIKNVVKAIDAKDA
                     EKAQAAYVLAVPVIDRMADKGIIHKNKAARHKGRLNGHIKALKEAAAA"
     gene            743065..744603
                     /locus_tag="PPUBIRD1_RS03305"
                     /old_locus_tag="PPUBIRD1_0652"
     CDS             743065..744603
                     /locus_tag="PPUBIRD1_RS03305"
                     /old_locus_tag="PPUBIRD1_0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589578.1"
                     /db_xref="GI:504402476"
                     /translation="MNLLKSLAAVSSITMISRVLGFVRDTILARIFGAGVATDAFFIA
                     FKLPNLLRRIFAEGAFSQAFVPILAEYKTQQGEEATRTFIAYVSGLLTLVLALVTAIG
                     ILAAPWVVWATAPGFVDSTEKYELTTDLLRVTFPYIFLISLSSLAGAILNTWNRFSVP
                     AFTPTLLNVAMIAFAVLLTPYFNPPIMALAWGVLAGGLAQLLYQLPALKKIGMLVLPR
                     LNLKDVGVWRVLKQMLPAILGVSVSQISLIINTIFASFLVAGSVSWMYYADRLMELPS
                     GVLGVALGTILLPTLAKTYANKDREEYSRILDWGLRLCFLLVLPCTLALAILAEPLTV
                     ALFQYGKFSAFDAAMTQRALIAYSVGLLAIILIKVLAPGFYAQQNIRTPVKIAVFTLV
                     CTQLFNLALVGPLAHAGLALAISLGACLNAGLLFWKLRSQQLFEPQPGWAVFLLKLVL
                     AVALMSAVLLAGMHYMPAWEQGIMLERFLRLGALILAGVVTYFGCLYLCGFRPRHFAR
                     KALH"
     gene            744722..745672
                     /locus_tag="PPUBIRD1_RS03310"
                     /old_locus_tag="PPUBIRD1_0653"
     CDS             744722..745672
                     /locus_tag="PPUBIRD1_RS03310"
                     /old_locus_tag="PPUBIRD1_0653"
                     /EC_number="2.7.7.2"
                     /EC_number="2.7.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD synthetase"
                     /protein_id="WP_014589579.1"
                     /db_xref="GI:504402477"
                     /translation="MQLVRGLHNLRPEHRGCVATIGNFDGVHRGHQAILARLRERGQA
                     LGLPTCVVIFEPQPREYFAPDTAPARLARLRDKIELLATEGIDRVLCLAFNHRLSKLS
                     ADAFVKAILVDGLGVRHLEVGDDFRFGCDRAGDFAFLVEAGNAYGFTVEAANTVIQDG
                     LRVSSTEVRKALSEGDFELAEHLLGRPYRITGRVLHGQKLARQLGTPTANIQLKRRRV
                     PLSGVYLASIVIDGKAWPGVGNIGVRPTVAGDGRPHLEIHLLDFAGDLYGRRLTVEFH
                     HKLREEQRFASLEALKSAIDADIAAARAHWHAQPLTKSLK"
     gene            745669..748500
                     /locus_tag="PPUBIRD1_RS03315"
                     /old_locus_tag="PPUBIRD1_0654"
     CDS             745669..748500
                     /locus_tag="PPUBIRD1_RS03315"
                     /old_locus_tag="PPUBIRD1_0654"
                     /EC_number="6.1.1.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017148081.1"
                     /note="Isoleucyl-tRNA synthetase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isoleucine--tRNA ligase"
                     /protein_id="WP_014589580.1"
                     /db_xref="GI:504402478"
                     /translation="MTDYKATLNLPDTAFPMKAGLPQREPQILQRWDSIGLYQKLREI
                     GKDRPKFVLHDGPPYANGKIHIGHALNKILKDMIVRSKTLAGFDAPYVPGWDCHGLPI
                     EHKVEVTHGKHLSADRTRELCREYAAEQIEGQKTEFIRLGVLGDWDNPYKTMNFANEA
                     GEIRALAEMVKQGFVFKGLKPVNWCFDCGSALAEAEVEYADKKSQTIDVAFPVADEAK
                     LAAAFGLASLAKPAAIVIWTTTPWTIPANQALNIHPEFKYALVDTGERLLVLAEELVE
                     SCLKRYNLEGSVVATAQGSALELINFRHPFYDRLSPIYLADYVELGAGTGVVHSSPAY
                     GEDDFVTCKRYGMVNDDILTPVQSNGVYVESLPFFGGQFIWKANPAIVEKLSEVGALM
                     HTETISHSYMHCWRHKTPLIYRATAQWFVGMDKQPSTGEPLRERALKAIEDTKFVPAW
                     GQARLHAMIANRPDWCISRQRNWGVPIPFFLHKQTGELHPRTVELMEEVAKRVEQQGI
                     EAWFKLDAAELLGAEADQYDKIADTLDVWFDSGTTHWHVLRGSHDIGHATGPRADLYL
                     EGSDQHRGWFHSSLLTGCAIDNHAPYRELLTHGFTVDENGRKMSKSLGNTIEPEKVNN
                     TLGADILRLWVSATDYSGEMAVSEQILQRSADAYRRIRNTARFLLSNLSGFDPARDLL
                     APEDMLALDRWAVDRTLLLQRELEEHYSEYRFWNVYSKVHNFCVQELGGFYLDIIKDR
                     QYTTGANSVARRSCQTALYHISEALVRWIAPILAFTADEIWQYLPGERNESVMLNGWY
                     QGLSELPEGTELDRAYWDRVMAVKASVNKELENQRTAKVIGGNLQAEVTLYADEGLSA
                     DLGKLGDELRFVLITSAASVVPFAQAPAEAVATEVEGLKLQVVKSGHTKCGRCWHFRA
                     DVGSHPEHPEICGRCVDNLTGSGEVRHYA"
     gene            748493..749008
                     /locus_tag="PPUBIRD1_RS03320"
                     /old_locus_tag="PPUBIRD1_0655"
     CDS             748493..749008
                     /locus_tag="PPUBIRD1_RS03320"
                     /old_locus_tag="PPUBIRD1_0655"
                     /EC_number="3.4.23.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951870.1"
                     /note="Lipoprotein signal peptidase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="WP_014589581.1"
                     /db_xref="GI:504402479"
                     /translation="MPNPAAGRFGRLAWLWLSLLVLVVDQATKLYFNNALTMYQQIVV
                     IPDYFSWTLAYNTGAAFSFLADGAGWQRWLFALIAVVVSAVLVVWLKRLGRNETWLAV
                     ALALVLGGAIGNLYDRIVLGHVVDFILVHWQNRHYFPAFNVADSAITVGAVMLALDMF
                     KSKKSEDPVHD"
     gene            749001..749438
                     /locus_tag="PPUBIRD1_RS03325"
                     /old_locus_tag="PPUBIRD1_0656"
     CDS             749001..749438
                     /locus_tag="PPUBIRD1_RS03325"
                     /old_locus_tag="PPUBIRD1_0656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270371.1"
                     /note="rotamase; accelerates isomerization of the peptidyl
                     prolyl bond, involved in the folding of proteases; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_003247607.1"
                     /db_xref="GI:489340427"
                     /translation="MTDTRIGQNTEVTLHFALHLENGDTVDSTFDKAPATFKVGDGNL
                     LPGFENALFGFKAGDKRTVVVAPENAFGQPNPQNVQVMPRSNFEGMELSEGLLIIFND
                     AANTELPGVVKAFDDDQVTIDFNHPLAGKTLTFEVEILEVKAL"
     gene            749453..750400
                     /gene="ispH"
                     /locus_tag="PPUBIRD1_RS03330"
                     /old_locus_tag="PPUBIRD1_0657"
                     /gene_synonym="lytB"
     CDS             749453..750400
                     /gene="ispH"
                     /locus_tag="PPUBIRD1_RS03330"
                     /old_locus_tag="PPUBIRD1_0657"
                     /gene_synonym="lytB"
                     /EC_number="1.17.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003247605.1"
                     /note="catalyzes the conversion of
                     1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate into
                     isopentenyl diphosphate (IPP) and dimethylallyl
                     diphosphate (DMAPP); functions in the nonmevalonate
                     isoprenoid biosynthesis pathway; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-enyl diphosphate
                     reductase"
                     /protein_id="WP_004577287.1"
                     /db_xref="GI:490714594"
                     /translation="MQIKLANPRGFCAGVDRAIEIVNRALEVFGPPIYVRHEVVHNKF
                     VVEDLRNRGAIFVEELDQVPDDVIVIFSAHGVSQAVRQEAAGRGLKVFDATCPLVTKV
                     HIEVAKYSRDGRECILIGHEGHPEVEGTMGQYDASNGGAIYLVEDEEDVANLQVRDPN
                     HLAFVTQTTLSMDDTSRVIDALRARFPNIGGPRKDDICYATQNRQDAVKQLAGESDVV
                     LVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDQTARIGITAGASAPEVLV
                     RGVIEQLKAWGATGAEELDGREENITFSMPKELRVRSLI"
     gene            complement(750477..750959)
                     /locus_tag="PPUBIRD1_RS03335"
                     /old_locus_tag="PPUBIRD1_0658"
     CDS             complement(750477..750959)
                     /locus_tag="PPUBIRD1_RS03335"
                     /old_locus_tag="PPUBIRD1_0658"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pili biogenesis protein FimT"
                     /protein_id="WP_019436798.1"
                     /db_xref="GI:518266590"
                     /translation="MKQRGVTLIQMLSALAVAVLLTQLGMPAYARMSDDLHRAAAARD
                     LAQALRSARSHALLQGQPVLVLALDGNWGNGWRVVLEHNRQVLREQRLPKPLKITSNR
                     GEQFKFSALGVPMTLGNSWLGATLEMCERAAARSRYQVVLASSGRVRLLTEDLSNDRC
                     "
     gene            751069..751251
                     /locus_tag="PPUBIRD1_RS03340"
                     /old_locus_tag="PPUBIRD1_0659"
     CDS             751069..751251
                     /locus_tag="PPUBIRD1_RS03340"
                     /old_locus_tag="PPUBIRD1_0659"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilV, Tfp pilus assembly protein PilV"
                     /protein_id="WP_014589583.1"
                     /db_xref="GI:504402481"
                     /translation="MHERQGGMTLLEVLLAVVVVAVGMFAAAGLQLQALQAVDSARRN
                     GQAAMAAHSEHERGRR"
     gene            751248..751892
                     /locus_tag="PPUBIRD1_RS03345"
                     /old_locus_tag="PPUBIRD1_0660"
     CDS             751248..751892
                     /locus_tag="PPUBIRD1_RS03345"
                     /old_locus_tag="PPUBIRD1_0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589584.1"
                     /db_xref="GI:504402482"
                     /translation="MRRGQRGFGLVELMLALTIGLMLLAAASQLFASAHQAWRLQSTA
                     LRMQDEARQALLRMAQDIRMAGMFGCLRLKPSDFDDPALQQVFARPLVIEASTLSLIV
                     AELPGQAGRPDWFLHTNCLTEVSVDEARKAGDPLVYPVSRYVYQLQDDKLRFKRGNSK
                     FQPLVDNVQAMRVERVQMVGGERVDISLTLYEPTLKVQQRHELSVAIRNPVPAS"
     gene            751889..752353
                     /locus_tag="PPUBIRD1_RS03350"
                     /old_locus_tag="PPUBIRD1_0661"
     CDS             751889..752353
                     /locus_tag="PPUBIRD1_RS03350"
                     /old_locus_tag="PPUBIRD1_0661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589585.1"
                     /db_xref="GI:504402483"
                     /translation="MTHQRGVVLLLALVLSVLLGLLATSALRDALVETRMTGYLSDGL
                     MALEEAEATLLAGVRELERAPPDVCNACLPPPRPHDLVGQWQGTQTGFFQLQNLGVST
                     RAAHMPEGQPVSLFRITAVSKQSRSRHVLEAVYAVAGNQTQRITWRQRLRGD"
     gene            752355..752744
                     /locus_tag="PPUBIRD1_RS03355"
                     /old_locus_tag="PPUBIRD1_0662"
     CDS             752355..752744
                     /locus_tag="PPUBIRD1_RS03355"
                     /old_locus_tag="PPUBIRD1_0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750371.1"
                     /note="type IV pili biogenesis protein PilE; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PilE"
                     /protein_id="WP_014589586.1"
                     /db_xref="GI:504402484"
                     /translation="MQQGLSLIELLIVLAVTGILAAIAYPSYSDQLQRAARSEVVGLL
                     HDAALRLERHRVRTGQYAEGDLVLPEGTRYYSLQAQRDSDTFTLRARRLPHGLMAQDG
                     CGDFQLDQAGVQHNPGAVEHSTHCWGS"
     gene            752799..753896
                     /locus_tag="PPUBIRD1_RS03360"
                     /old_locus_tag="PPUBIRD1_0663"
     CDS             752799..753896
                     /locus_tag="PPUBIRD1_RS03360"
                     /old_locus_tag="PPUBIRD1_0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003247575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-amino acid oxidase"
                     /protein_id="WP_014589587.1"
                     /db_xref="GI:504402485"
                     /translation="MSKQVVVVGGGVIGLLTAFNLAAKVGQVVVCDQGEVGRESSWAG
                     GGIVSPLYPWRYSPAVTALAHWSQDFYPQLGERLFASTGVDPEVHTTGLYWLDLDDEA
                     EALAWAVREQRPLSAVDISAAYDAVPVLGPGFKHAIYMAGVANVRNPRLVKSLKAALL
                     ALPNVTLREHCQISGFVQEKGRVTGVQTADGVLAADEVVLSAGAWSGDLLRTLGLELP
                     VEPVKGQMILFKCAEDFLPSMVLAKGRYAIPRRDGHILVGSTLEHAGYDKTPTGDALE
                     SLKASAVELLPELEGATVVAHWAGLRPGSPEGIPYIGPVPGHEGLWLNCGHYRNGLVL
                     APASCQLFTDLLTGAEPIIDPAPYAPEGRLG"
     gene            complement(754041..755450)
                     /locus_tag="PPUBIRD1_RS03365"
                     /old_locus_tag="PPUBIRD1_0664"
     CDS             complement(754041..755450)
                     /locus_tag="PPUBIRD1_RS03365"
                     /old_locus_tag="PPUBIRD1_0664"
                     /EC_number="3.5.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019436797.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_014589588.1"
                     /db_xref="GI:504402486"
                     /translation="MTQKTAIGELTAVELLELYQRRQLSPVEVVDDVLARIDLHNPAV
                     NAYCHVDGEGARAAARASEQRWQRGQPCGRLDGVPASIKDLTLTRGMPTRKGSRTTSG
                     AGPWEVDAPFSAFMREAGAVLVGKTTTPEFGWKGVTDNPLYGITRNPWDTRLTAGGSS
                     GGAAAAAALNLGVLHQGSDAGGSIRIPCAFTGTFGIKPTFGYVPQWPASAMTVLSHLG
                     PMTRTVDDSVLMLDCVARPDARDGLAGAPRQAPWLSQQQDLSGLRIAYSANFGYVQVA
                     PQIQALVAQAVQRLARLGAQVEEVDPGFSDPLETFNTLWFAGAARLASALSDEQRALL
                     DPGLRWIAEQGAQISLGEYTQALEARAELIAKMNAFHQRYDVLISPMLPLVAFEAGHN
                     VPPGSGMAQWMEWTPFSYPFNLTQQPAASVPCGFTREGLPVGLQVVAGRFADEQVLRV
                     CKVYEQHYPSRHLQAPITG"
     gene            complement(755452..756729)
                     /locus_tag="PPUBIRD1_RS03370"
                     /old_locus_tag="PPUBIRD1_0665"
     CDS             complement(755452..756729)
                     /locus_tag="PPUBIRD1_RS03370"
                     /old_locus_tag="PPUBIRD1_0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020192257.1"
                     /note="allantoate amidohydrolase and N-carbamoyl-L-amino
                     acid amidohydrolase are very similar; the allantoate
                     amidohydrolase from Escherichia coli forms a dimer and
                     binds zinc ions for catalytic activity and catalyzes the
                     conversion of allantoate to (S)-ureidoglycolate and
                     ammonia; carbamoyl amidohydrolase from Bacillus sp.
                     converts N-carbamoyl amino acids to amino acids, ammonia,
                     and carbon dioxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="WP_014589589.1"
                     /db_xref="GI:504402487"
                     /translation="MNTRIDPSQHLLGQGPLVSRERLWQSLMDLAQLGATAKGGVCRL
                     ALTDLDRQARDLFVHWCEEAGCTVSVDAIGNIFARRPGRNPALPPIMTGSHIDTQPTG
                     GKFDGCYGVMAGLEVMRTLNDLHLTTEAPLEVVVWTNEEGSRFPPCMMGSGVFAGKFG
                     LQETLDKVDDQGLSVGAELQRIGYAGPRVPTGHAVGAYFEAHIEQGPVLEDQRTTIGV
                     VQGCLGQKWFDLTLTGVEAHAGPTPMHLRKDALVGAAEVVAAVNRVAHAHQPHACGTV
                     GCLTLHPGSRNVIPGQVHMTIDLRHLDPGHLDAMVSEVCAAIENSTAKHGLSYQLTPT
                     ADFPPLYFAEQCVDAVRQGARALGLSHMDIVSGAGHDAIFLAELGPAGMIFVPCEGGI
                     SHNEIENAAPQDLADGCDVLLRAMFQAANPGAR"
     gene            complement(756882..757577)
                     /locus_tag="PPUBIRD1_RS03375"
                     /old_locus_tag="PPUBIRD1_0666"
     CDS             complement(756882..757577)
                     /locus_tag="PPUBIRD1_RS03375"
                     /old_locus_tag="PPUBIRD1_0666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016392907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012051120.1"
                     /db_xref="GI:500997693"
                     /translation="MLNVDSIHSYYDKSHVLEGVSLKVEAGELVTLLGRNGAGKTTTL
                     RSILGIVRPRQGQISFNGQQLVGREIFDIARLGIALVPEHRGIFRQLSVEENLKIAVR
                     KASRWQLEDVYSMFPRLKERRRNGGFALSGGEQQMLAIARALLNGPKLLILDEPTEGL
                     APVIVDELVKILRRIKDEGLSILLVEQNLMVCDALADRHYVLEQGRVAYQGSAAQFRE
                     DPSIKNRYLALSA"
     gene            complement(757577..758329)
                     /locus_tag="PPUBIRD1_RS03380"
                     /old_locus_tag="PPUBIRD1_0667"
     CDS             complement(757577..758329)
                     /locus_tag="PPUBIRD1_RS03380"
                     /old_locus_tag="PPUBIRD1_0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_014589590.1"
                     /db_xref="GI:504402488"
                     /translation="MSDYLLETRQLELAYGPFKAVAGVDLKVRAGTIHTIIGPNGAGK
                     TSLFHCLTGERQATAGKILFNGQDIIRKPSHGRVALGMARSFQLTSLFQNLSVRENLR
                     LAAQGRDGLGALNFWRSVEHKRSHWNTADQVLERLKLSARADTLAGELSHGQQRVLEV
                     GMSICAKPTLLMLDEPTSGMGIDDIPVMTDLISDLGRDHTVLLIEHNMSIVMSISQRI
                     TVMSHGQILVEGTPEQVRNDERVRTAYLGEAA"
     gene            complement(758329..759348)
                     /locus_tag="PPUBIRD1_RS03385"
                     /old_locus_tag="PPUBIRD1_0668"
     CDS             complement(758329..759348)
                     /locus_tag="PPUBIRD1_RS03385"
                     /old_locus_tag="PPUBIRD1_0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012270381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_014589591.1"
                     /db_xref="GI:504402489"
                     /translation="MSEKNPLPVAKGRAPALLSLVVASLVALPLLLPSATLATEILIF
                     AMAALACNLLLGYTGLLSFGQGIFFGVGAYGAALLMIHLQWGMFAALLGAAVFGALLA
                     LLVGALAIRRTGIYFVMLTLAFSQMAYFLAYTLSDWTGGDNGLLDVPRPNIEIAGHVL
                     VDLADPRHFYVFVAVLFLLIFAAALRVIRSPFGSTLLAIRENETRAAAIGYDTRHFKI
                     LVFMLSGAITGIAGALYAMLLHFAPLSNIDLMMSENILIMTIVGGTGSLFGSLLGAGA
                     IVLLGDVLSELWPRWLMLLGVILILVVVFMRGGLWGGLTELGKRLLATRNADDKPQAK
                     TKETL"
     gene            complement(759350..760210)
                     /locus_tag="PPUBIRD1_RS03390"
                     /old_locus_tag="PPUBIRD1_0669"
     CDS             complement(759350..760210)
                     /locus_tag="PPUBIRD1_RS03390"
                     /old_locus_tag="PPUBIRD1_0669"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016713397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_003247565.1"
                     /db_xref="GI:489340385"
                     /translation="MLDLYLFQLLNGLGLGMIYFLIAVGLTIIFGLLNFVNFAHGAFF
                     LLGAYLCYTAVAVTGNFWLALLIAPLVVAALAWAVERLLIKRIYHLPHTFQILVTLGI
                     ALIIQEASVLIWGPVGKNIAVPPELRGVLILGDFIYPYYRLFLIGFAALIGIGLWLLL
                     ERTRFGALVRAGSESTETVSLLGTNIFRLFSLTFALGVGLAGVAGVLFAPLRGAQPFV
                     GPEILGIAFVVVVIGGMGSFGGALVGGLLVGVVQSMMTSLWPQGASLMIYGAMAAVIL
                     VRPYGLFGRA"
     gene            complement(760276..761478)
                     /locus_tag="PPUBIRD1_RS03395"
                     /old_locus_tag="PPUBIRD1_0670"
     CDS             complement(760276..761478)
                     /locus_tag="PPUBIRD1_RS03395"
                     /old_locus_tag="PPUBIRD1_0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016713396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_014589592.1"
                     /db_xref="GI:504402490"
                     /translation="MQRRTLLKAGLALGALGSLPLGAHRAFADQPLTFYGLKSMSGAF
                     ASYGKYADMGSRLAIAEHPQLLGHPLKYKVIDTEGNAGKAVRKVQEAIGQDGARFFQG
                     CTLSSSALAVSKEIHKAGGVFMTPVGADEITGKDCNASTFRWSVPTYGAIRETLVPMS
                     RQLPQAKRWYTITPQYVFGDALLDNARKVFAELGVEHIGNSYHSLQEQEFSGYLTNAI
                     AAKPDVLVLLNFGSQASNALRQAVNFGIKDRMKVLMVWSAGLDQFQELGSDVLEGVYL
                     GAQYWHQVDTPLNKQLVAATRKAYGINPNYPLAADYIGTKVMLEAIVKAGSLDGATVS
                     AALQGMRFQGPTGEELIRPGDHQVLKDYYLLRGKPQGQMRDEDDLAEVISSGRSFVEV
                     DHTGCALA"
     gene            complement(761569..762333)
                     /locus_tag="PPUBIRD1_RS03400"
                     /old_locus_tag="PPUBIRD1_0671"
     CDS             complement(761569..762333)
                     /locus_tag="PPUBIRD1_RS03400"
                     /old_locus_tag="PPUBIRD1_0671"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_019437914.1"
                     /db_xref="GI:518267706"
                     /translation="MLKPKRKRQKLSDVIVESVKRSIVTEALHPGDRLPTERELMEHF
                     ECSKGTAREALKALEVEGLVSTRTGPTGGAYLNEVGTEPASRALRNYLHFQHLDGEQV
                     YQLRKVIEVELAVSVMGKLSEADYAALQANIDFCSAPEDSEEGQREQRLAELEFHTLL
                     ANRCPNPLLRFMAVFLNDLLRDLVVLKKAYLPKRQQFAAANIGYHKQLLTALRASDEP
                     AVRRLMHEHMCDAEHHMTALEGEVARNFLLEFDHHH"
     gene            complement(762600..762830)
                     /locus_tag="PPUBIRD1_RS03405"
                     /old_locus_tag="PPUBIRD1_0672"
     CDS             complement(762600..762830)
                     /locus_tag="PPUBIRD1_RS03405"
                     /old_locus_tag="PPUBIRD1_0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589594.1"
                     /db_xref="GI:504402492"
                     /translation="MVRLLFWIALIAAAFWLWRKYKVSQQSHPEAKLDAPLKMVRCAH
                     CGVHLPNDRALQQGNEWYCSQAHLQQGPGHQG"
     gene            complement(762925..763944)
                     /locus_tag="PPUBIRD1_RS03410"
                     /old_locus_tag="PPUBIRD1_0673"
     CDS             complement(762925..763944)
                     /locus_tag="PPUBIRD1_RS03410"
                     /old_locus_tag="PPUBIRD1_0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA transporter"
                     /protein_id="WP_004577276.1"
                     /db_xref="GI:490714583"
                     /translation="MRVKHLLLIAILGLTAACSSNKEVIDENLSEAELYQQAQADLDN
                     SSYTSAVNKLKALESRYPFGRYADQAQLELIYANYKNSEPEAAKSAAERFIRLHPQHP
                     NVDYAYYLKGLTSFDQDRGLLARFLPLDMTKRDPGAARDSYNEFAQLTSRFPNSRYAP
                     DAKQRMIYLRNLLASYEIHVADYYLSRQAYVAAANRGRYVVENFQETPSVGDGLAVMV
                     ESYQKLHLDELAATSLETLKLNYPDHPSLVDGEFQPKQTESDGRGWLSKATLGLIETD
                     TPLPPGETRANQDVVKQFQDARDEMPRELLPKDENGDPIVPEGPKEAEKDRSWFSYMT
                     FGLFD"
     gene            764092..765054
                     /locus_tag="PPUBIRD1_RS03415"
                     /old_locus_tag="PPUBIRD1_0674"
     CDS             764092..765054
                     /locus_tag="PPUBIRD1_RS03415"
                     /old_locus_tag="PPUBIRD1_0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003258205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /protein_id="WP_041167124.1"
                     /db_xref="GI:752477848"
                     /translation="MSEIIQLSAEVPSELGGQRLDQVAAQLFAEYSRSRLTSWIKEGR
                     LTVDGAVVRPRDLVHGGSLLTLEAEQEAQGEWIAEDIELDIVYEDDHILVINKPAGLV
                     VHPAAGHASGTLLNALLHHVPDIVNVPRAGIVHRLDKDTTGLMVVAKTLQAQTKLVEQ
                     MQARKVSRIYECIVIGVVTAGGKIDAPIGRHGGMRQRMAVTDGGKPAVSHYRVLKRFR
                     SHTHVRVKLETGRTHQIRVHMAHVGFPLVGDQTYGGRFRIPPAASPTMVEAVKTFPRQ
                     ALHARFLALAHPITGEVMKWESPLPDDFVWLLSLLNQDRESFIG"
     gene            765051..765791
                     /locus_tag="PPUBIRD1_RS03420"
                     /old_locus_tag="PPUBIRD1_0675"
     CDS             765051..765791
                     /locus_tag="PPUBIRD1_RS03420"
                     /old_locus_tag="PPUBIRD1_0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="laccase"
                     /protein_id="WP_014589596.1"
                     /db_xref="GI:504402494"
                     /translation="MSELTQALLFPDWPAPASVRACVTTRQGGVSLPPYETFNLGDHV
                     GDDPAAVAENRRRLSEQFAIQPAWLKQVHGRVVADADPAVVAEADASWTRQPGIACTV
                     MTADCLPALFCDRAGTRVAAAHAGWRGLAGGVLEATLDRLALPPEEVLVWLGPAIGPQ
                     AFEVGLEVRDAFTAVHPQAARAFVDGERPGKLLADIYELARIRLAARGVTAVYGGGLC
                     TVSDARFFSYRRTPQGGRFASLVWLDPR"
     gene            766041..768605
                     /locus_tag="PPUBIRD1_RS03425"
                     /old_locus_tag="PPUBIRD1_0677"
     CDS             766041..768605
                     /locus_tag="PPUBIRD1_RS03425"
                     /old_locus_tag="PPUBIRD1_0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88Q71.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disaggregation chaperone"
                     /protein_id="WP_041166835.1"
                     /db_xref="GI:752477559"
                     /translation="MRIDRLTSKLQLAISDAQSLAVGMDHPAIEPVHLLQALLEQQGG
                     SIKPLLMQVGFDINGLRQGLVKELDQLPKIQNPTGDVNMSQDLARLLNQADRLAQQKG
                     DQFISSELVLLAAMDENSKLGKLLLSQGVSKKALENAINNLRGGAAVNDANAEESRQA
                     LDKYTVDLTKRAEEGKLDPVIGRDDEIRRTVQVLQRRTKNNPVLIGEPGVGKTAIAEG
                     LAQRIINGEVPDGLKGKRLLALDMGALIAGAKYRGEFEERLKSLLNELSKQEGQIILF
                     IDELHTMVGAGKGEGAMDAGNMLKPALARGELHCVGATTLNEYRQFIEKDAALERRFQ
                     KVLVEEPSEEDTIAILRGLKERYEVHHKVAITDGAIIAAAKLSHRYITDRQLPDKAID
                     LIDEAASRIRMEIDSKPEVLDRLDRRLIQLKVESQALKKEEDEAAKKRLEKLTEEIER
                     LEREYSDLEEIWASEKAEVQGSAQIQQKIEQSRQELEAARRKGDLNRMAELQYGVIPD
                     LERSLQMVDQHGKTDNQLLRNKVTEEEIAEVVSKWTGIPVAKMLEGEREKLLKMEELL
                     HQRVIGQSEAVTAVANAVRRSRAGLSDPNRPSGSFLFLGPTGVGKTELCKALAEFLFD
                     TEEAMVRIDMSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVVLLDEVEKA
                     HPDVFNVLLQVLEDGRLTDSHGRTVDFRNTVIVMTSNLGSAQIQELVGDREAQRAAVM
                     DAVGAHFRPEFINRIDEVVVFEPLGREQIAGITEIQLGRLRSRLLERELSLSLSPEAL
                     DKLIAVGYDPVYGARPLKRAIQRWIENPLAQLILAGKFLPGSAITAKVEADEIVFG"
     gene            768968..769043
                     /locus_tag="PPUBIRD1_RS03430"
                     /old_locus_tag="PPUBIRD1_t0007"
     tRNA            768968..769043
                     /locus_tag="PPUBIRD1_RS03430"
                     /old_locus_tag="PPUBIRD1_t0007"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769001..769003,aa:Asn,seq:gtt)
     gene            769048..769124
                     /locus_tag="PPUBIRD1_RS03435"
                     /old_locus_tag="PPUBIRD1_t0008"
     tRNA            769048..769124
                     /locus_tag="PPUBIRD1_RS03435"
                     /old_locus_tag="PPUBIRD1_t0008"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769082..769084,aa:Pro,seq:tgg)
     gene            769132..769207
                     /locus_tag="PPUBIRD1_RS03440"
                     /old_locus_tag="PPUBIRD1_t0009"
     tRNA            769132..769207
                     /locus_tag="PPUBIRD1_RS03440"
                     /old_locus_tag="PPUBIRD1_t0009"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:769165..769167,aa:Lys,seq:ttt)
     gene            complement(769399..770694)
                     /locus_tag="PPUBIRD1_RS03445"
                     /old_locus_tag="PPUBIRD1_0678"
     CDS             complement(769399..770694)
                     /locus_tag="PPUBIRD1_RS03445"
                     /old_locus_tag="PPUBIRD1_0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003260618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent pyridine nucleotide-disulfide
                     oxidoreductase"
                     /protein_id="WP_003247549.1"
                     /db_xref="GI:489340369"
                     /translation="MTHRIVIVGGGAGGLELATRLGKSLGKRKQAEITLVDTNLTHIW
                     KPLLHEVAAGSLNSSEDELNYVAQAKWNHFNFQLGRMSGLDREGKQIQLAATLDEEGR
                     ELLPARTLGYDTLVIAVGSNTNDFGTLGAAQHCLFLDTRKQAERFHQQLLNHYLRAHA
                     GDVASEKISVAIVGAGATGVELAAELHHAAHELAAYGLDRIQPKDMHITLIEAGPRVL
                     PALPERISVPVHKTLEKLGVKVMTNAAVSEVTEDGLKTKDGEVIQASLKVWAAGIRAP
                     GFLKDIDGLETNRINQLVVRPTLQTTRDDNIFAFGDCAACPQPGSDRNVPPRAQAAHQ
                     QASMLAQSLKARLENKALPTYEYKDYGSLVSLSRFSAVGNLMGNLMGSVKLEGWLARM
                     FYVSLYRMHQMALYGFFRTALMMLGSKIGRGTEPRLKLH"
     gene            complement(770779..770952)
                     /locus_tag="PPUBIRD1_RS03450"
                     /old_locus_tag="PPUBIRD1_0679"
     CDS             complement(770779..770952)
                     /locus_tag="PPUBIRD1_RS03450"
                     /old_locus_tag="PPUBIRD1_0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004577274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_008091951.1"
                     /db_xref="GI:495367237"
                     /translation="MTSRLNPEDQRRVDEYLRAPQHQVERRPFRPWLLLVLVLAVTIG
                     LGLISRLLSGLVL"
     gene            complement(771085..771714)
                     /locus_tag="PPUBIRD1_RS03455"
                     /old_locus_tag="PPUBIRD1_0680"
     CDS             complement(771085..771714)
                     /locus_tag="PPUBIRD1_RS03455"
                     /old_locus_tag="PPUBIRD1_0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007959580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247546.1"
                     /db_xref="GI:489340366"
                     /translation="MDDSDYLRLLTIQAEQANAFLSNARKWERERWVCQRLLQGLNIP
                     YRSEDFTPAGQEPPDVLFRDAAFEVFFVLDEGRRLNDEWREELQRRRSAFSLAQLVRR
                     EARPRRISATELLGRLAPTLRKKAHNYRERGLELNELDIIAFSSLKREVLDLNTHFPP
                     PTEYLRQGWRSLSLVGPTFARVLFAHPDAPDFLRGNLGRSIVFDVGISL"
     gene            complement(771770..772201)
                     /locus_tag="PPUBIRD1_RS03460"
                     /old_locus_tag="PPUBIRD1_0681"
     CDS             complement(771770..772201)
                     /locus_tag="PPUBIRD1_RS03460"
                     /old_locus_tag="PPUBIRD1_0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003247544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589598.1"
                     /db_xref="GI:504402496"
                     /translation="MLEGTNPALLLAAALNATIGVIHLAIIAVGPRWYRLFGAGERMA
                     VAAEKGRCYPALITAAIACVLLAWSAYALSAAGAIGRLPLLLPVICLITLVYLLRGLL
                     GPVLLAGTGRSQRFIVVSSLICLGFGLVHLVGLVQQWPVLG"
     gene            772288..772995
                     /locus_tag="PPUBIRD1_RS03465"
                     /old_locus_tag="PPUBIRD1_0682"
     CDS             772288..772995
                     /locus_tag="PPUBIRD1_RS03465"
                     /old_locus_tag="PPUBIRD1_0682"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020190540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589599.1"
                     /db_xref="GI:504402497"
                     /translation="MAAKGIVQVISAQVLSGTTLTLGWLGYVPLLIWAVSRVRWVELF
                     TDRRRQHLLFGTVFCLFALWLVRRDFDTGVSYHFIGMTAVTLLLDWPLAVLGGFMAQL
                     GLLALGRQDLAALGVNGLLLIGLPVLITEVCAIVVERAQPRNLFVYIFCSGFFPAALT
                     VLVCVPAALGVLWLDGRFALPEWLSDFVGYLWLMMFPEAFINGMVISALVVFCPEWLE
                     TFNRTRYLQAPWKEDER"
     gene            complement(773172..773372)
                     /locus_tag="PPUBIRD1_RS03470"
                     /old_locus_tag="PPUBIRD1_0683"
     CDS             complement(773172..773372)
                     /locus_tag="PPUBIRD1_RS03470"
                     /old_locus_tag="PPUBIRD1_0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008091956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase inhibitor"
                     /protein_id="WP_014589600.1"
                     /db_xref="GI:504402498"
                     /translation="MSQPLTVDCPTCGAPVEWSEKNAFRPFCSDRCKLIDLGAWAAEE
                     HKIPGSEESEDELYSGDLEPRH"
     gene            complement(773369..773992)
                     /locus_tag="PPUBIRD1_RS03475"
                     /old_locus_tag="PPUBIRD1_0684"
     CDS             complement(773369..773992)
                     /locus_tag="PPUBIRD1_RS03475"
                     /old_locus_tag="PPUBIRD1_0684"
                     /EC_number="2.7.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019437918.1"
                     /note="Dephospho-CoA kinase; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_014589601.1"
                     /db_xref="GI:504402499"
                     /translation="MTTAAFTPWILGLTGGIGSGKSAAAERFVELGVHLVDADQAARW
                     VVEPGRPALASIVERFGPGVLQGDGQLDRAALRQLIFADPAQRKWLEQLLHPLIGQEI
                     FSYLAKAQSPYAVYVSPLLIESGQYHKTQRVLVIDAPQDLQIARTLARDNTSAEQVQA
                     ILQAQLAREDRLRHADDVVVNDGGLAALHEQIDRLHHFYLTLKGGQP"
     gene            complement(773992..774858)
                     /locus_tag="PPUBIRD1_RS03480"
                     /old_locus_tag="PPUBIRD1_0685"
     CDS             complement(773992..774858)
                     /locus_tag="PPUBIRD1_RS03480"
                     /old_locus_tag="PPUBIRD1_0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-methyltransferase"
                     /protein_id="WP_019437919.1"
                     /db_xref="GI:518267711"
                     /translation="MTLWALLVEQPAYFLTLATVLGLLVGSFINVLVYRLPIMLERQW
                     QREAQEVLGLPTTQHARFDLCLPASRCPHCAHRIRAWENIPVISYLALGGRCSSCKNR
                     ISLRYPVVEVASALLSLVVAWRFGASVEALLALPLTWCLLALSLIDADHQLLPDVLVL
                     PTMWLGLIVNAFGIHVPLADALWGAVAGYLSLWTVYWVFRLVTGKEGMGYGDFKLMAL
                     IGAWGGWQVLPLTLLLSSVVGALVGLCLLRFRRHALGTAIPFGPYLAIAGWIAVLWGD
                     EIYASYIQLLGY"
     gene            complement(774861..776069)
                     /locus_tag="PPUBIRD1_RS03485"
                     /old_locus_tag="PPUBIRD1_0686"
     CDS             complement(774861..776069)
                     /locus_tag="PPUBIRD1_RS03485"
                     /old_locus_tag="PPUBIRD1_0686"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II secretion system protein F"
                     /protein_id="WP_041166836.1"
                     /db_xref="GI:752477560"
                     /translation="MTSSSLLYRWHGTDANGAPVSGQTPGRSPAYVRAGLIRQGITVA
                     SLQPASGLAFSLPKRREKADPAGFSRQLATLLKAGVPLLQAFEVMGRSGCDAAQAALL
                     ERLKQDVASGLGLADALQRHPAWFDALYCNLVRVGEQSGTLDRQLEQLAGMLEQRRVL
                     HKKVRKAMIYPLLLLLTGLGVSAILLLEVIPKFESMFSGMGAALPAFTQWVINLSTGL
                     SRFAPLLLVMGLVLGVAVRQLYRQHAPARLWISWRVLGLPVFGKLLGQAALARFARSL
                     ATSYGAGVPLLDALGTVARVTGGDLHEQAVLRLRQGMANGQGLNQAMAGEPLFPPLLV
                     QLTAIGESSGTLDQMLEKAASHYEEQVSQALDQLTSLLEPAIVLILGLLVGGLVVAMY
                     LPIFQLGSLI"
     gene            776286..776696
                     /locus_tag="PPUBIRD1_RS03490"
                     /old_locus_tag="PPUBIRD1_0687"
     CDS             776286..776696
                     /locus_tag="PPUBIRD1_RS03490"
                     /old_locus_tag="PPUBIRD1_0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970772.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein"
                     /protein_id="WP_014589604.1"
                     /db_xref="GI:504402502"
                     /translation="MKGQRGITLIELMIVVAIIGILATIALPMYTNHQARSKAAAGLL
                     EISALKTAMDLRLNDGKDVADVAALGGQPATAHCAITASGKAADGSGSIVCTLVDAPA
                     NALGKALILTRSASGWACTTDIEEDLAPKGCKGA"
     gene            776768..776843
                     /locus_tag="PPUBIRD1_RS03495"
                     /old_locus_tag="PPUBIRD1_t0010"
     tRNA            776768..776843
                     /locus_tag="PPUBIRD1_RS03495"
                     /old_locus_tag="PPUBIRD1_t0010"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:776801..776803,aa:Thr,seq:cgt)
     gene            777093..778247
                     /locus_tag="PPUBIRD1_RS03500"
                     /old_locus_tag="PPUBIRD1_0688"
     CDS             777093..778247
                     /locus_tag="PPUBIRD1_RS03500"
                     /old_locus_tag="PPUBIRD1_0688"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Filamentation induced by cAMP protein Fic"
                     /protein_id="WP_014589605.1"
                     /db_xref="GI:504402503"
                     /translation="MPQFSHHDLQLLNPSFDSPLVDVLAELEFLRRLRLEGDTPPQVF
                     FQLKALFHTLESLGSARIEGNHTTLADYIDSKVEGKAESTDQLLEIANIEKAMDYIEA
                     VIEPGADLTEHTIRELHAMTVLGLRREGDKTPGAYREGAVRIAQAEHLPPEGVLVPQY
                     MQELVSFINRDDSPKYALMKVALAHHRFGWIHPFGNGNGRVVRLLTYALLMKYGFNVN
                     TGGRVLNPTAVFCNDRDKYYTMLGLADTGTAAGLEAWCTYVLQGIRDELEKVDKLTDY
                     GYLTKCILLPAVSFARSREWITETEEQILVSVIKMKVVKSSDIAQALPALTANQRTYQ
                     IKNLVEQGMLLPINPGSRQYTIGFSNNYLVRGVIKALREQGFIPEPLDRP"
     gene            779692..780396
                     /locus_tag="PPUBIRD1_RS03505"
     CDS             779692..780396
                     /locus_tag="PPUBIRD1_RS03505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008151840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166837.1"
                     /db_xref="GI:752477561"
                     /translation="MIYLGGTDFYIDVPSLPRHEFEQYSTKLFDEWEAYVENALKIPD
                     YSLALEVEEGSIKGSAKVAAALGAIYIGIGQYGSFISGLQTIRGQVSAVGSFLAAQAS
                     TPFPYGEVKPKIKKYNGALGDLQRLFNKVQQGEITAEQAMLKAELILGDEVSSEPGFM
                     VELKDSFESTTLLTRQLDLPLNNFEQGSVLQLDNKMRKPRVPRPKPELPIGQQFRVEV
                     WRESKKKKRKVRVIQL"
     gene            780478..781311
                     /locus_tag="PPUBIRD1_RS03510"
     CDS             780478..781311
                     /locus_tag="PPUBIRD1_RS03510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017049926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166838.1"
                     /db_xref="GI:752477562"
                     /translation="MRKPRIFIASAVESLDVADAFNVNLDHQTEVTVWKHGFNLSQNT
                     IDSLVKMAESVDFAIFIFTPDDIAEIRDQQKHVVRDNVLFELGLFVGTLGKERCFIVK
                     PRDTELHFPTDLLGLTPADYNGGRSDGNLEAAVNHPCVLIKKEVANLGLLSQDLNIHT
                     KPRRKAGYNYKLGDVEHRLLAKVLESYASSPDGVSVWSTFNNLKGVEQGVLSLAAIKL
                     ERVGFLDRSIAIDHEYNGSEYYSFTITADGIDYLLENEELLHKASKKVDVVDFNSDIP
                     F"
     gene            782550..783569
                     /locus_tag="PPUBIRD1_RS03515"
     CDS             782550..783569
                     /locus_tag="PPUBIRD1_RS03515"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000738239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166839.1"
                     /db_xref="GI:752477563"
                     /translation="MPAKKPLLMFRVGYMLQYDGIAEIKGGGSHIEKHGEGGEMWNFR
                     PESGRCYGYVMTRHFSGIDLSRIDGSKSWHENEELEGIDIVFFAKKPEGGQTVIGWYK
                     NATVFHKVYRKRRGMKTHGDWEKLDYLCEVDAENAVLLDESDRTFEVPYAPVHGKGYP
                     GHSNVWYGDAKEPRSQDFLKDLSNYIDQYSKAADKSSGACKLGSRSSQYDQELISNIE
                     KAAIRTTWDHYESLGYKLTSVEKDNRGWDLEALKGVELLRLEVKGHLGNVVQFELTPN
                     EYMQMQGNAFSYRVCMVRTCLSTPELTILFPKKIGQDWMLETSDLKVRVQLSEKIAAK
                     AYEVI"
     gene            783660..783950
                     /locus_tag="PPUBIRD1_RS03520"
     CDS             783660..783950
                     /locus_tag="PPUBIRD1_RS03520"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166840.1"
                     /db_xref="GI:752477564"
                     /translation="MTSKILIELDKEDEVRANLQDLLGDVVFIDAKRFDGADVLQILA
                     ALNTVTIPVLGKIAIERIRSNRHVVIKKDGVVVSGLSADNAIKVLNKLANND"
     gene            784405..785097
                     /locus_tag="PPUBIRD1_RS03525"
     CDS             784405..785097
                     /locus_tag="PPUBIRD1_RS03525"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041166841.1"
                     /db_xref="GI:752477565"
                     /translation="MAHEVAHSRWCLDKDNLNKEVSRHIDEFICEGSGFYINASNSLS
                     GYYKAALDQAPAGFLEEIFADDFGALIAFRVADRLGVPAWQRAAGVILAFKYMRLFRY
                     LDLLAHRIAKLSAETDAKSFKRKIKVLKKDILNGNTEDIRLYQFREHFIRHRLRIACS
                     RISSYDASDEVKISALIDDYETNTEQPIVLDLIERLSKRLKFKVWVDLNKKISAHRDG
                     VALVDEMTGWAK"
     gene            complement(785473..787005)
                     /locus_tag="PPUBIRD1_RS03530"
                     /old_locus_tag="PPUBIRD1_0692"
     CDS             complement(785473..787005)
                     /locus_tag="PPUBIRD1_RS03530"
                     /old_locus_tag="PPUBIRD1_0692"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_014589608.1"
                     /db_xref="GI:504402506"
                     /translation="MISMPENLPDDPVLLKQLLEQMISERASDKGKIVHLEEEVALLR
                     QRLFERKTEQTGDAATPQLPLFDEAESLAEPLDEADDEEVVAPTKRRGKRKPLPADLP
                     RIEVVHELPEHELTCACGCRKHAIVEEVSEQLEIVPMQIRVIKHVRKVYGCRDCESAP
                     VTADKPAQMIEKSMASPSVLAMLLTTKYVDGLPLHRFEKVLGRHGIDIPRQTLARWVI
                     QCSKHFQPLLNLMRESLLNSWIIHCDETRVQVLKEPSREPSSQSWMWVQTGGPSDRPV
                     ILYDYATSRAQEVPVRLLDGYRGYVMTDDYAGYNALAAQDGLERLGCWVHARRKFVEA
                     HKVQPKGKTGRADIALNLINKLYGVERDLKDSDDEDRKVARMERSLPLLTQLNNWVEK
                     TQPQVTTQNALGKAIGYLASNWSKLARYVEHGYLPMDNNAAERAIRPFVIGRKNWLFS
                     DTPKGATASAQLYSLVETAKANGQEPYAWLRHALERLPQACSVEDYEALLPWNCTPQI
                     HS"
     gene            complement(787159..787383)
                     /locus_tag="PPUBIRD1_RS03535"
                     /old_locus_tag="PPUBIRD1_0693"
     CDS             complement(787159..787383)
                     /locus_tag="PPUBIRD1_RS03535"
                     /old_locus_tag="PPUBIRD1_0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589609.1"
                     /db_xref="GI:504402507"
                     /translation="MMRPDAKVEKVYLYPKLVDFRKSIDGLAALVELDIKVAVFDPVL
                     FVFLNKPRNRVKILYWERNGFCLWLKRLES"
     gene            complement(787745..>787972)
                     /locus_tag="PPUBIRD1_RS03540"
     CDS             complement(787745..>787972)
                     /locus_tag="PPUBIRD1_RS03540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000571145.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041167125.1"
                     /db_xref="GI:752477849"
                     /translation="VLAELLDAEDGYLRFDHDPDRRDGHKHPLDHADLFYTNGASFKI
                     GLHKKIALDEIIDILNRETDCHYLGRVTERK"
     gene            complement(788393..790399)
                     /locus_tag="PPUBIRD1_RS03545"
                     /old_locus_tag="PPUBIRD1_0694"
     CDS             complement(788393..790399)
                     /locus_tag="PPUBIRD1_RS03545"
                     /old_locus_tag="PPUBIRD1_0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013697862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Putative ATP-dependent helicase"
                     /protein_id="WP_014589610.1"
                     /db_xref="GI:504402508"
                     /translation="MSSYIFSSIEASAEIEGFLHELADWCAEKFVQCYIIDKPLIEVK
                     GNYESDKCFAILIPKRKIVFASCSTDENTLSEYADDFVEDIGYISTKFNYKEKIGRPK
                     RWQNILTSQKPNAENLSIAEYLEASELDNPEEQRLSELLVSLATGSINDIERVGVEVP
                     ENDLDRIKRNILLFDGDQTRFVYQDLKQKEVRIQGLSGTGKTELLLHKLKELYVADDS
                     SKIAVTCHNKILAANLRARIPKFFNFMKVEQQIEWNQRLLCVHAWGSSGQPYSGAYAA
                     ICSAYDIPCHPWSRSMDFDRACSLSLEALKAKGGTDGVYAFDYMLIDESQDFPESFFV
                     LCELATKNSLFIAGDIFQSIFDERKNAGAKAEFTLSKCYRTAPTTLMFAQALAMGYFE
                     DRKLNWLDNDDLDACGYQNHTDPHTGELILKREPISRFEDISQESRSVDLIRLNGEYR
                     QQSCLQIIECIRDIKRQYPNVTANDVGIIMIDKGKAIYEMSDMLAQIIPREVGWPVNK
                     AYESGNPSKDGELFLSNTNHVKGLEFPFVICVTSHLSESFNHRNALYMAITRSFLKTY
                     FLVPNGAMNQTLDRIQEGLEKISESGVLRVMPPPAEEQDRIRASVKWHGRLKSFDDLA
                     LDILTELGTPESQVARYLNAMKSLLDPDASKVEIHKLARKLTSE"
     gene            791520..791732
                     /locus_tag="PPUBIRD1_RS03550"
                     /old_locus_tag="PPUBIRD1_0695"
     CDS             791520..791732
                     /locus_tag="PPUBIRD1_RS03550"
                     /old_locus_tag="PPUBIRD1_0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589611.1"
                     /db_xref="GI:504402509"
                     /translation="MSDQERLSTIQSYAWTLELLGEALVQHDEMLECEHNPRLSFRNT
                     AGIHQAIRIISRLASEQCGKVMEQGG"
     gene            791977..792675
                     /locus_tag="PPUBIRD1_RS03555"
                     /old_locus_tag="PPUBIRD1_0696"
     CDS             791977..792675
                     /locus_tag="PPUBIRD1_RS03555"
                     /old_locus_tag="PPUBIRD1_0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589612.1"
                     /db_xref="GI:504402510"
                     /translation="MDQNRDSLKTTNPIAGLPGAVFEKAWEVRWALKLAYVGLFIDIA
                     LMHSLGTTLLGFSGDMAIVWENVGRIFVGIMVFCLVVSVVIPVLARVAAIMGSFVPWY
                     RLQGPRDYSLFPNYVTFSALREHSLREGNEFLYNYWKRLTVQREEWRQQRFQAGVLVF
                     GLVLMAIANAGVSAHFQLPGLMAYFTFWFGWKGYALLSIVTLYLLHWAWWSSDEIGQI
                     YYPPLAEKLKKNQY"
     gene            complement(792772..794157)
                     /locus_tag="PPUBIRD1_RS03560"
                     /old_locus_tag="PPUBIRD1_0697"
     CDS             complement(792772..794157)
                     /locus_tag="PPUBIRD1_RS03560"
                     /old_locus_tag="PPUBIRD1_0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019750409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate transporter"
                     /protein_id="WP_014589613.1"
                     /db_xref="GI:504402511"
                     /translation="MTPLDIQLLLTALASVLVLVALIVSRLKMHPLLALLVVSIGVGF
                     ATHMAPGSIVSHLLTGAGKTLGAVGVVIALGAMLGKILADAGVTEQVADVILKRTSDR
                     MIPWAMMLVAFVIGIPMFFEVGLVIMLPLIFSVARKLESKARFKGSAYVYVGVPVISA
                     LAAMHGMVPPHPGPLTAIAVLKTSVGPTMLYGFVAAIPAMILGGPLYGMFISPRMNTR
                     PDQALLDQFTLTEKADGQPRPGVMVGMLAALLPAILMLVHAVAEMLLPKGNALLEMAS
                     FLGNPLIAMLLGVLFAGASLVLARGGDAEQLRDALGKSLKPIASIIMIIAGGGAFQEM
                     LTSAKVGDAIVHLTQQSAFPPLILGWLIAMLLSVSTGSATVGIVGAAGLLAPLAGADP
                     SLNLPLLALSIGCGSLFFNYANHAGFWMVKESFGMTMGEATKTISVVQSIVAVVGLIV
                     VLLLNAAIAVS"
     gene            794590..795519
                     /locus_tag="PPUBIRD1_RS03565"
                     /old_locus_tag="PPUBIRD1_0698"
     CDS             794590..795519
                     /locus_tag="PPUBIRD1_RS03565"
                     /old_locus_tag="PPUBIRD1_0698"
                     /EC_number="1.1.1.37"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate dehydrogenase"
                     /protein_id="WP_014589614.1"
                     /db_xref="GI:504402512"
                     /translation="MNKLTIVGAGLVGEAAAQIIARDELCRELVLMDVQGELAQGKAL
                     DVWQAAVDSGSDTHVHGGAKAEMLEGSELVVITAGVPRKPGQSRQDVLSTNLPILDSI
                     MADIKHHAPTATVLVVSNPVDVLTYRAWSVSGQGRDKVFGQAGVLDTARMKCFIAEQT
                     GFSARDITALVLGGHGDSMVPLMRYCQIGSVPLSHFLSSEQIEQIVERTRKGGGEILG
                     LKKTGSACDAPGVAIAQMVDAIANGRNRILPAVAILEGEYGRTDIAMGVPCVLAEKGL
                     ARVIELPLDAQEQAMFDHSADQVARDIAEMKAL"
     gene            complement(795625..796446)
                     /locus_tag="PPUBIRD1_RS03570"
                     /old_locus_tag="PPUBIRD1_0699"
     CDS             complement(795625..796446)
                     /locus_tag="PPUBIRD1_RS03570"
                     /old_locus_tag="PPUBIRD1_0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_003247513.1"
                     /db_xref="GI:489340333"
                     /translation="MSTFPPSPKPVAKPAGAGLFGFRTRLLLTWLALFGLFVAFFLSF
                     DLKFAIILEKFPNLAGFKLGPNGFLQGAALTLFLCLCSMVVSVLLGFAAALARLSNSA
                     VLVGVASFYTSFFRGTPLLIQILLIYLGLPQVGLVPGAISAGIIALSLNYGAYLSEIF
                     RAGILGVARGQREAALALGMRTPQIFCHIILPQAMRVIIPPTANQFISMLKDSSLISV
                     MGVWEVMFLAQSYGRSSYRYLEMLTTAAVIYWVLSILLELLQARLERHFGKAYQR"
     gene            complement(796443..797264)
                     /locus_tag="PPUBIRD1_RS03575"
                     /old_locus_tag="PPUBIRD1_0700"
     CDS             complement(796443..797264)
                     /locus_tag="PPUBIRD1_RS03575"
                     /old_locus_tag="PPUBIRD1_0700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_003247511.1"
                     /db_xref="GI:489340331"
                     /translation="MRFSSLLGAGLVLLATATQAFAGATLERVESRKEMVNVLMESYP
                     PFSFLNDHNQLDGYDVDVAKAVADKLGVKLRLETPSWDVIAAGRWSGRYDICICSMTP
                     SKARAEVFDFPVEYYASPAVIVVNASDERIHGAKDLEGRKVGSISASSYESYLNKNLV
                     IEGKEDQKIDYPFDFVQAAPYDTENVAFQDLGLGTGVRLDAIITNLVTAQPRLQQDKR
                     FKLAGAPLYEEPNAVAIEKGDPEWDAKVRQVFAELKADGTLAKLSQKWIGADISK"
     gene            797368..798267
                     /locus_tag="PPUBIRD1_RS03580"
                     /old_locus_tag="PPUBIRD1_0701"
     CDS             797368..798267
                     /locus_tag="PPUBIRD1_RS03580"
                     /old_locus_tag="PPUBIRD1_0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003247509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homocysteine methyltransferase"
                     /protein_id="WP_033724844.1"
                     /db_xref="GI:727266154"
                     /translation="MAERTMVILDGGMGRELQRSGAPFRQPEWSALALSEAPEAVVGV
                     HAAFIDAGAQVITSNSYAVVPFHIGEERFAAEGRQLAHIAGQLARHAADSGAHPVRVA
                     GSLPPLFGSYRPDLFQSERVAEVLTPLLQGLAPHVDLWLAETQSSVAEVRAIHSHLPA
                     DGRPFWVSFTLQDEDVDEVPRLRSGEPVAEAIEAAVSLGVAAVLFNCSQPEVIGAAID
                     VARSVIERHNAEIAIGAYANAFPPQPKEATANDGLDELREDLDPPGYLAWAKDWRARG
                     ASMVGGCCGIGPEHIAELKRNLA"
     gene            798435..799706
                     /locus_tag="PPUBIRD1_RS03585"
                     /old_locus_tag="PPUBIRD1_0702"
     CDS             798435..799706
                     /locus_tag="PPUBIRD1_RS03585"
                     /old_locus_tag="PPUBIRD1_0702"
                     /EC_number="2.5.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193339.1"
                     /note="catalyzes the formation of cystathionine from
                     L-cysteine and O-succinyl-L-homoserine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_010951917.1"
                     /db_xref="GI:499254377"
                     /translation="MNNNEKFEGNAAAGVGTRVVWSGEQVQHPYNATQTPIVVSAAYG
                     YNDIDAWYDVAQGKQPGFIYSRMSNPTVATLEAKLAELEQAESAVAFSSGMAAISAVL
                     HTFLSNGKRVVSTRDSYGGTNKIFEEFLPRMGVQVCLCDTLDTEALEREIAAGCDLLY
                     LETPTNPTLKVLDIRRLSAAAHKVGALVVADNTFATPLNQNPLALGVDVVVHSATKFL
                     SGHGDVLGGVVCGAEALMAQVRHYREINGAALDPFSAYLIIRGIKTLAVRLRQQQASA
                     MALAHYLSTEPLVEAVNYPGLPAHAGHAIAKAQMRGFGAIVSFVLKGGMPTVARLLPR
                     LKYAHRAGNLGAVETIYGPARTTSHVENTLEERLALGISEGLVRISVGIEETDDLLAD
                     LAQACASVREELAVAKELHADADACQSPVQA"
     gene            799849..801288
                     /locus_tag="PPUBIRD1_RS03590"
                     /old_locus_tag="PPUBIRD1_0703"
     CDS             799849..801288
                     /locus_tag="PPUBIRD1_RS03590"
                     /old_locus_tag="PPUBIRD1_0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid transporter"
                     /protein_id="WP_014589617.1"
                     /db_xref="GI:504402515"
                     /translation="MSVQTTTTRNASAHTFKQDMQTRHIVMLALGGVIGTGLFLTSGY
                     TVNQAGPLGAVIAYILGAIMVYLVMMCLGELAVHMPEVGSFSSYATRYLGPGTGYMVA
                     WMYWLTWTVAIGSEFTAAGILMVRWFPDTPVWMWSALFGAAVFISNIISVRSFAETEF
                     WLSLVKVLAVIAFLVVGGGAILGGFEIQQAHSAGLGNFTREGLFPTGFWSIAMTLLAV
                     AFAFSGTELIGIAAGETKDPEKNVPKAIRTTVLRLALFFIGTIFVLATLLPREQAGVI
                     ESPFVMVFAMIGIPYAADIMNFVIITALLSAANSGLYAASRMLWTLSDQGNMPRRYAT
                     LSRRGTPFNAIVLSMAGGMASLLSSVFAPDTIYLALVSISGLAVVVVWISIAASQIAF
                     RRHYIASGGKLEDLKFRVRGYPFVPLGAIFCCVLACVGIAFDPAQRVALYFGLPFIAW
                     CYLAYWLTCKYRSRRTGPVEIVAPGSEAA"
     gene            801334..802218
                     /locus_tag="PPUBIRD1_RS03595"
                     /old_locus_tag="PPUBIRD1_0704"
     CDS             801334..802218
                     /locus_tag="PPUBIRD1_RS03595"
                     /old_locus_tag="PPUBIRD1_0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016713370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_014589618.1"
                     /db_xref="GI:504402516"
                     /translation="MTQKTLPPLNWLRAFEVSARYLNFTHAAEELHLTQGAVSQQIRH
                     LESQLGVALFKRLPRGLGLTEEGQSYLPVVQDAISRLAVGTNEIFGQRQRRPLKVRGS
                     LSFLHFWLAPRLADFRRSHPQVDIRYISNLWVKELDAEDDLEIRWGSGQWAGVEAQRL
                     TRDVLVPVCAPALLASCPLRDPRDLARVPLLHVLGYEEGWGYWLERVGADQVDSSSGL
                     QFDTLVSTLRMAELGLGVALARSSLVEDLLQEGRLVAPFAQRIEASESFFLVRGLGEA
                     LSPDAQAFSHWLVAMAHR"
     gene            802243..803631
                     /locus_tag="PPUBIRD1_RS03600"
                     /old_locus_tag="PPUBIRD1_0705"
     CDS             802243..803631
                     /locus_tag="PPUBIRD1_RS03600"
                     /old_locus_tag="PPUBIRD1_0705"
                     /EC_number="4.2.3.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_014589619.1"
                     /db_xref="GI:504402517"
                     /translation="MQYTSTRGNEIRVDFRTALLSGLADDGGLYVPTSVPVFSPQEIA
                     SWSWLPFDELAWRVMAPFVGDTLDEPTLRALVSDSYRGFRHRGIAPLQQLGHNEWILQ
                     LFHGPTRSSKDFAAQLQARFVRHFLGAECERVMLVGASNGDTAVAAIEALRHCPAAGL
                     LALYPSAGTPADRAAVMRSAASDSVSCVAVDGSFDDCQSLVSALLRDWPCPGLIPVSF
                     NSTNWVGVLAQIVFYFHAALQLGGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQII
                     VSTNRNDALHRFIHCNRYSRGSTSQTLSPVMDFSLFSNLERFVWELYDRDGGATRALM
                     EHFEACGELSIGNRQWLHARMLFDSYAVDDVLIREEIVTLFHETGSAVDPHAATGVFA
                     GRLHRRNIGAPIVTLGQFAPEKSAGLLAELGAWHGEVPAGAVGTAGDEPLLAPDDLAG
                     VHALLARLQAGR"
     gene            803628..804065
                     /locus_tag="PPUBIRD1_RS03605"
                     /old_locus_tag="PPUBIRD1_0706"
     CDS             803628..804065
                     /locus_tag="PPUBIRD1_RS03605"
                     /old_locus_tag="PPUBIRD1_0706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="WP_014589620.1"
                     /db_xref="GI:504402518"
                     /translation="MKRILDPLDERILAELTANARIAHAELGLKVNLSRNAVRQRIER
                     LERDGAIQGYTLRIGEGRRPASLINAVIFVYRYDRMRGDAVLDALRQIPEVIQCEVLS
                     GEFDLMLRVEASSPERVHHVWKEIAAMPGVENTVTSFVLAAVV"
     gene            804264..805307
                     /locus_tag="PPUBIRD1_RS03610"
                     /old_locus_tag="PPUBIRD1_0707"
     CDS             804264..805307
                     /locus_tag="PPUBIRD1_RS03610"
                     /old_locus_tag="PPUBIRD1_0707"
                     /EC_number="1.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_014589621.1"
                     /db_xref="GI:504402519"
                     /translation="MTEYKIALVGFGGVNRALAQLIAERNARWQQELGFGLKIVGVTD
                     LFLGSVIDRDGLDAAMLAALPAQKGALAQIPQGSAEAFNEAVIKQSGADIIAEATFTN
                     PKDGEPAATFCRWALEAGKHVVTTNKGPIALHAQALKALAKANDVSFEYEGAVMSGTP
                     VLRMARQTLAGAGLVGFEGILNGTSNYVLTRMEEGLGFNEAVAQAQALGFAEADPTAD
                     VEGHDVRLKVVILANELLGACLQVGDVACSGISAIDSAAIERAQAAGERWKLIGSARR
                     EADGSVRASVEAKLLPGHHPLAGISGATNALAFDTELLGAVTVSGPGAGRIETAFALL
                     SDIVAIHAAGHSA"
     gene            805320..806738
                     /locus_tag="PPUBIRD1_RS03615"
                     /old_locus_tag="PPUBIRD1_0708"
     CDS             805320..806738
                     /locus_tag="PPUBIRD1_RS03615"
                     /old_locus_tag="PPUBIRD1_0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020193335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_014589622.1"
                     /db_xref="GI:504402520"
                     /translation="MSLTSVSRALVQQPALIDVYNPFDGSLVGSVDNLGAEAVPALLA
                     RARQGVRESAALPRHRRAHILEHAAQLIERDAADFAGLIVDEAGKTLRQAEKEVKRCI
                     NTLKLSAEEARRNAGEVVPFDAYEGSESRQGWFTREPLGLILAITPYNDPLNLVAHKL
                     GPALAGGNAVILKPSELAPLSALKLVQYLVDAGLPEAVVTVATGGAELGKALVAVREV
                     RMVSFTGGFATGEKIAHGAGLKKLAMDLGGNAPVLVLKDCDLEATVESCVSGAFWAAG
                     QNCIGTQRILVDASIYEAFRERFVALTQAMVWGDPGRRETDMGPMITEAAARQIEERV
                     NQALEGGARLLCGHQRQGAVYAPTVLESVDPVSRLWLEEVFAPVVMLAPFETVEQAIA
                     LANAPEYSLHAGVFTRDLSLALSLARRIEAGGVMINDSSDYRFDAMPFGGAKYGSLGR
                     EGVRFAYEDMTQPKVVCFNQMG"
     gene            806755..807102
                     /locus_tag="PPUBIRD1_RS03620"
                     /old_locus_tag="PPUBIRD1_0709"
     CDS             806755..807102
                     /locus_tag="PPUBIRD1_RS03620"
                     /old_locus_tag="PPUBIRD1_0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_026031895.1"
                     /db_xref="GI:648250746"
                     /translation="MITRYGSSARMSLAVSYRGLFETAGIVADDLQQDVQGQLRQALS
                     VIDGLMGQANVGKAQLTRVQMWLADYRHFDLVNEVYDAWLQGCAKPVRACVGADLGAG
                     YLVEVQVFAVCPE"
     gene            complement(807130..808083)
                     /locus_tag="PPUBIRD1_RS03625"
                     /old_locus_tag="PPUBIRD1_0710"
     CDS             complement(807130..808083)
                     /locus_tag="PPUBIRD1_RS03625"
                     /old_locus_tag="PPUBIRD1_0710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arsenic resistance protein"
                     /protein_id="WP_014589624.1"
                     /db_xref="GI:504402522"
                     /translation="MTREQLETRQIPIYFAAVLAAIVFGLLASDTARQLEALITPAIA
                     VLMYAMFLQIPFLDLRQGLGNRRFITALLLANFMLVPLLVWAITRGLVEHPAILVGAL
                     LVLLTPCIDYVVVFTHIGKGDSRLTLAATPVLLLAQLVLLPVYLALMLGGGSQVAISI
                     TPFVEAFVLLIVVPMALAVLTSAGARRSRAVATWNDAWAWLPVPAMALVLMVVIASQI
                     VVVLRDFDRLLPVVPVYIGFMLLAPVLGFICARLLRLPASEARSVTFSAATRNSLVVL
                     PLALALPEEMRGLAAAAVITQTLVELVSELIYVRAVPRFVH"
     gene            complement(808332..809585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS03630"
                     /old_locus_tag="PPUBIRD1_0711"
     CDS             complement(808332..809585)
                     /gene="glyA"
                     /locus_tag="PPUBIRD1_RS03630"
                     /old_locus_tag="PPUBIRD1_0711"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q88Q27.1"
                     /note="Serine hydroxymethyltransferase 2; catalyzes the
                     reaction of glycine with 5,10-methylenetetrahydrofolate to
                     form L-serine and tetrahydrofolate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_014589625.1"
                     /db_xref="GI:504402523"
                     /translation="MFSRDLTIAKYDAELFEAMQQEALRQEEHIELIASENYTSPAVM
                     EAQGSVLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHAGSQAN
                     AAVYLALLSAGDTILGMSLAHGGHLTHGASVSSSGKLYNAIQYGIDGNGLIDYDEVER
                     LAVEHKPKMIVAGFSAYSQVLDFARFRAIADKVGAYLFVDMAHVAGLVAAGVYPNPVP
                     FADVVTTTTHKTLRGPRGGLILARANADIEKKLNSAVFPGAQGGPLEHVIAAKAICFK
                     EALQPEFKAYQQQVVKNAQAMASVFIERGFDVVSGGTQNHLFLLSLIKQEISGKDADA
                     ALGKAFITVNKNSVPNDPRSPFVTSGLRFGTPAVTTRGFKEAECKELASWICDILADL
                     NNEAVIDAVREKVKAICKKLPVYGN"
     gene            complement(809892..813722)
                     /locus_tag="PPUBIRD1_RS03635"
                     /old_locus_tag="PPUBIRD1_0712"
     CDS             complement(809892..813722)
                     /locus_tag="PPUBIRD1_RS03635"
                     /old_locus_tag="PPUBIRD1_0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014755285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate phosphodiesterase"
                     /protein_id="WP_014589626.1"
                     /db_xref="GI:504402524"
                     /translation="MTNLTHPSSLRSAPQAPATILRGSIKGALALLALILLGLLLWQL
                     FAQFNHTQAELRKQSLDASAELADHLSLNMALKAQQAVNVVQPYLDAPTPAALPSLLG
                     TLRERLPALQSVAWLDNTGQLRADSLAGSPDRQSLDELLVLSQGRPYFFTNSADNHIL
                     YLLLRQDASQGSGYWLLRLSPDYYRELTLHLEGSGHPQWLLENSRSGEVLQRHAAADT
                     SDEPLQSVMLAFIENSTWQLRGLFDAKLAQQKLLPALLGKCLLVLFCALLPVLALINM
                     RRRQRALQEDRRRYQEIFEGTGVALCVLDLSSLPGQLDRYHLRNRAALKHSLALDPNL
                     RRSLLLELKITEVNQVARQLLNIHCHEGAWQRLIDGTGDSRDSVGMQLIDALIEQRPL
                     LELEVRLPTPQGTELHLWLMARLPLQRRDYQAVILSISDITSRKQVELSLLERESFWS
                     DVVRTVPDQLYVQDVPSQRMIFSNRHLGQTLGYDRTELAQMGDRFWELLLHPEDAAHY
                     QALRQQQRDSGHDQPLHCQLRFRHRDGSWRCYDIREQVLSRNAEGLVTRIIGVGKDVT
                     VQIEASQSLRDSEQRYRMLAESISDVIFSTDNQLKLNYVSPSVQSVLGYQADWIFANG
                     WQSIVANPAQLTGIYSLMERVSKAMGDPAQMAQLCSQLPTQLFLFDCLRADGRKIPIE
                     LRLVLVWDDDQRFEGVLGVGRDISQQRRAEKDLRMAATVFEHSTSAILITDPAGYIVQ
                     ANEAFSRVSGYAVSEVLDQLPGMLTVDEQQEGHLRYVVKQLHQRGSWEGEVWLKRRDG
                     DHYPAWVGITAVLDDEGDLASYVCFFTDISERKASEQRIHRLAYYDALTHLPNRTLFQ
                     DRLYNALQQAERQKAWVVLMFLDLDRFKPINDSLGHAAGDRMLKDMALRLLACVDDDD
                     TVARMGGDEFTLLLQPRPTREMALNRAIHVAENILGSLVRPFVLENREFFVTASIGIA
                     LSPQDGSELSQLMKNADTAMYHAKERGKNNFQFYQAEMNASALERLELESDLRHAMEQ
                     NEFILYYQPQFSGDGKRLTGAEALLRWRHPTRGLVPPGDFIPVIEELGLVVDVGDWVL
                     REASRQLKAWHKAKVRVPKVSVNISARQFSDGQLGTRIANILEESGLPPACLELELTE
                     SILMREVNEALQILASLKNLGLSIAVDDFGTGYSSLNYLKQFPIDVLKIDRTFVDGLP
                     EGEQDAQIARAIIAMAHSLNLAVIAEGVETHEQLEFLREHGCDEVQGYLFGRPMPAHQ
                     FEAQFSNETLFMFH"
     gene            813971..814375
                     /locus_tag="PPUBIRD1_RS03640"
                     /old_locus_tag="PPUBIRD1_0713"
     CDS             813971..814375
                     /locus_tag="PPUBIRD1_RS03640"
                     /old_locus_tag="PPUBIRD1_0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014589627.1"
                     /db_xref="GI:504402525"
                     /translation="MVTHFSSNGLDSACGRSSQTLVSTAVTEDVSCKSCQRSLGKPEA
                     AAAAKSKAPSLAELRKTAKVAAEPAVAVAAAKPAAKVVSTAPAPAKPAKAAEQQPARS
                     GSFSVKSAWAARLAEQGDRCRLPRGKAKQRHV"
     gene            814680..816347
                     /locus_tag="PPUBIRD1_RS03645"
                     /old_locus_tag="PPUBIRD1_0714"
     CDS             814680..816347
                     /locus_tag="PPUBIRD1_RS03645"
                     /old_locus_tag="PPUBIRD1_0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013970812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_010951931.1"
                     /db_xref="GI:499254391"
                     /translation="MAQYVYTMHRLSKVVPPKREILKNISLSFFPGAKIGVLGLNGAG
                     KSTLLRIMAGVDKEFDGEARPMPDINVGYLPQEPQLDPTKTVREVVEEAVSVIKDAQA
                     RLDEVYAAYAEPDADFDKLAAEQAKLEAILQAADGHNLERQLDVAADALRLPAWDARI
                     EHLSGGEKRRVALCRLLLSAPDMLLLDEPTNHLDADSVAWLERFLHDFPGTVVAITHD
                     RYFLDNVAGWILELDRGAGIPYEGNYSGWLEAKSERLAQESKQQSAHEKAMKEELEWV
                     RKGAKARQSKSKARLQRFEEMQSQEFQKRSETNEIYIPAGPRLGDKVIEFKNVTKGYG
                     DRVLIDNLSFSMPKGAIVGVIGGNGAGKSTLFRMLMGKEQPDSGSIEIGETVQLACVD
                     QSREDLDGAKTVFQQISDGSDQIRIGNYEIPSRTYVGRFNFKGGDQQKFVKDLSGGER
                     GRLHLALTLKEGGNVLLLDEPSNDLDVETLRSLEEALLDFPGAAIVISHDRWFLDRVA
                     THILAYEDDSNVVFFEGNYTEYEADRKKRLGDAAAQPHRVRHKKLAQ"
     gene            816569..817909
                     /locus_tag="PPUBIRD1_RS03650"
                     /old_locus_tag="PPUBIRD1_0715"
     CDS             816569..817909
                     /locus_tag="PPUBIRD1_RS03650"
                     /old_locus_tag="PPUBIRD1_0715"
                     /EC_number="1.4.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014589628.1"
                     /note="converts 2-oxoglutarate to glutamate; in
                     Escherichia coli this enzyme plays a role in glutamate
                     synthesis when the cell is under energy restriction; uses
                     NADPH; forms a homohexamer; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_014589628.1"
                     /db_xref="GI:504402526"
                     /translation="MIESVDNFLARLKQRDPGQPEFHQAVEEVLRTLWPFLEANPHYL
                     QSGILERMVEPERAVLFRVSWVDDQGKVQVNRGYRIQMSSAIGPYKGGLRFHPSVNLS
                     VLKFLAFEQVFKNSLTSLPMGGGKGGSDFDPKGKSDAEVMRFCQAFMSELYRHIGADC
                     DVPAGDIGVGAREIGFMFGQYKRLANQFTSVLTGKGMTYGGSLIRPEATGYGCVYFAE
                     EMLKRQDKRIDGRRVAVSGSGNVAQYAARKVMDLGGKVISLSDSEGTLYAEAGLTDAQ
                     WDALMELKNVKRGRISELAGQFGLEFRKGQTPWSLPCDIALPCATQNELSAEDARTLL
                     RNGCICVAEGANMPTTLEAVDIFLDAGILYAPGKASNAGGVAVSGLEMSQNAMRLLWT
                     AGEVDSKLHNIMQSIHHACVHYGEEADGRINYVKGANIAGFVKVADAMLAQGVV"
     gene            complement(818074..818571)
                     /locus_tag="PPUBIRD1_RS03655"
                     /old_locus_tag="PPUBIRD1_0716"
     CDS             complement(818074..818571)
                     /locus_tag="PPUBIRD1_RS03655"
                     /old_locus_tag="PPUBIRD1_0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012051151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor GreAB"
                     /protein_id="WP_014589629.1"
                     /db_xref="GI:504402527"
                     /translation="MSRAFVNEDQAADQADQPVERRISEQPNYVTASGLRQLQTRVAE
                     LNALRSELQAQGERGDKQRLADTERDLRYFSARVQSAQVVPAATSHSKVQIGSRVRFV
                     DAQDQEQLVQLVGEDEADAGRGLINWGSPLGRALLGAGPGDEVVWQRPVGEQVIEVVE
                     ILGEG"
     gene            complement(818639..818995)
                     /locus_tag="PPUBIRD1_RS03660"
                     /old_locus_tag="PPUBIRD1_0717"
     CDS             complement(818639..818995)
                     /locus_tag="PPUBIRD1_RS03660"
                     /old_locus_tag="PPUBIRD1_0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016501550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_003247495.1"
                     /db_xref="GI:489340315"
                     /translation="MSRYWFGVCIALLLSGCETTHEQMVNHGYPPAYADGFQDGCSSG
                     RQAAGLMVGNFRKNVPRYLHERQYETGWDDGFRQCHAMQNSEEQRQYHERFWDQRDRE
                     WEQEKDRGAAKAYRHN"
     gene            complement(819212..821065)
                     /locus_tag="PPUBIRD1_RS03665"
                     /old_locus_tag="PPUBIRD1_0718"
     CDS             complement(819212..821065)
                     /locus_tag="PPUBIRD1_RS03665"
                     /old_locus_tag="PPUBIRD1_0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010951934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014589630.1"
                     /db_xref="GI:504402528"
                     /translation="MLKRLAALALCACAPVHAAPMLDPGRLQQLANTPYWLAIGHYET
                     AKLGGWRSYVDDDAFFLAEDGAHHPDQELKATVAALYAPASLGDKHAQCVFPARTRWL
                     REQLDLQDLPQPDCQEFKTWYQSIDPHSAALIFPAAYLNSPSSMFGHTLLRIDQSNTR
                     SDDTTLLSYAINFGAYIEGSDNSILYAWKGLMGGYPGLFALMPYQEKLSEYRSLENRD
                     LWEYQLDLTPEETGRMVEHVWELKQIQFDYFFFDENCSYRLLELLQVARPSLDLTSQF
                     PLTAIPTDTVKAVKQSGLVASETYRPSRERELLARAEPLDHDEKRQVLAVSADTAQLQ
                     SPEFQALPRERQALVQDAAYRLERYRANGQERDPGQAKRSFELLRAINSNPPPPLQTE
                     RPGLPEDGHDSRTWQLGVGTREDRAYAEYGLRMAYHDLNDNAYGFPLGAQIEILQLKL
                     RQYEGNDWQVQRLDLATIRSLTPRNELLKPWSWQVAGGLERVPGKHDDEVLVSHVNGG
                     AGGTWQLADGLLGFALGTVRVEHHNDFAQFIAPAAGFNGGLLWRNGLGNMTLEAKGDY
                     FTNGEVRRSVSLNQQWEISQNLGLRLSASREFSHLATAQNEVMLELKWYHY"
     gene            complement(821137..821625)
                     /locus_tag="PPUBIRD1_RS03670"
                     /old_locus_tag="PPUBIRD1_0719"
     CDS             complement(821137..821625)
                     /locus_tag="PPUBIRD1_RS03670"
                     /old_locus_tag="PPUBIRD1_0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003256313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003247492.1"
                     /db_xref="GI:489340312"
                     /translation="MKRILLGTLFTVVSLNAMAEAPGGPNCGWGNMLFEGQRGTPAHF
                     LASTTNGTSGNATFGMTSGTNGCSTKASLTYGGKSWFAMNGMMNELSEDMAMGQGEAL
                     TTYAVVLGVAPEDRSYFNSVTHQHFNQIFSSADVTAETVHSNTLAVLKSDPRLAKYAT
                     EA"
     gene            821876..824314
                     /locus_tag="PPUBIRD1_RS03675"
                     /old_locus_tag="PPUBIRD1_0721"
     CDS             821876..824314
                     /locus_tag="PPUBIRD1_RS03675"
                     /old_locus_tag="PPUBIRD1_0721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010174939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_004575710.1"
                     /db_xref="GI:490712880"
                     /translation="MPDPVAARLRLAPEALTRRFSPEQFAFTHTDDLEPFRGVLGQER
                     AVEALQFGVAMPRPGYNVYVMGEPGTGRFSFVKRYLKAEGKRQQTPADWVYVNHFDDT
                     REPRALELPSGSAAEFISDMGGLIDNLLSTFPAVFEHPSYQQKKGAIDRAFNQRYDRA
                     LDVIERASLEKDVALYRDASNVAFTPMADGKALDEAEFAQLPEEVREQFHEDIALLEE
                     RLNEELASLPQWKRESNNQLRQLNEETITLALQPLLAPLSEKYAENAAVCAYLQSVQL
                     NLLRTLVEQLVDDSKSDAVARKLLEEQYAPSLVVGHHADGGAPVVFEPHPTYDNLFGR
                     IEYSTDQGALYTSYRQLRPGALHRANGGFLILEAEKMLGEPFVWDALKRALQSRKLKM
                     ESPIGELGRVATVSLQPQVIPLNVKLVIIGSRQLYYALQDHDPDFQEMFRVLVDFDED
                     MPMVDENLEQFAQLLRTRTNEEGMAPLTSDAVARLATYSARLAENQSRLSARIGDLFQ
                     LVSEADFIRQLASDEMTDAGHIERALKAKATRTGRVSQRVLDDMLAGIILIDTEGAAI
                     GKCNGLTVLEVGDSAFGMPARISATVYPGGSGIVDIEREVNLGQPIHSKGVMILTGYL
                     GSRYAQEFPLAISASIALEQSYGYVDGDSASLGEACTLISALSRTPLKQCFAITGSIN
                     QFGEVQAVGGVNEKIEGFFRLCEARGLTGEQGVIIPRANVATLMLDERVLQAVENGMF
                     HVYAVSQADEALSLLVGEEAGVLDDKGLFTEGSVNARVVERLREIAEMISEEDIEKAE
                     KERLEEVIAQAKPA"
     gene            824477..824815
                     /locus_tag="PPUBIRD1_RS03680"
                     /old_locus_tag="PPUBIRD1_0722"
     CDS             824477..824815
                     /locus_tag="PPUBIRD1_RS03680"
                     /old_locus_tag="PPUBIRD1_0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016713353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951936.1"
                     /db_xref="GI:499254396"
                     /translation="MRNLSLTRQCLGLVTRIECSIRPLAGDNGMWTLLFAAGMAGEQP
                     SAIKAQGPFHGPLVAESVLNAIVDSLTMHGYQVADDPQIWCLHLQAQLRRINGERCRN
                     LGDYQFHPET"
     gene            825005..825493
                     /locus_tag="PPUBIRD1_RS03685"
                     /old_locus_tag="PPUBIRD1_0723"
     CDS             825005..825493
                     /locus_tag="PPUBIRD1_RS03685"
                     /old_locus_tag="PPUBIRD1_0723"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1IF21.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_003247486.1"
                     /db_xref="GI:489340306"
                     /translation="MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEVVHVLPN
                     VFALSEADLILVILSLIDMSLVGGLLVMVMISGYENFVSQLDIDESKEKLNWLGKMDS
                     SSLKMKVAASIVAISSIHLLRVFMDAQNISTDYLMWYVIIHMTFVVSAFCMGYLDKLT
                     KH"
     gene            825710..826015
                     /locus_tag="PPUBIRD1_RS03690"
                     /old_locus_tag="PPUBIRD1_0724"
     CDS             825710..826015
                     /locus_tag="PPUBIRD1_RS03690"
                     /old_locus_tag="PPUBIRD1_0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011532164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_014589631.1"
                     /db_xref="GI:504402529"
                     /translation="MNLHQLNTEARAGHVDELNLIAIEGGDYLLEARVKGHPHPLSDT
                     RGERLRVHSVEDARKLLQTIPMVSMNLVHWSVQDEMCGMGTHPEEDLKVPISQRSAW"
     gene            826101..826718
                     /locus_tag="PPUBIRD1_RS03695"
                     /old_locus_tag="PPUBIRD1_0725"
     CDS             826101..826718
                     /locus_tag="PPUBIRD1_RS03695"
                     /old_locus_tag="PPUBIRD1_0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017905390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_003247482.1"
                     /db_xref="GI:489340302"
                     /translation="MSELNLSTDETRVSYGIGRQLGGQLRDNPPPGVSLEAILAGLTD
                     AFNGADSRVSEADLSASFKVIREVMQAEAAAKAEAAAAAGKEFLVENAKREGITTLAS
                     GLQFEVLTAGEGAKPTREDNVRTHYHGTLIDGTVFDSSYERGQPAEFPVGGVIAGWTE
                     ALQLMNAGSKWRLYVPSELAYGAQGVGSIPPHSVLVFDVELLDVL"
     gene            complement(826745..826990)
                     /locus_tag="PPUBIRD1_RS03700"
                     /old_locus_tag="PPUBIRD1_0726"
     CDS             complement(826745..826990)
                     /locus_tag="PPUBIRD1_RS03700"
                     /old_locus_tag="PPUBIRD1_0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016713350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951938.1"
                     /db_xref="GI:499254398"
                     /translation="MTYLIDAWLERPHPYLRILHRETGEVCAVLEEEALDELRDQGDL
                     DMSGLNSSEPGVLKELVRNLFLFCYARALRPGGTDWN"
     gene            complement(827075..827416)
                     /locus_tag="PPUBIRD1_RS03705"
                     /old_locus_tag="PPUBIRD1_0727"
     CDS             complement(827075..827416)
                     /locus_tag="PPUBIRD1_RS03705"
                     /old_locus_tag="PPUBIRD1_0727"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016484830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_010951939.1"
                     /db_xref="GI:499254399"
                     /translation="MSTLPPCPKCNSEYTYEDGTQLICPECAHEWSASGDAEAASDDV
                     VKKDSVGNILQDGDTVTVIKDLKVKGSSLVVKVGTKVKNIRLCDGDHDIDCKIDGIGA
                     MKLKSEFVRKV"
     gene            complement(827576..828544)
                     /locus_tag="PPUBIRD1_RS03710"
                     /old_locus_tag="PPUBIRD1_0728"
     CDS             complement(827576..828544)
                     /locus_tag="PPUBIRD1_RS03710"
                     /old_locus_tag="PPUBIRD1_0728"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019332742.