GenomeNet

Database: RefSeq
Entry: NC_017630
LinkDB: NC_017630
Original site: NC_017630 
LOCUS       NC_017630             114550 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Escherichia coli UM146 plasmid pUM146, complete sequence.
ACCESSION   NC_017630
VERSION     NC_017630.1  GI:386602509
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00017915
            Assembly: GCF_000148605.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli UM146
  ORGANISM  Escherichia coli UM146
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Complete genome sequence of adherent invasive Escherichia coli
            UM146 isolated from ileal Crohn's disease biopsy tissue
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2010) Research and Testing Laboratory, 4321
            Marsha Sharp Fwy, Lubbock, TX 79407, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 11/28/2014 15:17:38
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 5,082
            CDS                          :: 4,824
            Pseudo Genes                 :: 147
            CRISPR Arrays                :: 2
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 84
            ncRNA                        :: 5
            Frameshifted Genes           :: 126
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..114550
                     /organism="Escherichia coli UM146"
                     /mol_type="genomic DNA"
                     /strain="UM146"
                     /db_xref="taxon:869729"
                     /plasmid="pUM146"
     gene            complement(<1..199)
                     /locus_tag="UM146_RS24710"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
     CDS             complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001382804.1"
                     /note="with Hns involved in transcriptional regulation of
                     hemolysin; non-specific DNA-binding protein which affects
                     the production of multiple proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gene expression modulator"
                     /protein_id="WP_014639534.1"
                     /db_xref="GI:504452432"
                     /translation="MAKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLXXSERESFNSAA
                     DHRLAELITGKLYDRIPKEIWKYVR"
     gene            complement(492..953)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
     CDS             complement(492..953)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q7BSX4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_001233843.1"
                     /db_xref="GI:447156587"
                     /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKAVR
                     IRLINIDAPEKKQDYGRWSTXMMKSLVAGKTVTVTYFQRDRYGRILGQVYAPDGMNVN
                     QFMVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     gene            complement(1152..1394)
                     /locus_tag="UM146_RS24725"
     CDS             complement(1152..1394)
                     /locus_tag="UM146_RS24725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000619928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000619928.1"
                     /db_xref="GI:446542582"
                     /translation="MIRKTPGYGATGRSDAGLSGWKSGGTGREPLRHGYGLRSLLPGQ
                     TGSSLPEKGLNTATGAAGEGCNEKAAFITPGIQKAE"
     gene            complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
     CDS             complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020246019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein FinO"
                     /protein_id="WP_000139321.1"
                     /db_xref="GI:446061466"
                     /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELTAKKAQARQALSIYLNLPSLDEAVNTLKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEV
                     YAAERLDKIRRQNRIKAELQAVLDEQ"
     gene            complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
     CDS             complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001500153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000704523.1"
                     /db_xref="GI:446627177"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPC
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKIPFLTVMETLQYKPAESAA
                     KVQCPVLIVIAGQDSVNPPEQGKALYDAVASGTKELYEEADACHYDIYEGAFFERVAA
                     VQTQWFKKHL"
     gene            complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
     CDS             complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000205715.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraX"
                     /protein_id="WP_000205724.1"
                     /db_xref="GI:446127869"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSXRLYRAEDRAERLALXACLLAVIPALNLAXSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPVFYACHLAVLGVLAL"
     gene            complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
     CDS             complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001402905.1"
                     /note="cleaves origin of transfer and unwinds; oriT
                     relaxase; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraI"
                     /protein_id="WP_000948350.1"
                     /db_xref="GI:446871094"
                     /translation="MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQ
                     GSVDKDVFTRLLEGRLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRL
                     IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQDPQLHTHV
                     VVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEIRMAE
                     WMQTLKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQF
                     TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
                     RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
                     ELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMVFTPGSTVIVD
                     QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
                     PATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
                     GHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
                     LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASV
                     SEDAMTVVVPGRAEPAXLPVSDSPFTALKLENGWVETPGHSVSDSAXVFASVTQMAMD
                     NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETSLETAISLQ
                     KTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINAQIKR
                     GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSG
                     QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAV
                     GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
                     AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVXIMKEIVRQTPELREAVYXLINR
                     DVERALSGLESVKPSQVPRXEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGETFPDV
                     PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGQEQVMVP
                     VLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLIS
                     PREAVAEGVTLYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
                     QTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVAL
                     SRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVLEPKPDREVMNAQRLFSTARELRDV
                     AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
                     GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
                     GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
                     VRKMAENKPDLPDGKTELAVRDIAGQERDRSAISERETALPESVLRESQREREAVREV
                     ARENLLQERLQQMERDMVRDLQKEKTLGGD"
     gene            complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
     CDS             complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000009375.1"
                     /note="type IV secretion system coupling protein; similar
                     to F plasmid TraD; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="WP_000009377.1"
                     /db_xref="GI:445931522"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILXGLX
                     LWVKISWQTFXNGCIYWWCTXLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMI
                     WCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVA
                     RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
                     YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
                     YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQARP
                     KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPVS
                     SVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
                     HPDIQQHMQRREEVNINVHRERGEDVEPGDDF"
     gene            complement(11352..12089)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
     CDS             complement(11352..12089)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016831975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000199902.1"
                     /db_xref="GI:446122047"
                     /translation="MTSDNIAEYVGENNQFTEKPVTEYPPVIQDNTVTTKDYLYSNNI
                     DTDLLVVIGGLIVILFLMMLIMYFINSLRHKELTEILEKISFPEKSGSNLLKPEAVSC
                     NLLSLCVLAPVLCTPRKLAEVSREIIVASAQEIAWTPGSSRIDGHQGENITWSLSSQS
                     PADKYDLINKTSXVSPDSGRFYEPDTVLDHRERVRLFIQIQFPHGSDWSEVLRLTDIV
                     TEKVSSGRXAGGXHHRHTGYTWSVSVN"
     gene            complement(12292..13023)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
     CDS             complement(12292..13023)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000782452.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraT"
                     /protein_id="WP_000782451.1"
                     /db_xref="GI:446705105"
                     /translation="MKMKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIW
                     LEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKAD
                     KMDLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVE
                     DVNYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
                     KVNLKFEEAKPVLEDQLAKSIANIL"
     gene            complement(13072..13551)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
     CDS             complement(13072..13551)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001403425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001363115.1"
                     /db_xref="GI:485735884"
                     /translation="MRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLFIW
                     LFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCVSV
                     REWMQSQVNEQTNEDLHLDFDNMDFHRTNPATGLPMSGIGVDIGGNSYGYSSKRYDE"
     gene            complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
     CDS             complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001007014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_001007080.1"
                     /db_xref="GI:446929824"
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMGTRTWDSIEKIALTLSVLAV
                     AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
                     SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDY
                     VQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLK
                     DKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNV
                     TINALKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPV
                     VLSEISQIQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTAS
                     AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
                     SGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQFGSNRG
                     SSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRTSAGMY
                     GDAHAEWGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
                     AEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFV
                     QEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
                     VKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSA
                     QERMPGADSPQELMKRAKEYQDKYKQ"
     gene            complement(16392..17765)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
     CDS             complement(16392..17765)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001309243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_000944329.1"
                     /db_xref="GI:446867073"
                     /translation="MLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQ
                     PGVWQGQAAGYAYGGSLYARTQVKNIQLISMTLPDINAGCGGIDAYLGSFSFINGDQL
                     QRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQKMASDINSMNLSSCQVAQGIVGG
                     LFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKASDKDKERVLKNI
                     NIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGG
                     TAKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTIIQNKAVSDTPLDDREKGF
                     ISSTTVPVFKYLIDPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYP
                     QTVLDSVLENLNQAQQQIAVFQGQVKVQQDALLVVDRQMSYMRQQLSARMLSRYQNNY
                     HFGGSTL"
     gene            complement(17752..18162)
                     /locus_tag="UM146_RS24780"
     CDS             complement(17752..18162)
                     /locus_tag="UM146_RS24780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016230912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbF"
                     /protein_id="WP_041031481.1"
                     /db_xref="GI:751480740"
                     /translation="MSEETYNERKRNDAELKNRKTKRDYDYERRVSDIYFDLFFVFVA
                     AGTFLWVIMHSIFDACIDSWKADPELNNFRYMWNILMYVIPYTLWAFAGGFLIVYVRN
                     PLNELINGGIRIFRLKRRMRRENKLREGGNNASH"
     gene            complement(<18130..18411)
                     /locus_tag="UM146_RS24785"
     CDS             complement(<18130..18411)
                     /locus_tag="UM146_RS24785"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001244900.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041031482.1"
                     /db_xref="GI:751480741"
                     /translation="MRNKQVVLLIAGISGIATGIIVSLNIPFIRQGLFYPASPVEIVV
                     SLCLTFSVSVVFFVGAIVGWISVSEIYYSRMNGLNESSEISEETYNERKR"
     gene            complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
     CDS             complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000059825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="WP_000059830.1"
                     /db_xref="GI:445981975"
                     /translation="MSLTKLLPVILLMMATGVQASTRDEIERLWNPQGMAVQPAQPAA
                     DTSARTEKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSV
                     FPYTLDGQGDTAFPEALPVPPDVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDA
                     ASFMARMDTVLQMYGEEKGAK"
     gene            complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
     CDS             complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001617873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraQ"
                     /protein_id="WP_000624160.1"
                     /db_xref="GI:446546814"
                     /translation="MISKXRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLA
                     ELIAAILVLFGAYQVLDAWIARVSLEEREALEARQQAMMEGQQEGGHVSH"
     gene            19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
     CDS             19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000736414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin ArtA"
                     /protein_id="WP_000736414.1"
                     /db_xref="GI:446659068"
                     /translation="MKKLSFKEKLEIVRNIIRESLSGNAAFALLVYSLLHSLPIKTFA
                     DLFVTILLFIAIIAVVIWLFLIIYVYFCELFRSHWIAVWFILWSVVINLTIGFGIYDK
                     LAPVISLMK"
     gene            complement(19969..20712)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
     CDS             complement(19969..20712)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001030376.1"
                     /note="type IV secretion system pilus assembly protein;
                     similar to F plasmid TraF; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_001030404.1"
                     /db_xref="GI:446953148"
                     /translation="MNKALLPLLLCCFIFPASGKDAGWQWYNEKIXPKEKENKPVPAA
                     PRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKA
                     MLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQL
                     AQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGS
                     VRPLSYGFISQDDLAKQFLNVSEDFKPNF"
     gene            complement(20705..20962)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
     CDS             complement(20705..20962)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000864342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="WP_000864334.1"
                     /db_xref="GI:446787078"
                     /translation="MKVIFTSNRFIDFLIRLLITAXVISPVIIWSWDTVKETTADGXL
                     AAAFVILYSGVLLFILYFCFSALTDLQKTDERKXDERNEDE"
     gene            complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
     CDS             complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001403430.1"
                     /note="TraN; TrhN; involved in stabilizing mating pairs
                     during plasmid conjugation; F plasmid TraN appears to
                     recognize OmpA in the recipient cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraN"
                     /protein_id="WP_000821853.1"
                     /db_xref="GI:446744597"
                     /translation="MKRILPLILALVAGMAQADSNSDYRAGSDFARQIQGQGTGSIQG
                     FKPQESIPGYNANPDETKYYGGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKD
                     ILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRSEFTNYTCERDTMVEEYCTRT
                     ASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLSVYAAFFFL
                     NSRYTFMNTTFNVGLANGQSDTYPLSGATGLQVTQGQVLTGSGCTANGNCLPHGNGDR
                     KVYESLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKT
                     GVMEGKPWNITQACWAYRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLH
                     EYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAEAVSQLAALAAAGKDVA
                     ALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLT
                     VSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHPDCRGIT
                     VDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ"
     gene            complement(22836..23474)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
     CDS             complement(22836..23474)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001311050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbC"
                     /protein_id="WP_001080252.1"
                     /db_xref="GI:447002996"
                     /translation="MNRKIFALFALTAGMHLAVHASENVNTPENRQFLKQQENLSRQL
                     REKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPE
                     EGLKRMLXETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFSQYGI
                     RSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK"
     gene            complement(23483..23788)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
     CDS             complement(23483..23788)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001505125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000224418.1"
                     /db_xref="GI:446146563"
                     /translation="MATMDSKYIQHLRKISAVLLRLISRTLKLFPFGLVMVPVILFYF
                     APDSFLAEIIHEWKKADISEQVTLVRLYLKVTFTCAFMAVFLNYLFSDEFMPVNSRK"
     gene            complement(23818..24811)
                     /locus_tag="UM146_RS24830"
                     /note="conjugal transfer protein TraU; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
     CDS             complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001203746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraW"
                     /protein_id="WP_014639537.1"
                     /db_xref="GI:504452435"
                     /translation="MRCRGLIALLIWGQSVXAADLGTWGDLWPVKEPDMLTVIMQRLT
                     ALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYXSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQXLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEM
                     QKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
     gene            complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
     CDS             complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000156733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="WP_000214087.1"
                     /db_xref="GI:446136232"
                     /translation="MTTTQKTTDVTAPRRSHWWWTVPGCLAMVLLNAAXSYGIVRLNA
                     PVTAAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     gene            complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
     CDS             complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001064255.1"
                     /note="similar to VirB4; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraC"
                     /protein_id="WP_000069779.1"
                     /db_xref="GI:445991924"
                     /translation="MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRL
                     LPYRDYNQESGLFMNDTTMGFMLEAIPINGANKSIVEALDHMLRTKLPRGIPLCIHLM
                     SSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYR
                     VFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVGEMINHNP
                     DSLYPKRRQLDPYSDLNYQCVEDSFDLXVRADYLTLGLRENGRNSTARILNFHLARNP
                     EIAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTS
                     YAKWFPSVEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSF
                     RKNGFELISPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADN
                     PLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSG
                     GFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPN
                     GNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMI
                     VLLDQYTANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENR
                     MYRTPRTLKKLNVIDEGWRLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDS
                     DKASSAARAAWGNSSYKIILKQSAKEFAKYNQLFPDQFQPLQRDMIGKFGAAKDQWFS
                     SFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRXEGXSIHEAVWQLAWKKSG
                     PEMASLEAWLEEHEKYRSVA"
     gene            complement(29117..29590)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
     CDS             complement(29117..29590)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000549572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000549566.1"
                     /db_xref="GI:446471712"
                     /translation="MHKSEAEKIDSILDEHQQIYRRHNQINNILAYCACIAWIPCIIA
                     AFGVDGIYLKILFAVLACCGAVCFFIFFFTLLPESLMVLSRQSLLQLMRLTEDVPDAR
                     QELLNRLLSGKKLTGRDEQDIRRLWQEKVDAMQESATRQREQDTIRKFTEGNKSE"
     gene            complement(29583..29804)
                     /locus_tag="UM146_RS24855"
                     /old_locus_tag="UM146_24186"
     CDS             complement(29583..29804)
                     /locus_tag="UM146_RS24855"
                     /old_locus_tag="UM146_24186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001483197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraR"
                     /protein_id="WP_001278694.1"
                     /db_xref="GI:447201438"
                     /translation="MSDEADEAYSVTEQLTMTGINRIRQKINVHGIPVYLCEACGNPI
                     PEARRKIFPGVTLCVECQAYQEKQRKHYA"
     gene            complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
     CDS             complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016233168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraV"
                     /protein_id="WP_000809889.1"
                     /db_xref="GI:446732633"
                     /translation="MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANE
                     KAKKLEQPADAKPAAASLPRLAEGNFRTTTVRAVTAASPSGSGPVVTALPEQKLLAPR
                     PLFTAAREVKTIIPVSSVASVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVI
                     KPSAWGKPRIN"
     gene            complement(30451..30684)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
     CDS             complement(30451..30684)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000235791.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
                     /protein_id="WP_000235791.1"
                     /db_xref="GI:446157936"
                     /translation="MATSKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSS
                     RNTVFENPDIVKTCTVRDLKXDFVNCDEKGEGQ"
     gene            complement(30696..31016)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
     CDS             complement(30696..31016)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001462162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbD"
                     /protein_id="WP_001057274.1"
                     /db_xref="GI:446980018"
                     /translation="MNMRNINAITALSVPGKTMSDDFMHAVLSNCTTRIVLPAPKEFS
                     SESLPHNFNMAAVGVMKEGMSMRLFSSPGHIVVAGQFGGGKSASVKELIDRIIQKYKE
                     PFDE"
     gene            complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
     CDS             complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000968229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraP"
                     /protein_id="WP_000002787.1"
                     /db_xref="GI:445924932"
                     /translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMA
                     LFVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQDICHYRAA
                     DAADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLK
                     EVYTEDASLPGKIRKCPVYLPDDRTNRNNGDKNEHA"
     gene            complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
     CDS             complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012881130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_000146665.1"
                     /db_xref="GI:446068810"
                     /translation="MASINTIVKRKQYLWLGIVVVGAASAIGGVLYLSDVDMSGNGEA
                     VAEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDD
                     QRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPP
                     QGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGTSLPYIPSGS
                     FAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSS
                     ERAIVRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDG
                     IGQGMERASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIP
                     IGAGNEVTVVFQDGFQLKTVEEMALERTQNRAEEDNPESPVPVPPSAESHLNGFNTDQ
                     MLKQLGNLNPQQFMSGSQGGGNDGK"
     gene            complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
     CDS             complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001352843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraK"
                     /protein_id="WP_001340581.1"
                     /db_xref="GI:485707951"
                     /translation="MAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNS
                     LDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDL
                     RGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADA
                     VWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLLAGARMDVYVIR
                     DGEGN"
     gene            complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
     CDS             complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016235958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraE"
                     /protein_id="WP_000399783.1"
                     /db_xref="GI:446321928"
                     /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNE
                     QRTAVTPMXFNXPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
                     GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     gene            complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
     CDS             complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000012107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraL"
                     /protein_id="WP_000012100.1"
                     /db_xref="GI:445934245"
                     /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIIT
                     SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     gene            complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
     CDS             complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016239104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraA"
                     /protein_id="WP_001098988.1"
                     /db_xref="GI:447021732"
                     /translation="MNTVLSVQGASAPVEKKSFFSKFTCLNMLRLVRAVIPVAVLMML
                     FPELAMAAGKGDLMAKGQETVKATFGKNSSIVKWIVLAEVLVGAVMYMMTKNIKFLVG
                     FAILSVFIAVGMSVAGF"
     gene            complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
     CDS             complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P10512.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraY"
                     /protein_id="WP_001254388.1"
                     /db_xref="GI:447177132"
                     /translation="MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIR
                     LRDHLKRFPDFYNEEIFREVIEENESTFKEL"
     gene            complement(35352..36038)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
     CDS             complement(35352..36038)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001589401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraJ"
                     /protein_id="WP_000332487.1"
                     /db_xref="GI:446254632"
                     /translation="MCALDRRERPLNSQSVNKYILNVQNIYRNSPVPVCVRNKNRKIL
                     YANGAFIELFSREDKPLSGESYIRLQVEIFLSSLELECQALGHGSAFCRRFNFHGEIY
                     QIRMENVSFYNDESVVLWQINPFPDYPFFALNQSGSNTNTSDKLTIWNDLSPGTLVVF
                     SFYMLGVGHATIARELGITDRASEDRIKPVKRKIKEFFEHFDLFRVSCIYKGEIDSLL
                     SIIREFYGVK"
     gene            complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
     CDS             complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001151562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="WP_001151562.1"
                     /db_xref="GI:447074306"
                     /translation="MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLE
                     LGLRVHEAQMERKESAFNQAEFNKVLLECAVKTQSTVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIRDKVSSEMERFFPENDEE"
     gene            37039..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
     CDS             37039..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P47737.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_000759167.1"
                     /db_xref="GI:446681821"
                     /translation="MKKWMLAICLMFINEICQATDCFDLAGRDYKIDPDLLRAISWKE
                     SRYRVNAIGINPVTGYGSGLMQVDSQHFNELDRYGIKPEHLTTDPCMNIYTGAYYLAI
                     AFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYRIYTGIKSSKGIRIPVTKKSL
                     PEINSVQNN"
     gene            complement(37845..38666)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
     CDS             complement(37845..38666)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001234456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001234492.1"
                     /db_xref="GI:447157236"
                     /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERY
                     TYIPTINIINKLRDEGFQPFFACQSRVRDLGRREYSKHMLRLRREGNINGQEVPEIIL
                     LNSHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIVGQVIEGAYEVLGVFD
                     KVTXNMEXMKEIHLNSDEQHLFGRAALMXRYEDENKTPVTPEQIITPRRREDKQNDLW
                     TTCQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWKS"
     gene            complement(38785..39072)
                     /locus_tag="UM146_RS24930"
     CDS             complement(38785..39072)
                     /locus_tag="UM146_RS24930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001513506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000107526.1"
                     /db_xref="GI:446029671"
                     /translation="MSTRNIHVNTASYTILVAGREKNTGEEWDVLEFSSLTELKKYRK
                     SHPEKMAFSYSYALSRGVDTQFRHINIAEADHFKQFLRQIKRAGLDIRAIC"
     gene            complement(39097..39216)
                     /locus_tag="UM146_RS24935"
     CDS             complement(39097..39216)
                     /locus_tag="UM146_RS24935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001496299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001127499.1"
                     /db_xref="GI:447050243"
                     /translation="MPLAAKVLKQVMVNTGGNKRQVPAKRQNRGSRNSTDDGG"
     gene            complement(39299..39493)
                     /locus_tag="UM146_RS24940"
     CDS             complement(39299..39493)
                     /locus_tag="UM146_RS24940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001500139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_032140920.1"
                     /db_xref="GI:692947029"
                     /translation="MACAPGIPAKGRRDVRRNAVSQTVLHVVAAGPCPLLCPVPFTCL
                     SPCRRGLIQPQPAALTVQGK"
     gene            39416..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
     CDS             39416..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012896899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012896899.1"
                     /db_xref="GI:502660848"
                     /translation="MKHGLRNGVAPYIPAAFCRDARSAGHGATEAARPERSLQARGFA
                     SGMEARQGGDSFAGSVHDSPPRQGDARKRHKQENNKTDNNQGSSNQSQSSNQSQSRRK
                     KRIIKGKVM"
     gene            complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
     CDS             complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014063856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001302184.1"
                     /db_xref="GI:485658258"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
                     FMAYESGK"
     gene            40190..>40406
                     /locus_tag="UM146_RS24955"
                     /note="protein sok; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(40422..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
     CDS             complement(40422..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016233040.1"
                     /note="PsiA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_001276243.1"
                     /db_xref="GI:447198987"
                     /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRHQGNTLAEYPYAGAF
                     FRCLNGSRRISLSDLRFFMPSLTAEELHGXRLQWLYAIDVLIETQGEVCLLPLPGDAA
                     ERLFPSVRFXVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
                     TVGSWHARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKE
                     AGHAVREMERWMVPNKLREVA"
     gene            complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
     CDS             complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015675404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_000845910.1"
                     /db_xref="GI:446768654"
                     /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDERRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     gene            complement(41627..43585)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
     CDS             complement(41627..43585)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001317531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001145500.1"
                     /db_xref="GI:447068244"
                     /translation="MPVTKCEPETTRKASRKYAKTQETVLSALLAQTEEVSVPLASLI
                     KSPLNVRTVPYSAESVSELAESIKGVGLLQNLVVHTLPGDRYGVAAGGRRLAALNMLA
                     ERGIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
                     DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQ
                     SGWGGKPDVRVIRNLITESEVAVAGNSKFRFVGADAFSPDELRTDLFSDDEGGYVDCV
                     ALDAALLEKLQAVAEFLREAEGWEWCAGRMEPVGECREDAGTYRCLPEPEAVLTEAEE
                     ERLNELMARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGGGVVVSWCYGNV
                     CVQRGVQLRSEDDAADDADRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQPD
                     KSLTLLAWTLCLNVFGSGAYSKPAQISLECKHYSLTSDAPSGKEGAAFMALMAEKARL
                     AALLPEGWSRDMTTFLSLSQEVLLSLLSFCTACSLNGVQTREYGHTSRSPLDTLESAI
                     GFHMRDWWQPTKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKD
                     NRWVPGWMCAPRPQTDATERTDNLADAA"
     gene            complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
     CDS             complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000006014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000006018.1"
                     /db_xref="GI:445928163"
                     /translation="MSEYFRILQGLPDGSFTREQAEAVAAQYRNVFIEDDQGTHFRLV
                     VRNNSGLVWRTWNFEDGAGYWMNHVIRNFGILK"
     gene            complement(43934..44461)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
     CDS             complement(43934..44461)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000290787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_000290833.1"
                     /db_xref="GI:446212978"
                     /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDK
                     QTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTMQMLGSAPQQNAQVQPQPQQNGQPQSADATKKGSAKTKGRGRKAAQPEPQPQ
                     PPEGEDYWFSDDIPF"
     gene            44763..45221
                     /locus_tag="UM146_RS24985"
                     /old_locus_tag="UM146_24301"
     CDS             44763..45221
                     /locus_tag="UM146_RS24985"
                     /old_locus_tag="UM146_24301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011478091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014639539.1"
                     /db_xref="GI:504452437"
                     /translation="MAPDXTTGRDPPQRREARFAKRRCALHPGGLLPGCQELRPRRDR
                     GGATEAARPERSLQAGGFASGMEARQGGDSSAGSVHDSPPRQGDARKRHKQENNKTDS
                     NQSSRKKKNSSSSSSSSSSRNNNIISNRQMTGLKRQKPPSERPRNERGGA"
     gene            complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
     CDS             complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001332335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001298559.1"
                     /db_xref="GI:485653429"
                     /translation="MHSQLRERIRLMRARLDNAAPVAEIRAESQLFVSPAPICDRLVT
                     LAEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCG
                     DFMEWQSVQYYSRIIMNPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLP
                     FSDVREELPRGTFAYTDVPTMIIRLRA"
     gene            complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
     CDS             complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000170658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_000170697.1"
                     /db_xref="GI:446092842"
                     /translation="MTLAAITMTAPEAASPVQMYRATYSPDDNKLRLYAASRLDPETY
                     KKVHDAGFRWAPXQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGY
                     SGKRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFER
                     AEYWEERARSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLD
                     LNMAKLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRC
                     HERQIQHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVN
                     KSNGAVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPG
                     EGFREMTKAQWAALPRDCKAVRSVEEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEI
                     PQK"
     gene            complement(47330..47560)
                     /locus_tag="UM146_RS25000"
     CDS             complement(47330..47560)
                     /locus_tag="UM146_RS25000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000155844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000155844.1"
                     /db_xref="GI:446077989"
                     /translation="MTISIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIAR
                     SFHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
     gene            complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
     CDS             complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016238862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001027516.1"
                     /db_xref="GI:446950260"
                     /translation="MNISTETREILRNYRAVINARRREMGQKPLTTAQIVDEICDFVA
                     NQQAVFLGGHYILQGSRNR"
     gene            complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
     CDS             complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000271689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000271708.1"
                     /db_xref="GI:446193853"
                     /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTD
                     DELETVMQRLDDAFVYGACDRVVSDIVNELMEEKRASRHVTVPAVMLEKVMALAGSEM
                     KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     gene            complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
     CDS             complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001198918.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein YubI"
                     /protein_id="WP_001198903.1"
                     /db_xref="GI:447121647"
                     /translation="MQYAKPVTLNVEECDRLSFLPYLFGLDFLYAEASVYTLAKKMMP
                     EYEGGFWHFIRLPDGGGYMMPDGDRFHLVNGENWFDRTVSADAAGIILTSLVINRQLW
                     LYHDSGDAGLTHLYRMRDAQLWSHIEFHPECNAIYAALD"
     gene            complement(50020..50790)
                     /locus_tag="UM146_RS25020"
                     /old_locus_tag="UM146_24341"
     CDS             complement(50020..50790)
                     /locus_tag="UM146_RS25020"
                     /old_locus_tag="UM146_24341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001462092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001007109.1"
                     /db_xref="GI:446929853"
                     /translation="MNEXLNALIYRHASNLLLAQGWPEETDVDQRNPKYPGWISIYVR
                     LDAPRLATLLIXRHGGVLPPLLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
                     PYAGEWLAEDEIRAVLGAVRDAVCSVSYQVAEDARRIRAALTTTGQTLLTRQTRRFRL
                     VVKESDHPCWLDEDDENLPVVLDAILNRGARFSSVEMYLVSECVEHILSSGLACDMLR
                     IPDEPPRRWFDRGVLREVVREARNEIRSMADXLAKIRK"
     gene            complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
     CDS             complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001562898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000274516.1"
                     /db_xref="GI:446196661"
                     /translation="MYGTCETLCRXLAAKYXGDTPLMLVIWSPEEIQALXDGMDIXLX
                     DHEIRTVLARLEDIPEDQRTESGISSGXAMEIINNVXENRQVTVPAELLASLIQTAEQ
                     ALWKREWAAXDHGLAVPECVTRRQAVVNQVRILLKNNTHEND"
     gene            complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
     CDS             complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001104874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001104873.1"
                     /db_xref="GI:447027617"
                     /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
                     LTRQTLYRANRLFMEAYTEILELDSCFKD"
     gene            complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
     CDS             complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000086154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylase"
                     /protein_id="WP_000086169.1"
                     /db_xref="GI:446008314"
                     /translation="MSRFVLGNCIDVMARIPDNAIDFILTDPPYLVGFRDRSGRTIAG
                     DVNDDWLQPASNEMYRVLKKDALMVSFYGWNRVDRFMAAWKRAGFSVAGHLVFTKNYT
                     SKSAYVAYRHECAYILAKGSPARPRNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DNWFEPEAA"
     gene            complement(52264..52575)
                     /locus_tag="UM146_RS25040"
     CDS             complement(52264..52575)
                     /locus_tag="UM146_RS25040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014640311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310011.1"
                     /db_xref="GI:485668905"
                     /translation="MKYDGDGRATARFFSGKGCRRAPLFTAPADAARHKRCLWSVSRV
                     RWARDGRFYRSRLASVTVYASLSPFSDERPSSRFRGIALPSERRRLRYSTVGLTRYRT
                     R"
     gene            complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
     CDS             complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001298677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001298677.1"
                     /db_xref="GI:485653556"
                     /translation="MLGGADNPNGELPSYITGADSWQLYERGELVDVLWGELEWSSPT
                     DDDELPEVTGPAWIVDNVAHYGG"
     gene            52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
     CDS             52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005147430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_000952372.1"
                     /db_xref="GI:446875116"
                     /translation="MLSREDFYMIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRAC
                     RPRRARTKGKVERMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKET
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSRDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRIYSNEKLVASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
     gene            53988..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
     CDS             53988..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012602155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_000544830.1"
                     /db_xref="GI:446466976"
                     /translation="MHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQ
                     EWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVIL
                     LGPPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYAR
                     VLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAIL
                     DRLLHHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVKSGQHQ"
     gene            complement(54779..55633)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
     CDS             complement(54779..55633)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001134351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001134351.1"
                     /db_xref="GI:447057095"
                     /translation="MPNWCSNRMYFSGEPAKIAEIKRLASGAVTPFYRRATNEGIQLF
                     LAGSAGLLQTTEDVRFEPCPGLTAAGRGVLSPENITFTRWLKHLQDGVLLDEQNCLML
                     HELWLQSGTGQRRWEGLPDDVRETITVHFTAKRGDWCDIWGNEDVSVWWNRLCDNVLS
                     EKTMPFDLLTVLPTRLDIEVNGFNGGVLNGVPSAYHWYTERYGVKWPCGYDLNISSQG
                     ENFIQVDFDTPWCQPESDVVAELSRRFGCTLEHWYAEQGCNFCGCVNATMFDRYLPFS
                     CPLRYFRY"
     gene            complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
     CDS             complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000343765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000343766.1"
                     /db_xref="GI:446265911"
                     /translation="MDEKSLYAHILNLTAPWQVKSLTLDENAGSVTVTVGIAENTQLT
                     CPTCRKSCSVHDHRHRKWRHLDTCQFMTLVEADVPRVMCPEHGCQTLPVPWAGSGSRY
                     TLLFESFVLSWLKISTVDAVRKQLKLSWNAVDGIMTRAVKRGLSRIKKPLSVRHMNVD
                     EVAFKKGHRYITVVSDRDGRALALTDDRGTESLASYLRSLTDSQLLAIKTLSMDMNAG
                     YIRAARIHLPNAVEKIAFDRFHVAKQLGEVVDKTRQNEHPHLPVESRRQAKGTRFLWQ
                     YSDKWMTESRQEKLMWLREQMQQTSQCWTLKELAKNIWDRPWSTERRNDWLQWISRAS
                     ECDVPMMKNAAKTIKKRLYGILNAMRHRVSNGNAEALNSKIRLLRIKARGYRNRERFK
                     LGVMFHYGKLNMAY"
     gene            complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
     CDS             complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000115885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000115885.1"
                     /db_xref="GI:446038030"
                     /translation="MSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKG
                     TEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL
                     SYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRL
                     RKWAKNNNISLK"
     gene            57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
     CDS             57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001697964.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein impC"
                     /protein_id="WP_000619112.1"
                     /db_xref="GI:446541766"
                     /translation="MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRID
                     QGSAPSVSVTGARNDKGKERIQSLLEEIWQDDSWLPAA"
     gene            58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
     CDS             58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000109072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein impA'"
                     /protein_id="WP_000109079.1"
                     /db_xref="GI:446031224"
                     /translation="MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDL
                     NSYCISRPAATFFLRTSGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKR
                     LLLRPRPALEPVSDSPEFRTLYPENICIFGIVTHVIHRTRELR"
     gene            58602..59873
                     /locus_tag="UM146_RS25085"
                     /note="protein ImpB; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(59878..60270)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
     CDS             complement(59878..60270)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000340835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000340835.1"
                     /db_xref="GI:446262980"
                     /translation="MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAF
                     ISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRTVLTELGASQ
                     SVEKMPPSATDSVQEAMNDVRLKMKKLF"
     gene            complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
     CDS             complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001505082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001103694.1"
                     /db_xref="GI:447026438"
                     /translation="MNVYCDDGSTTIKLAWNDNGKICKSLSQNSFRHGWKVDGLGIRQ
                     TFNYELDGKKYTYDEVSNQSILTTHIEYQYTDVNLLAVHHALLNSGLAPQPVSLTVTL
                     PISEFYTKECQKNELNIQRKIENLMRPIRLNKGDVFTIEHVDVMPESLPAVFSRLVVD
                     KVGQFEKSLVVDIGGTTLDVGVIVGQFDSVSAIHGNSGIGVSSVTKAAMSALRMASSD
                     TSFLVADELIKRRNDPDFVRQVINDETKTDLVLNTIEGAIASLGEQVVNELGDFHHVN
                     RVYVVGGGAPLIYDSIKTAWHHLGQKVVMMESPQTALVEAIAAFKEE"
     gene            61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
     CDS             61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000633910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein ParA"
                     /protein_id="WP_000633911.1"
                     /db_xref="GI:446556565"
                     /translation="MITVVGGNKGGSGKTTIASNLAIALANKGREVCLLNGDLQRTAA
                     KHHAEREAAGLLPAITLVEKFDNLTQTLQALNEKFDDVIVDVAGRNSKEFITSGVVAH
                     QIIAPLQCSQPDLDTLTELEQQIDAMRNLNPELKVYCLQSMATTNPVLRGNERKEFLE
                     YLEEFPTIQVLDSVICFRKVYRDCMSNGTGVVETNNTAAKAEIEHLMNEVFGPW"
     gene            62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
     CDS             62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000241708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000239529.1"
                     /db_xref="GI:446161674"
                     /translation="MVKKPSQQALNRAAVTVEQAEALAQRLADKPYGAPEKPEPEKQC
                     RTTISLGESMLVTIEDLALRNKRNGKDPKNVSAIVRVALEQYLKTLT"
     gene            complement(62526..63334)
                     /locus_tag="UM146_RS25110"
                     /note="resolvase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
     CDS             complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001310014.1"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_001159871.1"
                     /db_xref="GI:447082615"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     gene            complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
     CDS             complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000829079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pirin"
                     /protein_id="WP_000813634.1"
                     /db_xref="GI:446736378"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     KAENQEGMAEVARFIEMNGSFADENRDW"
     gene            66182..66823
                     /locus_tag="UM146_RS25125"
     CDS             66182..66823
                     /locus_tag="UM146_RS25125"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q1R1Y6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000990667.1"
                     /db_xref="GI:446913411"
                     /translation="MNADTWTRLQAFRHALELTSCEASLTAGYDHLKDFPAGCSELAS
                     QTLTDYLTEDGSNLYSCIVGMQWDNGPGRYGHVIADPARDYIDLTLDQFPGYHNRIVA
                     EPVESGGQLAADLNREPAISTADGIVASPSDKVNYITEQKNRQPMVIITECYKLIRMT
                     ARFIPMCQSSQLFQHQVFPRLFIISDVGSCSLFRNTLDRLATDWKVTLSILSL"
     gene            67251..67687
                     /locus_tag="UM146_RS25130"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            67834..68004
                     /locus_tag="UM146_RS25135"
     CDS             67834..68004
                     /locus_tag="UM146_RS25135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001365563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322640.1"
                     /db_xref="GI:485688520"
                     /translation="MVSTPDSVVKYRLQVFLQSVDGVLTHDFLFILLLSTGRRLSGKR
                     KFRHQKTVRRGG"
     gene            67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
     CDS             67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001569471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepFIB replication protein A"
                     /protein_id="WP_001309253.1"
                     /db_xref="GI:485668084"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKFFCIHYRRPR
                     LKAPNDESKENQLPPSPAEKISPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
     CDS             complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001717367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_001066947.1"
                     /db_xref="GI:446989691"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGVRPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWPVTDETMRNWLKQAV
                     KRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLK"
     gene            complement(70078..70266)
                     /locus_tag="UM146_RS25150"
     CDS             complement(70078..70266)
                     /locus_tag="UM146_RS25150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001309252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine-threonine protein kinase"
                     /protein_id="WP_001332784.1"
                     /db_xref="GI:485699419"
                     /translation="MASDTFSCRRRLSAGFFSVSACSWHYPNSPKNGKPALSPHHDWL
                     KTGSLRQNAPLRIWFYPQ"
     gene            70633..71801
                     /locus_tag="UM146_RS25155"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(73366..73557)
                     /locus_tag="UM146_RS25160"
                     /old_locus_tag="UM146_24491"
     CDS             complement(73366..73557)
                     /locus_tag="UM146_RS25160"
                     /old_locus_tag="UM146_24491"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001468867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001468867.1"
                     /db_xref="GI:485871973"
                     /translation="MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWKYRGKS
                     TSLLFRKDFSGSKQRSMPD"
     gene            complement(73515..73880)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
     CDS             complement(73515..73880)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001555068.1"
                     /note="represses IS2 gene transcription; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000567766.1"
                     /db_xref="GI:446489912"
                     /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAAS
                     QLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVE
                     YGRAKKWIAHAPLLPGDGE"
     gene            74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
     CDS             74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001555799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_001298664.1"
                     /db_xref="GI:485653542"
                     /translation="MYMNVIRNVICTLIILPIGLQAETSHSSMAKDTITVVATGNQNT
                     VFETPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVL
                     VLVDGIRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADF
                     LPPGETNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGERAP
                     NKEKPAALFAKGSVGITDSNKAGASLRLYRNNTTEPGNPTQTHGDSGLRDRKTVQNDV
                     QFWYQYAPVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFP
                     GAHQLSYGAEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDR
                     YKSFNPRAGELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRK
                     GKPNYWVPNLNLKPENNITREIGAGIQLDGLLTGNDRLQLKGGYFGTDARNYIATRVD
                     MKRMRSYSYNVSRARIWGWDMQGNYQSDYFDWMLSYNRTESMDASSREWLGSGNPDTL
                     ISDISIPVGHGGVSAGWRAELSAAATHVKKGDPHQAGYAVHSFSLSYKPVSVKGFEAS
                     VTLDNAFNKLAMNGKGVPLSGRTVSLYTRYQW"
     gene            76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
     CDS             76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020234590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_000977394.1"
                     /db_xref="GI:446900138"
                     /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNITAEIGYGHN
                     FPSKGTIPDRRNFFENPRIYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGY
                     WSRTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLS
                     DISRFSEDVKLKVLYKTSPLAGAIMELDSVSYLKSSRHTHAVEHKHPVHKAELTFVTN
                     EDGIVTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
     gene            complement(76993..77340)
                     /locus_tag="UM146_RS25180"
                     /old_locus_tag="UM146_24511"
     CDS             complement(76993..77340)
                     /locus_tag="UM146_RS25180"
                     /old_locus_tag="UM146_24511"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001529930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000855090.1"
                     /db_xref="GI:446777834"
                     /translation="MKTLSRHSELAKAFAYALNQWPALTYYADDGWAEADNNIAENAL
                     RMVSLGRKNYLFFGSDHGGERGALLYSLIGTCKLNGVEPESYLRYVLDVIADWPINRV
                     GELLPWRVALPTE"
     STS             77015..77097
                     /standard_name="RH124512"
                     /db_xref="UniSTS:161334"
     gene            complement(77669..78448)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
     CDS             complement(77669..78448)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016243248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001323403.1"
                     /db_xref="GI:485689315"
                     /translation="MMELQHQRLMVLAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
                     HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERN
                     ENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQR
                     GVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDA
                     ALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     gene            complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
     CDS             complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001582750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001310017.1"
                     /db_xref="GI:485668912"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRGFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     gene            complement(<79556..80242)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
     CDS             complement(<79556..80242)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001538071.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001512972.1"
                     /db_xref="GI:486126947"
                     /translation="MYDPAVQRPLRQTRTRKPFPESLPRDEKRLLPAAPCCPNCGGSL
                     SYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAIVQAPAPSRPIERGIAGPGLLAR
                     VLTSKYAEHTPLYRQSEIYGRQGVELSRSLLSGWVDACCRLLSPLEEALHGYVLTDGK
                     LHADDTPVPVLLPGNKKTKTGRLWTYVRDDRNAGSTLAPAVWFAYSPDRKGIHPQTHL
                     AGFSGVLQADA"
     gene            complement(80244..80501)
                     /locus_tag="UM146_RS25200"
                     /old_locus_tag="UM146_24531"
     CDS             complement(80244..80501)
                     /locus_tag="UM146_RS25200"
                     /old_locus_tag="UM146_24531"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001332798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001332798.1"
                     /db_xref="GI:485699434"
                     /translation="MSSSLPDDINALKRLLAEQEALNRALLEKLNEREREIDHLQAQL
                     DKLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDRERYADW"
     gene            complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
     CDS             complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001399708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000612626.1"
                     /db_xref="GI:446535280"
                     /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTTLKDDPMSGHVF
                     IFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLEGIDW
                     RQPKRLLTSLTML"
     gene            complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
     CDS             complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016231180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000839179.1"
                     /db_xref="GI:446761923"
                     /translation="MKSLTAVRKKSPNYPVEFKIKMVELSHRPEISVAQLAREHGIND
                     NLLFKWRQYWREGKLRPPSTTENNVPELLPITLDAEDVVPTTSPRSQPVAAATPESLN
                     ISCEVTFRHGSLRLNGAISENILNLLIRELKR"
     gene            complement(81327..>81716)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
     CDS             complement(81327..>81716)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001523034.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_029364688.1"
                     /db_xref="GI:657259743"
                     /translation="TLLSTWQGVVYVAFIIDVFAGYIVGWRVSSSMETTFVLDALEQA
                     LWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKA
                     EVIHRKSWKNRKRRLSTVWQILKFLRE"
     gene            complement(81800..83308)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
     CDS             complement(81800..83308)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001189112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reverse transcriptase"
                     /protein_id="WP_001189113.1"
                     /db_xref="GI:447111857"
                     /translation="MQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLSSKGAH
                     TPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLGIPALR
                     DRIVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGRWVIEG
                     DLSSYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVPQGGVI
                     SPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPAVAYCR
                     YADDFVLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLGHRIIR
                     KRSRYGEMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWAMFYQF
                     VDFKAKVFSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLFGKTNH
                     GKLSGEILYWLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
     gene            83277..83702
                     /locus_tag="UM146_RS25225"
     CDS             83277..83702
                     /locus_tag="UM146_RS25225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001323569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323220.1"
                     /db_xref="GI:485689122"
                     /translation="MAAHVASLRCISLIIKGLHLVRSVNSRRKHIQTASLRHVMGFPH
                     RGLLRKLRQPARHRSHAPLTSVADLPRFTCLDSGILRRLPVALFILACRKLAEVSNAS
                     VIDAAAPVFRIHVKTPSTGSAYVSLPVPPARPVRSRRPW"
     gene            83617..83988
                     /locus_tag="UM146_RS25230"
     CDS             83617..83988
                     /locus_tag="UM146_RS25230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011478084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011478084.1"
                     /db_xref="GI:499797350"
                     /translation="MSKHLRPVVLTYHCQFLLHGLSDHVGRGDVFNPQRRINGFMFFS
                     LSVLNLEDHLGLVISPQSPLSAGYITLRACRRSLPLRFSTVTPGGIVGFLIVSYRFNI
                     PDRLAVHLSIHARPELRAHRK"
     gene            complement(83915..84127)
                     /locus_tag="UM146_RS25235"
                     /old_locus_tag="UM146_24556"
     CDS             complement(83915..84127)
                     /locus_tag="UM146_RS25235"
                     /old_locus_tag="UM146_24556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005119071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000279987.1"
                     /db_xref="GI:446202132"
                     /translation="MAVMGLAGVLRGKKVRTTVSRKAVAAGDRVNRQFVAERPDQLWV
                     ADFTYGVPGVQGGHGCLNEPRVCLEY"
     gene            84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
     CDS             84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000143800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_000143800.1"
                     /db_xref="GI:446065945"
                     /translation="MTFNTSQVSYYMTQRKKGITQHISAMKAGISVRSGRRIEKGEWA
                     KNSVRHWRTRKDPLEAVWDSMLVPLLKERPALTPTTLLEMLQDKYPGQYPNSLRRTMQ
                     RRVCEWKLQYGAEQEVMFRQRHQPGLRGLSDFTELKGVVVTIAGKLLAHKLYHFRLEW
                     SHWSWMRVVLGGESFSALAEGLQEALGQLGGVPVEHKTDSLRAAWKQQGEDGRRELTE
                     RYAALCQHYGMQGVHNNAGRGHENGSVESAHGHLKRRICQALILRGSNDFSTIEEYQA
                     FITQQVMRHNRNNQDLVKEERLHLKPLPLRRSADYDELTVRVSRSSTINVKHVVYSVP
                     SRLVGQLLRVRLWDDRLSCYVGSSEVMSCPRVRPEKGKTRARRIDFRHVIDSLAKKPG
                     AFCHATLRNDILPDDEWRRLWRRLCNHLEPDMAGRLMVHALKLAAGYDDISVVAKGME
                     QMLNTPGNVDLHRLMRFLGIKEKALPVVNVKQHNLSSYEQLLRGKGGSQ"
     gene            85913..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
     CDS             85913..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001522280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_000065240.1"
                     /db_xref="GI:445987385"
                     /translation="MSNIHHLERSLRKLRLTRVGAEWHALEKRALAEGWTPSRYLLTL
                     CNEELLWRESEKLRRYKKEARLPVAKTLSEYDFSQVPELNGAQFRQLCETTDWVDAGE
                     NVLLFGASGLGKSHLAAAIVDGVVGQGYRARFYSAGELLQELRKARAQLKLNELLLKL
                     DRYRVIVVDDLGYVKRDSAETGVLFELIAHRYERGSLVITSNHPFSMWGSIFVDETMA
                     VAAADRLIHHGYMFELKGESYRKKTAKAVTSAT"
     misc_feature    complement(86739..86855)
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            complement(86810..87136)
                     /locus_tag="UM146_RS25250"
                     /old_locus_tag="UM146_24571"
     CDS             complement(86810..87136)
                     /locus_tag="UM146_RS25250"
                     /old_locus_tag="UM146_24571"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0A1V2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000165261.1"
                     /db_xref="GI:446087406"
                     /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEF
                     DRLWKK"
     gene            87201..87467
                     /locus_tag="UM146_RS25255"
                     /old_locus_tag="UM146_24576"
     CDS             87201..87467
                     /locus_tag="UM146_RS25255"
                     /old_locus_tag="UM146_24576"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001377510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001336931.1"
                     /db_xref="GI:485704023"
                     /translation="MVRYFGFLANRVCGEKLPQVYRALGMDKPEAVAKVCYAQMVKQF
                     LSRDPFECVLCGGRMVYRRAIAGLNVSGLKKNARDISLLRYMPA"
     gene            complement(87990..89159)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
     CDS             complement(87990..89159)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005136398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TieB"
                     /protein_id="WP_031935676.1"
                     /db_xref="GI:686456931"
                     /translation="MFTLSKAPLYLLISLFLPTMAMAIDPPERELSRFALKTNYLQSP
                     DEGVYELAFDNASKKVFAAVTDRVNREANKGYLYSFNSDSLKVENKYTMPYRAFSLAI
                     NQDKHQLYIGHTQSASLRISMFDTPTGKLVRTSDRLSFKAANAADSRFEHFRHMVYSQ
                     DSDTLFVSYSNMLKTAEGMKPLHKLLMLDGTTLALKGEVKDAYKGTAYGLTMDEKTQK
                     IYVGGRDYINEIDAKNQTLLRTIPLKDPRPQITSVQNLAVDSASDRAFVVVFDHDDRS
                     GTKDGLYIFDLRDGKQLGYVHTGAGANAVKYNPKYNELYVTNFTSGTISVVDATKYSI
                     TREFNMPVYPNQMVLSDDMDTLYIGIKEGFNRDWDPDVFVEGAKERILSIDLKKS"
     gene            complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
     CDS             complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001100765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin Js sensitive receptor protein"
                     /protein_id="WP_001100763.1"
                     /db_xref="GI:447023507"
                     /translation="MNVIKLAIGSGILLLSCGAYSQSISEKTNSDKKGAAEFSPLSVS
                     VGKTTSEQEALEKTGATSSRTTDKNLQSLDATVRSMPGTYTQIDPGQGAISVNIRGMS
                     GFGRVNTMVDGITQSFYGTSTSGTTTHGSTNNMAGVLIDPNLLVAVDVTRGDSSGSEG
                     INALAGSANMRTIGVDDVIFNGNTYGLRSRFSVGSNGLGRSGMIALGGKSDAFTDTGS
                     IGVMAAVSGSSVYSNFSNGSGINSKEFGYDKYMKQNPKSQLYKMDIRPDEFNSFELSA
                     RTYENKFTRRDITSDDYYIKYHYTPFSELIDFNVTASTSRGNQKYRDGSLYTFYKTSA
                     QNRSDALDINNTSRFTVADNDLEFMLGSKLMRTRYDRTIHSAAGDPKANQESIENNPF
                     APSGQQDISALYTGLKVTRGIWEADFNLNYTRNRITGYKPACDSRVICVPQGSYDIDD
                     KEGGFNPSVQLSAQVTPWLQPFIGYSKSMRAPNIQEMFFSNSGGASMNPFLKPERAET
                     WQAGFNIDTRDLLVEQDALRFKALAYRSRIQNYIYSESYLVCSGGRKCSLPEVIGNGW
                     EGISDEYSDNMYIYVNSASDVIAKGFELEMDYDAGFAFGRLSFSQQQTDQPTSIASTH
                     FGAGDITELPRKYMTLDTGVRFFDNALTLGTIIKYTGKARRLSPDFEQDEHTGAIIKQ
                     DLPQIPTIIDLYGTYEYNRNLTLKLSVQNLMNRDYSEALNKLNMMPGLGDETHPANSA
                     RGRTWIFGGDIRF"
     gene            complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
     CDS             complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000981087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter TonB"
                     /protein_id="WP_000981091.1"
                     /db_xref="GI:446903835"
                     /translation="MMNILHFSQSVKWSSWFICSLLLHGLIFLAFIWRFSEVQPAMSP
                     APAIMLQWAEIIEAPSSPLSLPVGIAQQESAVTEEKQQTEDRQQRPVTEDSDATIEIT
                     RKKKSSDGEKKKTRPPRKIKAQTSDSNPTAVSSNAAPQALVESSRIAAPFNSDSTKRD
                     NSEASWESRVKGHLNRYKRYPGDARKRARTGTAVVTFTVNTEGTIVSSFLEISSGTFS
                     LDREAIAVLERAQPLPKPPPEILEGGLFKVKMPITFKLKE"
     gene            complement(92448..93323)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
     CDS             complement(92448..93323)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001224622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001224623.1"
                     /db_xref="GI:447147367"
                     /translation="MRKFILISMITLASVSLGACRQNVTIKQDAPGQKAFLTDGQIYD
                     LHSGKIISSSELLADLATAQHLIIGEKHDNAEHHQIELWLIQNLLIQRPQGSVLLEML
                     TSEQQPRVNQVKCWLKDNPVVRDSRVQELLNWQKGWSWEMYGDIVMQLLRGPYPLLNA
                     NIGREQILALYKKNEFPKGKKSTAPVVQEALRETIISMHEGNLESQQLTSMLSIQQQR
                     DRYMARQLLSAPVPSLLIAGGYHASKSMGVPLHMEDLATGTHPVVLMLAEKGMNITVD
                     HADYVWFVAPDTTKR"
     gene            complement(93655..94221)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
     CDS             complement(93655..94221)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016238190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rep protein"
                     /protein_id="WP_001013138.1"
                     /db_xref="GI:446935882"
                     /translation="MNGHAHLLYALNIAVRTAPDSSVKALKYAAAIERSLCEKLCADV
                     NYSGLICKNPFHLEWQVMEWREEAYTLDELADYLDLSASARRSIDKHYGMGRNCHLFE
                     MTRKWAYRAIRQGWPEFSQWLDAVIQRVEMYNASLPVPLSPPECRAIGKSIAKYTHRN
                     FTPETFAQYVADTHTLTYVFVPLALTPR"
     gene            94774..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
     CDS             94774..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001322408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322408.1"
                     /db_xref="GI:485688269"
                     /translation="MTNTGEFILKYDFINGSSILIIVWMTIAVIIRVTNWKFNKKTAP
                     AISLFLAFPASIVILLVYIFFFDK"
     gene            complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
     CDS             complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001080726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin transporter"
                     /protein_id="WP_001080732.1"
                     /db_xref="GI:447003476"
                     /translation="MNRKYYFNNMWWGWVTGGYMLYMSWDYDFKYRLLFWCISLCGMV
                     LYPVAKWYIEDTALKFTRPDFWNSGFFTDTPGKMGLLAVYTGTVFILSLPLSMIYILS
                     VIIKRLSVR"
     gene            96257..96604
                     /locus_tag="UM146_RS25295"
     CDS             96257..96604
                     /locus_tag="UM146_RS25295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000142455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000142452.1"
                     /db_xref="GI:446064597"
                     /translation="MTFEQKKARAIALMDSKKMWRSNYAPPLLRILWRLGIRLPPLPF
                     MPFWQVTVLTGGLWGISWGCAMWFIYWGPSGMVAGEAIIISITGGFLSGLLMASFHWW
                     RRKVNRLPPWDDV"
     gene            complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
     CDS             complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000194542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000194542.1"
                     /db_xref="GI:446116687"
                     /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGPVLTRDIERVLEQSGEA
                     PVYGPNLRASCRRLEDAGWLRTLRAPNLQLAVELTDAGRAVAQPLLPAGGTSATDLAV
                     ELNGITYQACRGDFVVRLDGSTCLQLWNKEGRVVRREGDPLEVAQWLQACHDAGMEVR
                     VQINESAAP"
     gene            complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
     CDS             complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000371883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000371882.1"
                     /db_xref="GI:446294027"
                     /translation="MDQEMTFSLSYEQLTRFAEKRIRECNLDSHGVTYLCESAKAGAV
                     LIFWHELAINGYTSMNAIKRQEIIDADHQRLRKLIWPEDDWK"
     gene            97492..97818
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
     CDS             97492..97818
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001438584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000165133.1"
                     /db_xref="GI:446087278"
                     /translation="MTKNTRFSPEVRQRAIRMVLESQGEYDSQWAAICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEF
                     DRLWKK"
     misc_feature    97773..97889
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            97818..98297
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
     CDS             97818..98297
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001309942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001130166.1"
                     /db_xref="GI:447052910"
                     /translation="MPLLDKLRKLYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
                     QRDDWLKKEILRVYDGNHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGK
                     KVRTTVSRKAVAAGDRVNRQFVAERPDQLWVADFTYGVPGVQGGHGCLNEPRVCLEY"
     gene            98904..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
     CDS             98904..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001189106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001189106.1"
                     /db_xref="GI:447111850"
                     /translation="MQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLSSKGAH
                     TPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLGIPALR
                     DRISIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMIRQWER
                     SQ"
     gene            complement(99431..99751)
                     /locus_tag="UM146_RS25325"
                     /old_locus_tag="UM146_24646"
     CDS             complement(99431..99751)
                     /locus_tag="UM146_RS25325"
                     /old_locus_tag="UM146_24646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001351254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphatase"
                     /protein_id="WP_001351254.1"
                     /db_xref="GI:485719818"
                     /translation="MGTMDPTFNPVITDDSAAFSQKAVQAMEKERSQMQLDDSYQLLA
                     QMTDYKDSPSCKEKQQCSLTEAKDAFREGANKQVMSSQADSLIKISRIWADFCPANTS
                     NQPI"
     gene            complement(99726..100175)
                     /locus_tag="UM146_RS25330"
                     /old_locus_tag="UM146_24651"
     CDS             complement(99726..100175)
                     /locus_tag="UM146_RS25330"
                     /old_locus_tag="UM146_24651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000733499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphatase"
                     /protein_id="WP_001323222.1"
                     /db_xref="GI:485689124"
                     /translation="MKKLILAAAVAGAVLLSSAAQAQTTPEGYQLQQVLMMSRHNLRA
                     PLANNGSVLEQSTPNQWPEWDVPGGQLTTKGGVLEIYMGHYMREWLAELGMVTSGECP
                     TPDTVYTYANSLQRTVATAQFFITGAFPGCDIPVHHQEKNGHDGPNV"
     gene            complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
     CDS             complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000874189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000874189.1"
                     /db_xref="GI:446796933"
                     /translation="MAFIWNDESLAILRENAGILTTEQIAQLLHTNITAVRNMAYRLK
                     LSLRVTAYNHRRIAQVQALYASETLSLKEIAAKTGLTASTVQYIVYVKSKNKPYATTE
                     YVSFETENAVHYRVQKEFVDTERSLLDNISDNTRFRELYLTDGTFYCARNIKYEVFIS
                     E"
     gene            complement(100807..101292)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
     CDS             complement(100807..101292)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012132911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_001267176.1"
                     /db_xref="GI:447189920"
                     /translation="MRWHNVLLLAAAILISGCKEEKLAVGAPAPALAAFDLQGQESGL
                     ERWQGKAVYLNFWSAGCGGCLAEMDTLEALSKKWGDKVVVVAVNTDPETVRINDLLAK
                     HQITYPVVRDQLNITQERYQVIGTPTSVLIDSEGRVLELHQGMRKPSELEATFARLAA
                     R"
     gene            complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
     CDS             complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000117262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000117262.1"
                     /db_xref="GI:446039407"
                     /translation="MSVTHIPQVAIETRHLYKRFGDVTALDDINLRIAQGEFVAIMGA
                     SGSGKTTLMNILTCLDTATEGQVFLDGTDAAALDEEGRRRFRAEKIGLVFQQFHLIPF
                     LTALENIMLAQHYHSVVDEAAARKVLEQVGLGHRVTHLPSQLSGGEQQRVCIARALVN
                     EPPVIFADEPTGNLDEENEQRVLDLLTDLHRQGRTIVMVTHNPALGQFADRILRLQHG
                     KYLGEEANQHALA"
     gene            complement(101979..103108)
                     /locus_tag="UM146_RS25350"
                     /old_locus_tag="UM146_24671"
                     /note="ABC transporter permease; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
     CDS             complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003836819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000964653.1"
                     /db_xref="GI:446887397"
                     /translation="MLWRMLRQSWGRNLRRKVLAIITVFLASSLISALLAVSIDIGDK
                     MSRELKSYGANILIEPAGQAALPALFSESSNPLSGQDFLDEAELPNIKDIFWRNNIVG
                     FAPMLGGEASVEGEPVRILGTFFSQPVDIPDEEGYETGQKTVSPYWQVTGDWPQEPAG
                     AEPQTLVGHALARQMGWKPGDKLTLRTEGEAVQVTVSGILSSGGDEDNQLVMPLSTVQ
                     HLLGLPGKVQAIRVSALTVPENELSRRARENLDALNAEEYDLWYCTAYVSSIAHQLEE
                     AISGAEVRPVWQVAASEGVVIDKIQLLMAVVTVAALVASAMGIASLMTSTIMERAKEI
                     GLMKALGARQWQIMLLFYLEAASSGLAGGALGCIAGWGLAKAIGVMLFDAPLNFAWIV
                     VPCVLVIAVLIALIGTWFPARRIARLYPVEVLYGR"
     gene            complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
     CDS             complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000119834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000119836.1"
                     /db_xref="GI:446041981"
                     /translation="MSYFFVTTLQVFFCIALLSGVLWSRNDPPSLRPLTWTLLTGLIA
                     GVLAGLFIHGSQPVQLLLVGAEVMVSLLFVLSFWWASTRIRYLWQGILIFGAARHWAL
                     DPNLGGLTSTHVLNTDLLLNLTAVVLAFAILCLAGVLCAMLLRRIRGLYWPLTLILLV
                     MIWLPLSGNLLLLLMKLQVVPLGKSLLSFVAKVTNNTALYNWAGAALLLALALCWLPA
                     LLRAFRQTRETEEPIAHRLALAQRRNALRLWLVTIGCAVVVIAGQLWWDKVASQPPQL
                     SEAVPVTLGSDGMVRLPVEQLRDGKLHRFVWVADDGKAVRFFVINRYPDKLRFGVVFD
                     ACLLCGDQGYVMEGNQVICVACGVHIFIPSIGKAGGCNPVPIENWHNDEKELVIPGKE
                     LATGVNYFSTVMTIKVTDPVDGSTLTNTSADYKYSYGGKTWFFSSEANYERFRETPEQ
                     FVPADMREE"
     gene            complement(<106446..108374)
                     /locus_tag="UM146_RS25365"
     CDS             complement(<106446..108374)
                     /locus_tag="UM146_RS25365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001243580.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron permease"
                     /protein_id="WP_041031483.1"
                     /db_xref="GI:751480742"
                     /translation="MRNFRNSLLVTLFGLFISMSVWASTNYAPLIEDIEQRLDKTAEL
                     YQQQHADEARRTVQMAYFEVFENLEGPIRINISARKSYEMESAFGEIRRMIGEKKPLA
                     DVQARIDWLKAALREVEPVLDGGHRLVAEEQHNALSRDDIAVHWQESFRTIDDLLAQA
                     VTEYQAGNYSVASQHVQQAHYQGFKNSEMEMSLRQNRSAKDAASINQQFSSLIALTAQ
                     PDHLNDVSYQVTTLLQDIEDILPGLPTTRDDQQVAAAQSADNIPAADEGNNRTDWAEV
                     TTGINQSIQDAIARYQGGDAKNAILDIQDTYFDRFEASGMENKIGSRDSAFKTTLEAY
                     FTRLVSLMKAGQPVERLNAEASALAQDLQKAVTMLGEGEETQWSLLLYSLMIIVREGL
                     EALLIVAAIVAYMVKNNHQDKLPLIRQSVIVALIASVITAAIFQMLFTNSGASRELLE
                     GITMLIAVVMLFFMSYWLLSKVEARHWKAWLEGKLSHSLSRGSLVGLWLTSFLAVYRE
                     GAETVLFYYALIGDANTVSGHMAIGAGFVIGCVVLLLAWLVMRYSVVRLPLKPFFMFT
                     GSFMYLMAFVFAGKGVLELVEGKLFQPTLINGFPEISWLGIYPYVETLLPQVVLLLAA
                     LVALWVMRRKSAVPGETIK"
     gene            complement(108667..109428)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
     CDS             complement(108667..109428)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012132916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:quinone oxidoreductase"
                     /protein_id="WP_001225378.1"
                     /db_xref="GI:447148122"
                     /translation="MRKGKIIVASMMVLCVLIFVAAAAWFMLFQGEMTEPTEEEKQAA
                     ILHAAGLMKSETQDKKSVETLYHRYIIQRHVNLDSGELVAGSSADTARQKCEKLAPER
                     DPAQVRQRCTVADVFFVKDKNNEIQQVIIPVTGKGAKSMMHAFLALGLDGRTVRNLYY
                     YQQRETPFLGARVEDANWRKQWPGKRLLDNSGHPALKIVQDKPEHADEYTVDGISGAT
                     LTSTGVEKSINYWMGPQGYGQFLQRLASDRNNLNL"
     gene            complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
     CDS             complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012132917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkyl hydroperoxide reductase"
                     /protein_id="WP_000949451.1"
                     /db_xref="GI:446872195"
                     /translation="MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLH
                     TLDGETVTLASISEERPVLLYFWASWCGICRFTTPDVARLQSEGESVMTIALRSGNDG
                     EVSRWLSRKRVTFPVVNDSGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKL
                     RLWRAAMF"
     gene            complement(110161..110319)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
     CDS             complement(110161..110319)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000449408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-sensitivity suppressor C"
                     /protein_id="WP_000449408.1"
                     /db_xref="GI:446371553"
                     /translation="METLSTNLQLARLVGVQGTPATIIGDEMIPGAVSWETLEAVVKE
                     KLAVAHAQ"
     gene            complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
     CDS             complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001067856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001067837.1"
                     /db_xref="GI:446990581"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYLFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMGALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            complement(111265..111476)
                     /locus_tag="UM146_RS25390"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(112178..113035)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
     CDS             complement(112178..113035)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001425616.1"
                     /note="RepA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_000131004.1"
                     /db_xref="GI:446053149"
                     /translation="MTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVGFTSR
                     FDFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
                     SEDAVAAARRSRVEWENKQRKKQGLDTLGMDELIAKAWRFVRERFCSYQTELKSRGIK
                     RARARRDANRERQDIVTLVKRQLTREISEGRFSASREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     gene            complement(113028..113102)
                     /locus_tag="UM146_RS25400"
     CDS             complement(113028..113102)
                     /locus_tag="UM146_RS25400"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P62550.1"
                     /note="RepA6; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap"
                     /protein_id="WP_001365705.1"
                     /db_xref="GI:485738474"
                     /translation="MPGKVQDFFLCSLLLRIVSAGWCD"
     gene            complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
     CDS             complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000078109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_000078109.1"
                     /db_xref="GI:446000254"
                     /translation="MSQIENAVTSSPKRIYRKGNPLTGAEKQRISVSRKKGTHKAINV
                     FIQSELKDDLTQLCKDSGLTQKEMIEHWILKEKAAMTDANRK"
     gene            complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
     CDS             complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001545650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000766808.1"
                     /db_xref="GI:446689462"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERILSGGEYWQRQKTLLTEREVSFMKGLFRIVDMKRWYLCPQVRVADIVQLNGNIRP
                     RSRQWWQLFRMVSQWHVDVVIVERRSFSIVAAVELDDASHLRPERRRRDILLEEVLRQ
                     AGIPLLRSHDARKLLQMTGEWLNTTGAVQQSPEHRS"
CONTIG      join(CP002168.1:1..114550)
//
DBGET integrated database retrieval system