GenomeNet

Database: RefSeq
Entry: NC_017630
LinkDB: NC_017630
Original site: NC_017630 
LOCUS       NC_017630             114550 bp    DNA     circular CON 22-FEB-2017
DEFINITION  Escherichia coli UM146 plasmid pUM146, complete sequence.
ACCESSION   NC_017630
VERSION     NC_017630.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00017915
            Assembly: GCF_000148605.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli UM146
  ORGANISM  Escherichia coli UM146
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Complete genome sequence of adherent invasive Escherichia coli
            UM146 isolated from ileal Crohn's disease biopsy tissue
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2010) Research and Testing Laboratory, 4321
            Marsha Sharp Fwy, Lubbock, TX 79407, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002168.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 02/22/2017 01:36:26
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,286
            CDS (total)                       :: 5,174
            Genes (coding)                    :: 4,862
            CDS (coding)                      :: 4,862
            Genes (RNA)                       :: 112
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 84
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 312
            Pseudo Genes (ambiguous residues) :: 3 of 312
            Pseudo Genes (frameshifted)       :: 211 of 312
            Pseudo Genes (incomplete)         :: 77 of 312
            Pseudo Genes (internal stop)      :: 62 of 312
            Pseudo Genes (multiple problems)  :: 38 of 312
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..114550
                     /organism="Escherichia coli UM146"
                     /mol_type="genomic DNA"
                     /strain="UM146"
                     /db_xref="taxon:869729"
                     /plasmid="pUM146"
     gene            complement(join(114463..114550,1..>2))
                     /locus_tag="UM146_RS27530"
                     /pseudo
     CDS             complement(join(114463..114550,1..>2))
                     /locus_tag="UM146_RS27530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011379012.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(join(114500..114550,1..199))
                     /locus_tag="UM146_RS25575"
                     /old_locus_tag="UM146_24031"
                     /pseudo
     CDS             complement(join(114500..114550,1..199))
                     /locus_tag="UM146_RS25575"
                     /old_locus_tag="UM146_24031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001734701.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
     CDS             complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405970.1"
                     /note="with Hns involved in transcriptional regulation of
                     hemolysin; non-specific DNA-binding protein which affects
                     the production of multiple proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin expression modulator Hha"
                     /protein_id="WP_014639534.1"
                     /translation="MAKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLXXSERESFNSAA
                     DHRLAELITGKLYDRIPKEIWKYVR"
     gene            complement(492..1028)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
     CDS             complement(492..1028)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_077634790.1"
                     /translation="MLFSVCCDIQDYLKYRCHLSDMENNMRKYIPLVLFIFSWPVLCA
                     DIHGRVVRVLDGDTIEVMDSRKAVRIRLINIDAPEKKQDYGRWSTXMMKSLVAGKTVT
                     VTYFQRDRYGRILGQVYAPDGMNVNQFMVRAGAAWVYEQYNTDPVLPVLQNEARQQKR
                     GLWSDADPVPPWIWRHRK"
     gene            complement(1198..1410)
                     /locus_tag="UM146_RS24725"
     CDS             complement(1198..1410)
                     /locus_tag="UM146_RS24725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001309245.1"
                     /translation="MNGTGRDSQNSGVWRYRQVGRRAVRLEVRGDWPGAAEAWLRAAQ
                     SAPRTDWQQFARKRAEHCHRRCRGRV"
     gene            complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
     CDS             complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405973.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein"
                     /protein_id="WP_000139321.1"
                     /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELTAKKAQARQALSIYLNLPSLDEAVNTLKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEV
                     YAAERLDKIRRQNRIKAELQAVLDEQ"
     gene            complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
     CDS             complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_000704523.1"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPC
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKIPFLTVMETLQYKPAESAA
                     KVQCPVLIVIAGQDSVNPPEQGKALYDAVASGTKELYEEADACHYDIYEGAFFERVAA
                     VQTQWFKKHL"
     gene            complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
     CDS             complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylase TraX"
                     /protein_id="WP_000205724.1"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSXRLYRAEDRAERLALXACLLAVIPALNLAXSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPVFYACHLAVLGVLAL"
     gene            complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
     CDS             complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer relaxase/helicase TraI"
                     /protein_id="WP_000948350.1"
                     /translation="MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQ
                     GSVDKDVFTRLLEGRLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRL
                     IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQDPQLHTHV
                     VVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEIRMAE
                     WMQTLKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQF
                     TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
                     RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
                     ELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMVFTPGSTVIVD
                     QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
                     PATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
                     GHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
                     LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASV
                     SEDAMTVVVPGRAEPAXLPVSDSPFTALKLENGWVETPGHSVSDSAXVFASVTQMAMD
                     NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETSLETAISLQ
                     KTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINAQIKR
                     GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSG
                     QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAV
                     GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
                     AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVXIMKEIVRQTPELREAVYXLINR
                     DVERALSGLESVKPSQVPRXEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGETFPDV
                     PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGQEQVMVP
                     VLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLIS
                     PREAVAEGVTLYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
                     QTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVAL
                     SRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVLEPKPDREVMNAQRLFSTARELRDV
                     AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
                     GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
                     GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
                     VRKMAENKPDLPDGKTELAVRDIAGQERDRSAISERETALPESVLRESQREREAVREV
                     ARENLLQERLQQMERDMVRDLQKEKTLGGD"
     gene            complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
     CDS             complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system coupling
                     protein TraD"
                     /protein_id="WP_000009377.1"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILXGLX
                     LWVKISWQTFXNGCIYWWCTXLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMI
                     WCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVA
                     RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
                     YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
                     YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQARP
                     KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPVS
                     SVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
                     HPDIQQHMQRREEVNINVHRERGEDVEPGDDF"
     gene            complement(11352..12155)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
     CDS             complement(11352..12155)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077634791.1"
                     /translation="MQILCATVKCCRRSRDLPEKVIMTSDNIAEYVGENNQFTEKPVT
                     EYPPVIQDNTVTTKDYLYSNNIDTDLLVVIGGLIVILFLMMLIMYFINSLRHKELTEI
                     LEKISFPEKSGSNLLKPEAVSCNLLSLCVLAPVLCTPRKLAEVSREIIVASAQEIAWT
                     PGSSRIDGHQGENITWSLSSQSPADKYDLINKTSXVSPDSGRFYEPDTVLDHRERVRL
                     FIQIQFPHGSDWSEVLRLTDIVTEKVSSGRXAGGXHHRHTGYTWSVSVN"
     gene            complement(12292..13026)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
     CDS             complement(12292..13026)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraT"
                     /protein_id="WP_012602147.1"
                     /translation="MMKMKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETI
                     WLEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKA
                     DKMDLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMV
                     EDVNYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNA
                     NKVNLKFEEAKPVLEDQLAKSIANIL"
     gene            complement(13072..13557)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
     CDS             complement(13072..13557)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000605869.1"
                     /translation="MIMRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLF
                     IWLFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCV
                     SVREWMQSQVNEQTNEDLHLDFDNMDFHRTNPATGLPMSGIGVDIGGNSYGYSSKRYD
                     E"
     gene            complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
     CDS             complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_001007080.1"
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMGTRTWDSIEKIALTLSVLAV
                     AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
                     SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDY
                     VQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLK
                     DKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNV
                     TINALKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPV
                     VLSEISQIQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTAS
                     AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
                     SGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQFGSNRG
                     SSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRTSAGMY
                     GDAHAEWGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
                     AEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFV
                     QEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
                     VKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSA
                     QERMPGADSPQELMKRAKEYQDKYKQ"
     gene            complement(16392..17774)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
     CDS             complement(16392..17774)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_077634792.1"
                     /translation="MAIMLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASN
                     TTQPGVWQGQAAGYAYGGSLYARTQVKNIQLISMTLPDINAGCGGIDAYLGSFSFING
                     DQLQRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQKMASDINSMNLSSCQVAQGI
                     VGGLFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKASDKDKERVL
                     KNINIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIM
                     EGGTAKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTIIQNKAVSDTPLDDRE
                     KGFISSTTVPVFKYLIDPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATG
                     NYPQTVLDSVLENLNQAQQQIAVFQGQVKVQQDALLVVDRQMSYMRQQLSARMLSRYQ
                     NNYHFGGSTL"
     gene            complement(17752..18504)
                     /locus_tag="UM146_RS27540"
                     /old_locus_tag="UM146_24096"
     CDS             complement(17752..18504)
                     /locus_tag="UM146_RS27540"
                     /old_locus_tag="UM146_24096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbJ"
                     /protein_id="WP_077634793.1"
                     /translation="MRHYRFCRGQRMPPVLWRGWIPFCRCTERKKVRNKQVVLLIAGI
                     SGIATGIIVSLNIPFIRQGLFYPASPVEIVVSLCLTFSVSVVFFVGAIVGWISVSEIY
                     YSRMNGLNESSEISEETYNERKRNDAELKNRKTKRDYDYERRVSDIYFDLFFVFVAAG
                     TFLWVIMHSIFDACIDSWKADPELNNFRYMWNILMYVIPYTLWAFAGGFLIVYVRNPL
                     NELINGGIRIFRLKRRMRRENKLREGGNNASH"
     gene            complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
     CDS             complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly thiol-disulfide isomerase TrbB"
                     /protein_id="WP_000059830.1"
                     /translation="MSLTKLLPVILLMMATGVQASTRDEIERLWNPQGMAVQPAQPAA
                     DTSARTEKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSV
                     FPYTLDGQGDTAFPEALPVPPDVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDA
                     ASFMARMDTVLQMYGEEKGAK"
     gene            complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
     CDS             complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     chaperone TraQ"
                     /protein_id="WP_000624160.1"
                     /translation="MISKXRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLA
                     ELIAAILVLFGAYQVLDAWIARVSLEEREALEARQQAMMEGQQEGGHVSH"
     gene            19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
     CDS             19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000736414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000736414.1"
                     /translation="MKKLSFKEKLEIVRNIIRESLSGNAAFALLVYSLLHSLPIKTFA
                     DLFVTILLFIAIIAVVIWLFLIIYVYFCELFRSHWIAVWFILWSVVINLTIGFGIYDK
                     LAPVISLMK"
     gene            complement(19614..19955)
                     /locus_tag="UM146_RS27545"
                     /old_locus_tag="UM146_24116"
     CDS             complement(19614..19955)
                     /locus_tag="UM146_RS27545"
                     /old_locus_tag="UM146_24116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001530454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbA"
                     /protein_id="WP_001298557.1"
                     /translation="MHTGDLCFFTGASLFIVGVVGYFFTGPNNKGVYLLSSFIFFVVN
                     VISVCMLPDNFLFLCGAVMNQCAVPVVSMAVSTIPVITKFDSFRRMFVCIMLSAIWSG
                     VMWFFIISLVK"
     gene            complement(19969..20742)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
     CDS             complement(19969..20742)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405987.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly protein TraF"
                     /protein_id="WP_077634794.1"
                     /translation="MKEKXMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKIXPK
                     EKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQA
                     GLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFY
                     RGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPA
                     MMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF"
     gene            complement(20705..20965)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
     CDS             complement(20705..20965)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="WP_077634795.1"
                     /translation="MMKVIFTSNRFIDFLIRLLITAXVISPVIIWSWDTVKETTADGX
                     LAAAFVILYSGVLLFILYFCFSALTDLQKTDERKXDERNEDE"
     gene            complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
     CDS             complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraN"
                     /protein_id="WP_000821853.1"
                     /translation="MKRILPLILALVAGMAQADSNSDYRAGSDFARQIQGQGTGSIQG
                     FKPQESIPGYNANPDETKYYGGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKD
                     ILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRSEFTNYTCERDTMVEEYCTRT
                     ASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLSVYAAFFFL
                     NSRYTFMNTTFNVGLANGQSDTYPLSGATGLQVTQGQVLTGSGCTANGNCLPHGNGDR
                     KVYESLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKT
                     GVMEGKPWNITQACWAYRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLH
                     EYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAEAVSQLAALAAAGKDVA
                     ALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLT
                     VSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHPDCRGIT
                     VDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ"
     gene            complement(22836..23486)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
     CDS             complement(22836..23486)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     assembly protein TrbC"
                     /protein_id="WP_077634796.1"
                     /translation="MRNIMNRKIFALFALTAGMHLAVHASENVNTPENRQFLKQQENL
                     SRQLREKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSF
                     SIPEEGLKRMLXETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFS
                     QYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK"
     gene            complement(23483..23794)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
     CDS             complement(23483..23794)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323329.1"
                     /translation="MKMATMDSKYIQHLRKISAVLLRLISRTLKLFPFGLVMVPVILF
                     YFAPDSFLAEIIHEWKKADISEQVTLVRLYLKVTFTCAFMAVFLNYLFSDEFMPVNSR
                     K"
     gene            complement(23818..24811)
                     /locus_tag="UM146_RS24830"
                     /pseudo
     CDS             complement(23818..24811)
                     /locus_tag="UM146_RS24830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405992.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraU"
     gene            complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
     CDS             complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001203750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system protein TraW"
                     /protein_id="WP_014639537.1"
                     /translation="MRCRGLIALLIWGQSVXAADLGTWGDLWPVKEPDMLTVIMQRLT
                     ALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYXSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQXLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEM
                     QKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
     gene            complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
     CDS             complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="WP_000214087.1"
                     /translation="MTTTQKTTDVTAPRRSHWWWTVPGCLAMVLLNAAXSYGIVRLNA
                     PVTAAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     gene            complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
     CDS             complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-IV secretion system protein TraC"
                     /protein_id="WP_000069779.1"
                     /translation="MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRL
                     LPYRDYNQESGLFMNDTTMGFMLEAIPINGANKSIVEALDHMLRTKLPRGIPLCIHLM
                     SSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYR
                     VFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVGEMINHNP
                     DSLYPKRRQLDPYSDLNYQCVEDSFDLXVRADYLTLGLRENGRNSTARILNFHLARNP
                     EIAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTS
                     YAKWFPSVEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSF
                     RKNGFELISPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADN
                     PLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSG
                     GFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPN
                     GNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMI
                     VLLDQYTANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENR
                     MYRTPRTLKKLNVIDEGWRLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDS
                     DKASSAARAAWGNSSYKIILKQSAKEFAKYNQLFPDQFQPLQRDMIGKFGAAKDQWFS
                     SFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRXEGXSIHEAVWQLAWKKSG
                     PEMASLEAWLEEHEKYRSVA"
     gene            complement(28576..28751)
                     /locus_tag="UM146_RS27550"
                     /pseudo
     CDS             complement(28576..28751)
                     /locus_tag="UM146_RS27550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405996.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(28819..29037)
                     /locus_tag="UM146_RS27555"
                     /old_locus_tag="UM146_24176"
     CDS             complement(28819..29037)
                     /locus_tag="UM146_RS27555"
                     /old_locus_tag="UM146_24176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000556746.1"
                     /translation="MHTFIFLVLIKNINGGGSWNITPMPNTDVCVQVLRTIESHGGRG
                     FGNTGECIEVKTNKPLNNVMDTLNGGGQ"
     gene            complement(29117..29632)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
     CDS             complement(29117..29632)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012602150.1"
                     /translation="MLNVRRIRKNRENTMHKSEAEKIDSILDEHQQIYRRHNQINNIL
                     AYCACIAWIPCIIAAFGVDGIYLKILFAVLACCGAVCFFIFFFTLLPESLMVLSRQSL
                     LQLMRLTEDVPDARQELLNRLLSGKKLTGRDEQDIRRLWQEKVDAMQESATRQREQDT
                     IRKFTEGNKSE"
     gene            complement(29583..29804)
                     /locus_tag="UM146_RS27560"
                     /old_locus_tag="UM146_24186"
     CDS             complement(29583..29804)
                     /locus_tag="UM146_RS27560"
                     /old_locus_tag="UM146_24186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraR"
                     /protein_id="WP_001278694.1"
                     /translation="MSDEADEAYSVTEQLTMTGINRIRQKINVHGIPVYLCEACGNPI
                     PEARRKIFPGVTLCVECQAYQEKQRKHYA"
     gene            complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
     CDS             complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraV"
                     /protein_id="WP_000809889.1"
                     /translation="MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANE
                     KAKKLEQPADAKPAAASLPRLAEGNFRTTTVRAVTAASPSGSGPVVTALPEQKLLAPR
                     PLFTAAREVKTIIPVSSVASVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVI
                     KPSAWGKPRIN"
     gene            complement(30451..30684)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
     CDS             complement(30451..30684)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
                     /protein_id="WP_000235791.1"
                     /translation="MATSKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSS
                     RNTVFENPDIVKTCTVRDLKXDFVNCDEKGEGQ"
     gene            complement(30696..31049)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
     CDS             complement(30696..31049)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbD"
                     /protein_id="WP_071586423.1"
                     /translation="MTEQTETTEIKMNMRNINAITALSVPGKTMSDDFMHAVLSNCTT
                     RIVLPAPKEFSSESLPHNFNMAAVGVMKEGMSMRLFSSPGHIVVAGQFGGGKSASVKE
                     LIDRIIQKYKEPFDE"
     gene            complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
     CDS             complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraP"
                     /protein_id="WP_000002787.1"
                     /translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMA
                     LFVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQDICHYRAA
                     DAADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLK
                     EVYTEDASLPGKIRKCPVYLPDDRTNRNNGDKNEHA"
     gene            complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
     CDS             complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_000146665.1"
                     /translation="MASINTIVKRKQYLWLGIVVVGAASAIGGVLYLSDVDMSGNGEA
                     VAEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDD
                     QRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPP
                     QGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGTSLPYIPSGS
                     FAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSS
                     ERAIVRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDG
                     IGQGMERASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIP
                     IGAGNEVTVVFQDGFQLKTVEEMALERTQNRAEEDNPESPVPVPPSAESHLNGFNTDQ
                     MLKQLGNLNPQQFMSGSQGGGNDGK"
     gene            complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
     CDS             complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001425793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system secretin
                     TraK"
                     /protein_id="WP_001340581.1"
                     /translation="MAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNS
                     LDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDL
                     RGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADA
                     VWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLLAGARMDVYVIR
                     DGEGN"
     gene            complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
     CDS             complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraE"
                     /protein_id="WP_000399783.1"
                     /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNE
                     QRTAVTPMXFNXPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
                     GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     gene            complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
     CDS             complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system protein
                     TraL"
                     /protein_id="WP_000012100.1"
                     /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIIT
                     SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     gene            complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
     CDS             complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV conjugative transfer system pilin TraA"
                     /protein_id="WP_001098988.1"
                     /translation="MNTVLSVQGASAPVEKKSFFSKFTCLNMLRLVRAVIPVAVLMML
                     FPELAMAAGKGDLMAKGQETVKATFGKNSSIVKWIVLAEVLVGAVMYMMTKNIKFLVG
                     FAILSVFIAVGMSVAGF"
     gene            complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
     CDS             complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxosome protein TraY"
                     /protein_id="WP_001254388.1"
                     /translation="MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIR
                     LRDHLKRFPDFYNEEIFREVIEENESTFKEL"
     gene            complement(35352..36098)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
     CDS             complement(35352..36098)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraJ"
                     /protein_id="WP_011478093.1"
                     /translation="MQGGLNSLHRLSIESLTEVPMCALDRRERPLNSQSVNKYILNVQ
                     NIYRNSPVPVCVRNKNRKILYANGAFIELFSREDKPLSGESYIRLQVEIFLSSLELEC
                     QALGHGSAFCRRFNFHGEIYQIRMENVSFYNDESVVLWQINPFPDYPFFALNQSGSNT
                     NTSDKLTIWNDLSPGTLVVFSFYMLGVGHATIARELGITDRASEDRIKPVKRKIKEFF
                     EHFDLFRVSCIYKGEIDSLLSIIREFYGVK"
     gene            complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
     CDS             complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="WP_001151562.1"
                     /translation="MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLE
                     LGLRVHEAQMERKESAFNQAEFNKVLLECAVKTQSTVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIRDKVSSEMERFFPENDEE"
     gene            36946..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
     CDS             36946..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_001323326.1"
                     /translation="MVLLVVRTTNLLSLFVEWVKLFTDKVTRGGKMKKWMLAICLMFI
                     NEICQATDCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQH
                     FNELDRYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEAVGAYNAGFRKTERQNQ
                     RRLAYASEVYRIYTGIKSSKGIRIPVTKKSLPEINSVQNN"
     gene            complement(37845..38750)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
     CDS             complement(37845..38750)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF945 domain-containing protein"
                     /protein_id="WP_077634797.1"
                     /translation="MLLMGIGRDDIKRKNFLLNLFFHKGVAVMRLASRFGRYNSIRRE
                     RPLTDDELMQFVPSVFSGDKHESRSERYTYIPTINIINKLRDEGFQPFFACQSRVRDL
                     GRREYSKHMLRLRREGNINGQEVPEIILLNSHDGSSSYQMIPGIFRFVCTNGLVCGNN
                     FGEIRVPHKGDIVGQVIEGAYEVLGVFDKVTXNMEXMKEIHLNSDEQHLFGRAALMXR
                     YEDENKTPVTPEQIITPRRREDKQNDLWTTCQRVQENMIKGGLSGRSASGKNTRTRAI
                     TGIDGDIRINKALWVIAEQFRKWKS"
     gene            complement(38785..39072)
                     /locus_tag="UM146_RS24930"
     CDS             complement(38785..39072)
                     /locus_tag="UM146_RS24930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000107526.1"
                     /translation="MSTRNIHVNTASYTILVAGREKNTGEEWDVLEFSSLTELKKYRK
                     SHPEKMAFSYSYALSRGVDTQFRHINIAEADHFKQFLRQIKRAGLDIRAIC"
     gene            39136..39372
                     /locus_tag="UM146_RS28310"
     CDS             39136..39372
                     /locus_tag="UM146_RS28310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001404411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001337416.1"
                     /translation="MTFCGDLPFVPSGIHHHLFENLRRKGHHCHGLTHLSWAERKIFY
                     RVLGKKFCGLFIYPGQSVRQVVAVSAPGDRGLNR"
     gene            39373..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
                     /pseudo
     CDS             39373..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001304227.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
     CDS             complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stable plasmid inheritance protein"
                     /protein_id="WP_001302184.1"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
                     FMAYESGK"
     gene            complement(40422..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
     CDS             complement(40422..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406018.1"
                     /note="PsiA; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="WP_001276243.1"
                     /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRHQGNTLAEYPYAGAF
                     FRCLNGSRRISLSDLRFFMPSLTAEELHGXRLQWLYAIDVLIETQGEVCLLPLPGDAA
                     ERLFPSVRFXVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
                     TVGSWHARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKE
                     AGHAVREMERWMVPNKLREVA"
     gene            complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
     CDS             complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugation system SOS inhibitor PsiB"
                     /protein_id="WP_000845910.1"
                     /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDERRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     gene            complement(41627..43675)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
     CDS             complement(41627..43675)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077613624.1"
                     /translation="MSSGISAFLSKRGAGRANVRQDISNYKGMIMPVTKCEPETTRKA
                     SRKYAKTQETVLSALLAQTEEVSVPLASLIKSPLNVRTVPYSAESVSELAESIKGVGL
                     LQNLVVHTLPGDRYGVAAGGRRLAALNMLAERGIIPADWPVRVKVIPQELATAASMTE
                     NGHRRDMHPAEQIAGFRAMAQEGKTPAQIGDLLGYSPRHVQRMLKLADLAPVILDALA
                     EDRITTEHCQALALENDTARQVQVFEAACQSGWGGKPDVRVIRNLITESEVAVAGNSK
                     FRFVGADAFSPDELRTDLFSDDEGGYVDCVALDAALLEKLQAVAEFLREAEGWEWCAG
                     RMEPVGECREDAGTYRCLPEPEAVLTEAEEERLNELMARYDALENQCEESDLLEAEMK
                     LMRCMAKVRAWTPEMRAGGGVVVSWCYGNVCVQRGVQLRSEDDAADDADRTEQVQEKA
                     SVEEISLPLLTKMSSERTLAVQAALMQQPDKSLTLLAWTLCLNVFGSGAYSKPAQISL
                     ECKHYSLTSDAPSGKEGAAFMALMAEKARLAALLPEGWSRDMTTFLSLSQEVLLSLLS
                     FCTACSLNGVQTREYGHTSRSPLDTLESAIGFHMRDWWQPTKANFFGHLKKPQIIAAL
                     NEAGLSGAARDAEKMKKGDAAEHAEHHMKDNRWVPGWMCAPRPQTDATERTDNLADAA
                     "
     gene            complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
     CDS             complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958724.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF905 domain-containing protein"
                     /protein_id="WP_000006018.1"
                     /translation="MSEYFRILQGLPDGSFTREQAEAVAAQYRNVFIEDDQGTHFRLV
                     VRNNSGLVWRTWNFEDGAGYWMNHVIRNFGILK"
     gene            complement(43934..44500)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
     CDS             complement(43934..44500)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_001338037.1"
                     /translation="MMGAENINRRRHIMAVRGINKVILVGRLGKDPEVRYIPNGGAVA
                     NLQVATSETWRDKQTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSW
                     EDNGITRYVTEILVKTTGTMQMLGSAPQQNAQVQPQPQQNGQPQSADATKKGSAKTKG
                     RGRKAAQPEPQPQPPEGEDYWFSDDIPF"
     gene            complement(44487..44627)
                     /locus_tag="UM146_RS27575"
     CDS             complement(44487..44627)
                     /locus_tag="UM146_RS27575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001487054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001445060.1"
                     /translation="MRQAVAVMPLAAKVLKQVMVNTGGNKRQVPAKRQNRGSRNSTDD
                     GG"
     gene            44763..45221
                     /locus_tag="UM146_RS28315"
                     /old_locus_tag="UM146_24301"
     CDS             44763..45221
                     /locus_tag="UM146_RS28315"
                     /old_locus_tag="UM146_24301"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014639539.1"
                     /translation="MAPDXTTGRDPPQRREARFAKRRCALHPGGLLPGCQELRPRRDR
                     GGATEAARPERSLQAGGFASGMEARQGGDSSAGSVHDSPPRQGDARKRHKQENNKTDS
                     NQSSRKKKNSSSSSSSSSSRNNNIISNRQMTGLKRQKPPSERPRNERGGA"
     gene            45202..45396
                     /locus_tag="UM146_RS28320"
     CDS             45202..45396
                     /locus_tag="UM146_RS28320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001398402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077634798.1"
                     /translation="MKGAARERGPFQRHRRAVFSXRGQTGIYPPASPVSSGTQTNNHR
                     RDIGISKRAARQLLADVRKR"
     gene            complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
     CDS             complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="class I SAM-dependent methyltransferase"
                     /protein_id="WP_001298559.1"
                     /translation="MHSQLRERIRLMRARLDNAAPVAEIRAESQLFVSPAPICDRLVT
                     LAEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCG
                     DFMEWQSVQYYSRIIMNPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLP
                     FSDVREELPRGTFAYTDVPTMIIRLRA"
     gene            complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
     CDS             complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF3560 domain-containing protein"
                     /protein_id="WP_000170697.1"
                     /translation="MTLAAITMTAPEAASPVQMYRATYSPDDNKLRLYAASRLDPETY
                     KKVHDAGFRWAPXQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGY
                     SGKRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFER
                     AEYWEERARSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLD
                     LNMAKLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRC
                     HERQIQHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVN
                     KSNGAVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPG
                     EGFREMTKAQWAALPRDCKAVRSVEEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEI
                     PQK"
     gene            complement(47330..47560)
                     /locus_tag="UM146_RS25000"
     CDS             complement(47330..47560)
                     /locus_tag="UM146_RS25000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000155844.1"
                     /translation="MTISIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIAR
                     SFHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
     gene            complement(47780..47899)
                     /locus_tag="UM146_RS27600"
     CDS             complement(47780..47899)
                     /locus_tag="UM146_RS27600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001332787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032292014.1"
                     /translation="MPLAAKVLKRVKFIPQGIQQQVPAKRQNRGSQNSTGDVL"
     gene            47819..>48040
                     /locus_tag="UM146_RS28325"
                     /pseudo
     CDS             47819..>48040
                     /locus_tag="UM146_RS28325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001756240.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(47981..48231)
                     /locus_tag="UM146_RS27605"
                     /pseudo
     CDS             complement(47981..48231)
                     /locus_tag="UM146_RS27605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001365574.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(<48373..48604)
                     /locus_tag="UM146_RS27610"
                     /pseudo
     CDS             complement(<48373..48604)
                     /locus_tag="UM146_RS27610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001418877.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
     CDS             complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001027516.1"
                     /translation="MNISTETREILRNYRAVINARRREMGQKPLTTAQIVDEICDFVA
                     NQQAVFLGGHYILQGSRNR"
     gene            complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
     CDS             complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1380 domain-containing protein"
                     /protein_id="WP_000271708.1"
                     /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTD
                     DELETVMQRLDDAFVYGACDRVVSDIVNELMEEKRASRHVTVPAVMLEKVMALAGSEM
                     KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     gene            complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
     CDS             complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="WP_001198903.1"
                     /translation="MQYAKPVTLNVEECDRLSFLPYLFGLDFLYAEASVYTLAKKMMP
                     EYEGGFWHFIRLPDGGGYMMPDGDRFHLVNGENWFDRTVSADAAGIILTSLVINRQLW
                     LYHDSGDAGLTHLYRMRDAQLWSHIEFHPECNAIYAALD"
     gene            complement(49577..50129)
                     /locus_tag="UM146_RS27615"
                     /pseudo
     CDS             complement(49577..50129)
                     /locus_tag="UM146_RS27615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001450806.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(50020..50790)
                     /locus_tag="UM146_RS28330"
                     /old_locus_tag="UM146_24341"
     CDS             complement(50020..50790)
                     /locus_tag="UM146_RS28330"
                     /old_locus_tag="UM146_24341"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001007109.1"
                     /translation="MNEXLNALIYRHASNLLLAQGWPEETDVDQRNPKYPGWISIYVR
                     LDAPRLATLLIXRHGGVLPPLLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
                     PYAGEWLAEDEIRAVLGAVRDAVCSVSYQVAEDARRIRAALTTTGQTLLTRQTRRFRL
                     VVKESDHPCWLDEDDENLPVVLDAILNRGARFSSVEMYLVSECVEHILSSGLACDMLR
                     IPDEPPRRWFDRGVLREVVREARNEIRSMADXLAKIRK"
     gene            complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
     CDS             complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1380 domain-containing protein"
                     /protein_id="WP_000274516.1"
                     /translation="MYGTCETLCRXLAAKYXGDTPLMLVIWSPEEIQALXDGMDIXLX
                     DHEIRTVLARLEDIPEDQRTESGISSGXAMEIINNVXENRQVTVPAELLASLIQTAEQ
                     ALWKREWAAXDHGLAVPECVTRRQAVVNQVRILLKNNTHEND"
     gene            complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
     CDS             complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001104873.1"
                     /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
                     LTRQTLYRANRLFMEAYTEILELDSCFKD"
     gene            complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
     CDS             complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_000086169.1"
                     /translation="MSRFVLGNCIDVMARIPDNAIDFILTDPPYLVGFRDRSGRTIAG
                     DVNDDWLQPASNEMYRVLKKDALMVSFYGWNRVDRFMAAWKRAGFSVAGHLVFTKNYT
                     SKSAYVAYRHECAYILAKGSPARPRNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DNWFEPEAA"
     gene            complement(52264..52568)
                     /locus_tag="UM146_RS25040"
                     /pseudo
     CDS             complement(52264..52568)
                     /locus_tag="UM146_RS25040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052644.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
     CDS             complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001298677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001298677.1"
                     /translation="MLGGADNPNGELPSYITGADSWQLYERGELVDVLWGELEWSSPT
                     DDDELPEVTGPAWIVDNVAHYGG"
     gene            52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
     CDS             52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_000952372.1"
                     /translation="MLSREDFYMIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRAC
                     RPRRARTKGKVERMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKET
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSRDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRIYSNEKLVASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
     gene            53985..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
     CDS             53985..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_012602155.1"
                     /translation="MMHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQ
                     QEWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVI
                     LLGPPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYA
                     RVLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAI
                     LDRLLHHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVKSGQHQ"
     gene            complement(54779..55678)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
     CDS             complement(54779..55678)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001351247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF1281 domain-containing protein"
                     /protein_id="WP_001351247.1"
                     /translation="MRHGLMEAVCERRIPMPNWCSNRMYFSGEPAKIAEIKRLASGAV
                     TPFYRRATNEGIQLFLAGSAGLLQTTEDVRFEPCPGLTAAGRGVLSPENITFTRWLKH
                     LQDGVLLDEQNCLMLHELWLQSGTGQRRWEGLPDDVRETITVHFTAKRGDWCDIWGNE
                     DVSVWWNRLCDNVLSEKTMPFDLLTVLPTRLDIEVNGFNGGVLNGVPSAYHWYTERYG
                     VKWPCGYDLNISSQGENFIQVDFDTPWCQPESDVVAELSRRFGCTLEHWYAEQGCNFC
                     GCVNATMFDRYLPFSCPLRYFRY"
     gene            complement(55647..55916)
                     /locus_tag="UM146_RS27625"
                     /old_locus_tag="UM146_24381"
     CDS             complement(55647..55916)
                     /locus_tag="UM146_RS27625"
                     /old_locus_tag="UM146_24381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310013.1"
                     /translation="MWLYACCGLLCPAYPQHFVHGSVDKILGYPGRAGTLIGLHPMQV
                     CRCRRPPHPVTFRRSSSTRCGFGAAPAFVCGRPVTGAARPDGGRM"
     gene            complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
     CDS             complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000343765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3 family transposase"
                     /protein_id="WP_000343766.1"
                     /translation="MDEKSLYAHILNLTAPWQVKSLTLDENAGSVTVTVGIAENTQLT
                     CPTCRKSCSVHDHRHRKWRHLDTCQFMTLVEADVPRVMCPEHGCQTLPVPWAGSGSRY
                     TLLFESFVLSWLKISTVDAVRKQLKLSWNAVDGIMTRAVKRGLSRIKKPLSVRHMNVD
                     EVAFKKGHRYITVVSDRDGRALALTDDRGTESLASYLRSLTDSQLLAIKTLSMDMNAG
                     YIRAARIHLPNAVEKIAFDRFHVAKQLGEVVDKTRQNEHPHLPVESRRQAKGTRFLWQ
                     YSDKWMTESRQEKLMWLREQMQQTSQCWTLKELAKNIWDRPWSTERRNDWLQWISRAS
                     ECDVPMMKNAAKTIKKRLYGILNAMRHRVSNGNAEALNSKIRLLRIKARGYRNRERFK
                     LGVMFHYGKLNMAY"
     gene            complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
     CDS             complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ClbS/DfsB family four-helix bundle protein"
                     /protein_id="WP_000115885.1"
                     /translation="MSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKG
                     TEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL
                     SYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRL
                     RKWAKNNNISLK"
     gene            57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
     CDS             57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DinI family protein"
                     /protein_id="WP_000619112.1"
                     /translation="MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRID
                     QGSAPSVSVTGARNDKGKERIQSLLEEIWQDDSWLPAA"
     gene            58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
     CDS             58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_000109079.1"
                     /translation="MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDL
                     NSYCISRPAATFFLRTSGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKR
                     LLLRPRPALEPVSDSPEFRTLYPENICIFGIVTHVIHRTRELR"
     gene            59005..59873
                     /locus_tag="UM146_RS25085"
                     /pseudo
     CDS             59005..59873
                     /locus_tag="UM146_RS25085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000538103.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V"
     gene            complement(59878..60306)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
     CDS             complement(59878..60306)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stable plasmid inheritance protein"
                     /protein_id="WP_012602156.1"
                     /translation="MKLSRLSKRSNIVDDERKRKKYTLYLHPEKAADFQTLEAIESVP
                     RSERGELFRNAFISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQAD
                     IRTVLTELGASQSVEKMPPSATDSVQEAMNDVRLKMKKLF"
     gene            complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
     CDS             complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001103694.1"
                     /translation="MNVYCDDGSTTIKLAWNDNGKICKSLSQNSFRHGWKVDGLGIRQ
                     TFNYELDGKKYTYDEVSNQSILTTHIEYQYTDVNLLAVHHALLNSGLAPQPVSLTVTL
                     PISEFYTKECQKNELNIQRKIENLMRPIRLNKGDVFTIEHVDVMPESLPAVFSRLVVD
                     KVGQFEKSLVVDIGGTTLDVGVIVGQFDSVSAIHGNSGIGVSSVTKAAMSALRMASSD
                     TSFLVADELIKRRNDPDFVRQVINDETKTDLVLNTIEGAIASLGEQVVNELGDFHHVN
                     RVYVVGGGAPLIYDSIKTAWHHLGQKVVMMESPQTALVEAIAAFKEE"
     gene            61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
     CDS             61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_000633911.1"
                     /translation="MITVVGGNKGGSGKTTIASNLAIALANKGREVCLLNGDLQRTAA
                     KHHAEREAAGLLPAITLVEKFDNLTQTLQALNEKFDDVIVDVAGRNSKEFITSGVVAH
                     QIIAPLQCSQPDLDTLTELEQQIDAMRNLNPELKVYCLQSMATTNPVLRGNERKEFLE
                     YLEEFPTIQVLDSVICFRKVYRDCMSNGTGVVETNNTAAKAEIEHLMNEVFGPW"
     gene            62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
     CDS             62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000239529.1"
                     /translation="MVKKPSQQALNRAAVTVEQAEALAQRLADKPYGAPEKPEPEKQC
                     RTTISLGESMLVTIEDLALRNKRNGKDPKNVSAIVRVALEQYLKTLT"
     gene            complement(62526..63334)
                     /locus_tag="UM146_RS25110"
                     /pseudo
     CDS             complement(62526..63334)
                     /locus_tag="UM146_RS25110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406044.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
     gene            complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
     CDS             complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052635.1"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin CcdB"
                     /protein_id="WP_001159871.1"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     gene            complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
     CDS             complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin CcdA"
                     /protein_id="WP_000813634.1"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     KAENQEGMAEVARFIEMNGSFADENRDW"
     gene            64498..64725
                     /locus_tag="UM146_RS27630"
     CDS             64498..64725
                     /locus_tag="UM146_RS27630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001310015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310015.1"
                     /translation="MADLNLIPENCQRCEDEESITAKAVIPPHPASSYVETYVGRAVP
                     TGQYRIDRPSGPLTSLYDKGGLANYCTVSLF"
     gene            complement(65965..66195)
                     /locus_tag="UM146_RS27635"
     CDS             complement(65965..66195)
                     /locus_tag="UM146_RS27635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322637.1"
                     /translation="MSAFTFSPSRHDGPGTEVYGRPPGILSAQLSYPAGAPPAVFFPG
                     ADFPGTYSFRSYPQNLWITVAPLLREKALLTA"
     gene            66182..66823
                     /locus_tag="UM146_RS25125"
     CDS             66182..66823
                     /locus_tag="UM146_RS25125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000990667.1"
                     /translation="MNADTWTRLQAFRHALELTSCEASLTAGYDHLKDFPAGCSELAS
                     QTLTDYLTEDGSNLYSCIVGMQWDNGPGRYGHVIADPARDYIDLTLDQFPGYHNRIVA
                     EPVESGGQLAADLNREPAISTADGIVASPSDKVNYITEQKNRQPMVIITECYKLIRMT
                     ARFIPMCQSSQLFQHQVFPRLFIISDVGSCSLFRNTLDRLATDWKVTLSILSL"
     gene            66880..67086
                     /locus_tag="UM146_RS27640"
     CDS             66880..67086
                     /locus_tag="UM146_RS27640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322638.1"
                     /translation="MFEDPEIRIHKLQPCTLCPRLEDLRFSWYFHYIHDRCLRSSACH
                     QDPVTLSTDRLWHTVGLVRSRVNN"
     gene            67251..67687
                     /locus_tag="UM146_RS25130"
                     /pseudo
     CDS             67251..67687
                     /locus_tag="UM146_RS25130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001337924.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
     CDS             67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepB family plasmid replication initiator
                     protein"
                     /protein_id="WP_001309253.1"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKFFCIHYRRPR
                     LKAPNDESKENQLPPSPAEKISPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
     CDS             complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405908.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_001066947.1"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGVRPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWPVTDETMRNWLKQAV
                     KRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLK"
     gene            complement(70078..70266)
                     /locus_tag="UM146_RS25150"
     CDS             complement(70078..70266)
                     /locus_tag="UM146_RS25150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001309252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001332784.1"
                     /translation="MASDTFSCRRRLSAGFFSVSACSWHYPNSPKNGKPALSPHHDWL
                     KTGSLRQNAPLRIWFYPQ"
     gene            70633..>70919
                     /locus_tag="UM146_RS27645"
                     /pseudo
     CDS             70633..>70919
                     /locus_tag="UM146_RS27645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001363099.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            70953..71801
                     /locus_tag="UM146_RS25155"
     CDS             70953..71801
                     /locus_tag="UM146_RS25155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016245172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016245172.1"
                     /translation="MAFIYVLYCAFDFDQSVKDNSGWLSILSIGVLIVVISAIINTRY
                     LEYDLSFKNNRMKLLRRVQIYLIIPLSIALLVHLQVIPLEMVFRNIETSDKSINFKVI
                     AELAFMSYFIFILTILPGLIYLKMNPQHKLSKRISSAFVASLMILLVISTQITVLPVI
                     FTHSVIKLSGISDFKIHSYIIKTSEYPEEFFSNAVWGKKNIKPGEYYSVQAVSMFTTN
                     QFILLCPKDIIRFYRESWKFDLLNVDFDTNTRKKLQEEAAYCVPISAISVKRWDMPLQ
                     GSKPSN"
     gene            complement(72648..72919)
                     /locus_tag="UM146_RS27655"
                     /pseudo
     CDS             complement(72648..72919)
                     /locus_tag="UM146_RS27655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322642.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            complement(73366..73925)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
                     /pseudo
     CDS             complement(73366..73925)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611435.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            73891..>73980
                     /locus_tag="UM146_RS27665"
                     /pseudo
     CDS             73891..>73980
                     /locus_tag="UM146_RS27665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001533573.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="PapC protein"
     gene            74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
     CDS             74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_001298664.1"
                     /translation="MYMNVIRNVICTLIILPIGLQAETSHSSMAKDTITVVATGNQNT
                     VFETPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVL
                     VLVDGIRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADF
                     LPPGETNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGERAP
                     NKEKPAALFAKGSVGITDSNKAGASLRLYRNNTTEPGNPTQTHGDSGLRDRKTVQNDV
                     QFWYQYAPVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFP
                     GAHQLSYGAEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDR
                     YKSFNPRAGELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRK
                     GKPNYWVPNLNLKPENNITREIGAGIQLDGLLTGNDRLQLKGGYFGTDARNYIATRVD
                     MKRMRSYSYNVSRARIWGWDMQGNYQSDYFDWMLSYNRTESMDASSREWLGSGNPDTL
                     ISDISIPVGHGGVSAGWRAELSAAATHVKKGDPHQAGYAVHSFSLSYKPVSVKGFEAS
                     VTLDNAFNKLAMNGKGVPLSGRTVSLYTRYQW"
     gene            76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
     CDS             76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405912.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF4198 domain-containing protein"
                     /protein_id="WP_000977394.1"
                     /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNITAEIGYGHN
                     FPSKGTIPDRRNFFENPRIYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGY
                     WSRTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLS
                     DISRFSEDVKLKVLYKTSPLAGAIMELDSVSYLKSSRHTHAVEHKHPVHKAELTFVTN
                     EDGIVTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
     gene            complement(76993..>77601)
                     /locus_tag="UM146_RS27670"
                     /old_locus_tag="UM146_24511"
                     /pseudo
     CDS             complement(76993..>77601)
                     /locus_tag="UM146_RS27670"
                     /old_locus_tag="UM146_24511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000099160.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     STS             77015..77097
                     /standard_name="RH124512"
                     /db_xref="UniSTS:161334"
     gene            complement(77669..78451)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
     CDS             complement(77669..78451)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001300609.1"
                     /translation="MMMELQHQRLMVLAGQLQLESLISAAPALSQQAVDQEWSYMDFL
                     EHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIER
                     NENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQ
                     RGVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGD
                     AALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     gene            complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
     CDS             complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_001310017.1"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRGFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     gene            complement(<79556..80501)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
                     /pseudo
     CDS             complement(<79556..80501)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000099160.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family transposase"
     gene            complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
     CDS             complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004966400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence hypothetical
                     protein"
                     /protein_id="WP_000612626.1"
                     /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTTLKDDPMSGHVF
                     IFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLEGIDW
                     RQPKRLLTSLTML"
     gene            complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
     CDS             complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000839180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family insertion sequence hypothetical
                     protein"
                     /protein_id="WP_000839179.1"
                     /translation="MKSLTAVRKKSPNYPVEFKIKMVELSHRPEISVAQLAREHGIND
                     NLLFKWRQYWREGKLRPPSTTENNVPELLPITLDAEDVVPTTSPRSQPVAAATPESLN
                     ISCEVTFRHGSLRLNGAISENILNLLIRELKR"
     gene            complement(<81375..>81716)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
                     /pseudo
     CDS             complement(<81375..>81716)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611849.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(81800..83323)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
     CDS             complement(81800..83323)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
                     /protein_id="WP_000587108.1"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRIVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGR
                     WVIEGDLSSYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVP
                     QGGVISPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPA
                     VAYCRYADDFVLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLG
                     HRIIRKRSRYGEMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWA
                     MFYQFVDFKAKVFSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLF
                     GKTNHGKLSGEILYWLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
     gene            83277..83702
                     /locus_tag="UM146_RS25225"
     CDS             83277..83702
                     /locus_tag="UM146_RS25225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323220.1"
                     /translation="MAAHVASLRCISLIIKGLHLVRSVNSRRKHIQTASLRHVMGFPH
                     RGLLRKLRQPARHRSHAPLTSVADLPRFTCLDSGILRRLPVALFILACRKLAEVSNAS
                     VIDAAAPVFRIHVKTPSTGSAYVSLPVPPARPVRSRRPW"
     gene            83617..83988
                     /locus_tag="UM146_RS25230"
     CDS             83617..83988
                     /locus_tag="UM146_RS25230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011478084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011478084.1"
                     /translation="MSKHLRPVVLTYHCQFLLHGLSDHVGRGDVFNPQRRINGFMFFS
                     LSVLNLEDHLGLVISPQSPLSAGYITLRACRRSLPLRFSTVTPGGIVGFLIVSYRFNI
                     PDRLAVHLSIHARPELRAHRK"
     gene            complement(<84032..84337)
                     /locus_tag="UM146_RS27675"
                     /pseudo
     CDS             complement(<84032..84337)
                     /locus_tag="UM146_RS27675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005115865.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
     CDS             84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000174402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_000143800.1"
                     /translation="MTFNTSQVSYYMTQRKKGITQHISAMKAGISVRSGRRIEKGEWA
                     KNSVRHWRTRKDPLEAVWDSMLVPLLKERPALTPTTLLEMLQDKYPGQYPNSLRRTMQ
                     RRVCEWKLQYGAEQEVMFRQRHQPGLRGLSDFTELKGVVVTIAGKLLAHKLYHFRLEW
                     SHWSWMRVVLGGESFSALAEGLQEALGQLGGVPVEHKTDSLRAAWKQQGEDGRRELTE
                     RYAALCQHYGMQGVHNNAGRGHENGSVESAHGHLKRRICQALILRGSNDFSTIEEYQA
                     FITQQVMRHNRNNQDLVKEERLHLKPLPLRRSADYDELTVRVSRSSTINVKHVVYSVP
                     SRLVGQLLRVRLWDDRLSCYVGSSEVMSCPRVRPEKGKTRARRIDFRHVIDSLAKKPG
                     AFCHATLRNDILPDDEWRRLWRRLCNHLEPDMAGRLMVHALKLAAGYDDISVVAKGME
                     QMLNTPGNVDLHRLMRFLGIKEKALPVVNVKQHNLSSYEQLLRGKGGSQ"
     gene            85913..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
     CDS             85913..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001522280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_000065240.1"
                     /translation="MSNIHHLERSLRKLRLTRVGAEWHALEKRALAEGWTPSRYLLTL
                     CNEELLWRESEKLRRYKKEARLPVAKTLSEYDFSQVPELNGAQFRQLCETTDWVDAGE
                     NVLLFGASGLGKSHLAAAIVDGVVGQGYRARFYSAGELLQELRKARAQLKLNELLLKL
                     DRYRVIVVDDLGYVKRDSAETGVLFELIAHRYERGSLVITSNHPFSMWGSIFVDETMA
                     VAAADRLIHHGYMFELKGESYRKKTAKAVTSAT"
     gene            complement(86559..87136)
                     /locus_tag="UM146_RS28335"
                     /pseudo
     CDS             complement(86559..87136)
                     /locus_tag="UM146_RS28335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076612086.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(87162..87470)
                     /locus_tag="UM146_RS28340"
                     /pseudo
     CDS             complement(87162..87470)
                     /locus_tag="UM146_RS28340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011114748.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(87990..89264)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
     CDS             complement(87990..89264)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enterotoxin"
                     /protein_id="WP_001446689.1"
                     /translation="MDIWRGHSFLMTISARFRQYVFSLMSILLQERKMNIFTLSKAPL
                     YLLISLFLPTMAMAIDPPERELSRFALKTNYLQSPDEGVYELAFDNASKKVFAAVTDR
                     VNREANKGYLYSFNSDSLKVENKYTMPYRAFSLAINQDKHQLYIGHTQSASLRISMFD
                     TPTGKLVRTSDRLSFKAANAADSRFEHFRHMVYSQDSDTLFVSYSNMLKTAEGMKPLH
                     KLLMLDGTTLALKGEVKDAYKGTAYGLTMDEKTQKIYVGGRDYINEIDAKNQTLLRTI
                     PLKDPRPQITSVQNLAVDSASDRAFVVVFDHDDRSGTKDGLYIFDLRDGKQLGYVHTG
                     AGANAVKYNPKYNELYVTNFTSGTISVVDATKYSITREFNMPVYPNQMVLSDDMDTLY
                     IGIKEGFNRDWDPDVFVEGAKERILSIDLKKS"
     gene            complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
     CDS             complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin Js receptor"
                     /protein_id="WP_001100763.1"
                     /translation="MNVIKLAIGSGILLLSCGAYSQSISEKTNSDKKGAAEFSPLSVS
                     VGKTTSEQEALEKTGATSSRTTDKNLQSLDATVRSMPGTYTQIDPGQGAISVNIRGMS
                     GFGRVNTMVDGITQSFYGTSTSGTTTHGSTNNMAGVLIDPNLLVAVDVTRGDSSGSEG
                     INALAGSANMRTIGVDDVIFNGNTYGLRSRFSVGSNGLGRSGMIALGGKSDAFTDTGS
                     IGVMAAVSGSSVYSNFSNGSGINSKEFGYDKYMKQNPKSQLYKMDIRPDEFNSFELSA
                     RTYENKFTRRDITSDDYYIKYHYTPFSELIDFNVTASTSRGNQKYRDGSLYTFYKTSA
                     QNRSDALDINNTSRFTVADNDLEFMLGSKLMRTRYDRTIHSAAGDPKANQESIENNPF
                     APSGQQDISALYTGLKVTRGIWEADFNLNYTRNRITGYKPACDSRVICVPQGSYDIDD
                     KEGGFNPSVQLSAQVTPWLQPFIGYSKSMRAPNIQEMFFSNSGGASMNPFLKPERAET
                     WQAGFNIDTRDLLVEQDALRFKALAYRSRIQNYIYSESYLVCSGGRKCSLPEVIGNGW
                     EGISDEYSDNMYIYVNSASDVIAKGFELEMDYDAGFAFGRLSFSQQQTDQPTSIASTH
                     FGAGDITELPRKYMTLDTGVRFFDNALTLGTIIKYTGKARRLSPDFEQDEHTGAIIKQ
                     DLPQIPTIIDLYGTYEYNRNLTLKLSVQNLMNRDYSEALNKLNMMPGLGDETHPANSA
                     RGRTWIFGGDIRF"
     gene            complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
     CDS             complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="energy transducer TonB"
                     /protein_id="WP_000981091.1"
                     /translation="MMNILHFSQSVKWSSWFICSLLLHGLIFLAFIWRFSEVQPAMSP
                     APAIMLQWAEIIEAPSSPLSLPVGIAQQESAVTEEKQQTEDRQQRPVTEDSDATIEIT
                     RKKKSSDGEKKKTRPPRKIKAQTSDSNPTAVSSNAAPQALVESSRIAAPFNSDSTKRD
                     NSEASWESRVKGHLNRYKRYPGDARKRARTGTAVVTFTVNTEGTIVSSFLEISSGTFS
                     LDREAIAVLERAQPLPKPPPEILEGGLFKVKMPITFKLKE"
     gene            complement(92448..93365)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
     CDS             complement(92448..93365)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulator CjrA"
                     /protein_id="WP_001446690.1"
                     /translation="MSINIWKHIVSDGNMRKFILISMITLASVSLGACRQNVTIKQDA
                     PGQKAFLTDGQIYDLHSGKIISSSELLADLATAQHLIIGEKHDNAEHHQIELWLIQNL
                     LIQRPQGSVLLEMLTSEQQPRVNQVKCWLKDNPVVRDSRVQELLNWQKGWSWEMYGDI
                     VMQLLRGPYPLLNANIGREQILALYKKNEFPKGKKSTAPVVQEALRETIISMHEGNLE
                     SQQLTSMLSIQQQRDRYMARQLLSAPVPSLLIAGGYHASKSMGVPLHMEDLATGTHPV
                     VLMLAEKGMNITVDHADYVWFVAPDTTKR"
     gene            complement(93655..94221)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
     CDS             complement(93655..94221)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
                     /inference="COORDINATES: protein motif:HMM:PF03090.15"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Rep protein"
                     /protein_id="WP_001013138.1"
                     /translation="MNGHAHLLYALNIAVRTAPDSSVKALKYAAAIERSLCEKLCADV
                     NYSGLICKNPFHLEWQVMEWREEAYTLDELADYLDLSASARRSIDKHYGMGRNCHLFE
                     MTRKWAYRAIRQGWPEFSQWLDAVIQRVEMYNASLPVPLSPPECRAIGKSIAKYTHRN
                     FTPETFAQYVADTHTLTYVFVPLALTPR"
     gene            94210..94464
                     /locus_tag="UM146_RS28345"
     CDS             94210..94464
                     /locus_tag="UM146_RS28345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001298666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001332607.1"
                     /translation="MTVHRIFYGDVRRGSVPVAPVNRCPLAINVKNQPELRMRLVLPD
                     LDMISGAFVFQSLTLHPTANPVDPSRKTDPFTITPVVRTP"
     gene            94798..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
     CDS             94798..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000872630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000872630.1"
                     /translation="MKYDFINGSSILIIVWMTIAVIIRVTNWKFNKKTAPAISLFLAF
                     PASIVILLVYIFFFDK"
     gene            complement(95380..95562)
                     /locus_tag="UM146_RS27690"
     CDS             complement(95380..95562)
                     /locus_tag="UM146_RS27690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322410.1"
                     /translation="MFPIFILFIIYWLYVKSIISLMIKMVSGVRISENKGCNMLFFLC
                     KYLRILNHSTRMIMYM"
     gene            95566..95775
                     /locus_tag="UM146_RS27695"
     CDS             95566..95775
                     /locus_tag="UM146_RS27695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322411.1"
                     /translation="MLYKIFTLNTKIKTTIITICALSYNLTAQASPSYRPRDRVNKTM
                     IELQTNGVERQLLDNSCGISSGVFK"
     gene            complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
     CDS             complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin transporter"
                     /protein_id="WP_001080732.1"
                     /translation="MNRKYYFNNMWWGWVTGGYMLYMSWDYDFKYRLLFWCISLCGMV
                     LYPVAKWYIEDTALKFTRPDFWNSGFFTDTPGKMGLLAVYTGTVFILSLPLSMIYILS
                     VIIKRLSVR"
     gene            complement(96106..96324)
                     /locus_tag="UM146_RS27700"
     CDS             complement(96106..96324)
                     /locus_tag="UM146_RS27700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012602137.1"
                     /translation="MLRHIFLLSIRAMARAFFCSKVTGAPPFHDVNVTQLIVIDYYYH
                     AVVMLSCISTLTKVQKKGKLADEQKILF"
     gene            96257..96604
                     /locus_tag="UM146_RS25295"
     CDS             96257..96604
                     /locus_tag="UM146_RS25295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405930.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000142452.1"
                     /translation="MTFEQKKARAIALMDSKKMWRSNYAPPLLRILWRLGIRLPPLPF
                     MPFWQVTVLTGGLWGISWGCAMWFIYWGPSGMVAGEAIIISITGGFLSGLLMASFHWW
                     RRKVNRLPPWDDV"
     gene            complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
     CDS             complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000194542.1"
                     /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGPVLTRDIERVLEQSGEA
                     PVYGPNLRASCRRLEDAGWLRTLRAPNLQLAVELTDAGRAVAQPLLPAGGTSATDLAV
                     ELNGITYQACRGDFVVRLDGSTCLQLWNKEGRVVRREGDPLEVAQWLQACHDAGMEVR
                     VQINESAAP"
     gene            complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
     CDS             complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000371882.1"
                     /translation="MDQEMTFSLSYEQLTRFAEKRIRECNLDSHGVTYLCESAKAGAV
                     LIFWHELAINGYTSMNAIKRQEIIDADHQRLRKLIWPEDDWK"
     gene            97492..>97743
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
                     /pseudo
     CDS             97492..>97743
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001491986.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            97818..>98174
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
                     /pseudo
     CDS             97818..>98174
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001758929.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(98224..98595)
                     /locus_tag="UM146_RS27705"
     CDS             complement(98224..98595)
                     /locus_tag="UM146_RS27705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011478084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011478084.1"
                     /translation="MSKHLRPVVLTYHCQFLLHGLSDHVGRGDVFNPQRRINGFMFFS
                     LSVLNLEDHLGLVISPQSPLSAGYITLRACRRSLPLRFSTVTPGGIVGFLIVSYRFNI
                     PDRLAVHLSIHARPELRAHRK"
     gene            complement(98510..98935)
                     /locus_tag="UM146_RS27710"
     CDS             complement(98510..98935)
                     /locus_tag="UM146_RS27710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323220.1"
                     /translation="MAAHVASLRCISLIIKGLHLVRSVNSRRKHIQTASLRHVMGFPH
                     RGLLRKLRQPARHRSHAPLTSVADLPRFTCLDSGILRRLPVALFILACRKLAEVSNAS
                     VIDAAAPVFRIHVKTPSTGSAYVSLPVPPARPVRSRRPW"
     gene            98889..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
     CDS             98889..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_415888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000587098.1"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRISIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMI
                     RQWERSQ"
     gene            complement(99431..99751)
                     /locus_tag="UM146_RS28350"
                     /old_locus_tag="UM146_24646"
     CDS             complement(99431..99751)
                     /locus_tag="UM146_RS28350"
                     /old_locus_tag="UM146_24646"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001351254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001351254.1"
                     /translation="MGTMDPTFNPVITDDSAAFSQKAVQAMEKERSQMQLDDSYQLLA
                     QMTDYKDSPSCKEKQQCSLTEAKDAFREGANKQVMSSQADSLIKISRIWADFCPANTS
                     NQPI"
     gene            complement(99726..100175)
                     /locus_tag="UM146_RS28355"
                     /old_locus_tag="UM146_24651"
     CDS             complement(99726..100175)
                     /locus_tag="UM146_RS28355"
                     /old_locus_tag="UM146_24651"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-1-phosphatase"
                     /protein_id="WP_001323222.1"
                     /translation="MKKLILAAAVAGAVLLSSAAQAQTTPEGYQLQQVLMMSRHNLRA
                     PLANNGSVLEQSTPNQWPEWDVPGGQLTTKGGVLEIYMGHYMREWLAELGMVTSGECP
                     TPDTVYTYANSLQRTVATAQFFITGAFPGCDIPVHHQEKNGHDGPNV"
     gene            complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
     CDS             complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000874189.1"
                     /translation="MAFIWNDESLAILRENAGILTTEQIAQLLHTNITAVRNMAYRLK
                     LSLRVTAYNHRRIAQVQALYASETLSLKEIAAKTGLTASTVQYIVYVKSKNKPYATTE
                     YVSFETENAVHYRVQKEFVDTERSLLDNISDNTRFRELYLTDGTFYCARNIKYEVFIS
                     E"
     gene            complement(100807..101361)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
     CDS             complement(100807..101361)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TlpA family protein disulfide reductase"
                     /protein_id="WP_012602139.1"
                     /translation="MGSLPTVFCGCNTVNIWVRRPINMRWHNVLLLAAAILISGCKEE
                     KLAVGAPAPALAAFDLQGQESGLERWQGKAVYLNFWSAGCGGCLAEMDTLEALSKKWG
                     DKVVVVAVNTDPETVRINDLLAKHQITYPVVRDQLNITQERYQVIGTPTSVLIDSEGR
                     VLELHQGMRKPSELEATFARLAAR"
     gene            complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
     CDS             complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000117262.1"
                     /translation="MSVTHIPQVAIETRHLYKRFGDVTALDDINLRIAQGEFVAIMGA
                     SGSGKTTLMNILTCLDTATEGQVFLDGTDAAALDEEGRRRFRAEKIGLVFQQFHLIPF
                     LTALENIMLAQHYHSVVDEAAARKVLEQVGLGHRVTHLPSQLSGGEQQRVCIARALVN
                     EPPVIFADEPTGNLDEENEQRVLDLLTDLHRQGRTIVMVTHNPALGQFADRILRLQHG
                     KYLGEEANQHALA"
     gene            complement(101979..103138)
                     /locus_tag="UM146_RS25350"
                     /old_locus_tag="UM146_24671"
                     /pseudo
     CDS             complement(101979..103138)
                     /locus_tag="UM146_RS25350"
                     /old_locus_tag="UM146_24671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405940.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
     gene            complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
     CDS             complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000964653.1"
                     /translation="MLWRMLRQSWGRNLRRKVLAIITVFLASSLISALLAVSIDIGDK
                     MSRELKSYGANILIEPAGQAALPALFSESSNPLSGQDFLDEAELPNIKDIFWRNNIVG
                     FAPMLGGEASVEGEPVRILGTFFSQPVDIPDEEGYETGQKTVSPYWQVTGDWPQEPAG
                     AEPQTLVGHALARQMGWKPGDKLTLRTEGEAVQVTVSGILSSGGDEDNQLVMPLSTVQ
                     HLLGLPGKVQAIRVSALTVPENELSRRARENLDALNAEEYDLWYCTAYVSSIAHQLEE
                     AISGAEVRPVWQVAASEGVVIDKIQLLMAVVTVAALVASAMGIASLMTSTIMERAKEI
                     GLMKALGARQWQIMLLFYLEAASSGLAGGALGCIAGWGLAKAIGVMLFDAPLNFAWIV
                     VPCVLVIAVLIALIGTWFPARRIARLYPVEVLYGR"
     gene            complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
     CDS             complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2318 domain-containing protein"
                     /protein_id="WP_000119836.1"
                     /translation="MSYFFVTTLQVFFCIALLSGVLWSRNDPPSLRPLTWTLLTGLIA
                     GVLAGLFIHGSQPVQLLLVGAEVMVSLLFVLSFWWASTRIRYLWQGILIFGAARHWAL
                     DPNLGGLTSTHVLNTDLLLNLTAVVLAFAILCLAGVLCAMLLRRIRGLYWPLTLILLV
                     MIWLPLSGNLLLLLMKLQVVPLGKSLLSFVAKVTNNTALYNWAGAALLLALALCWLPA
                     LLRAFRQTRETEEPIAHRLALAQRRNALRLWLVTIGCAVVVIAGQLWWDKVASQPPQL
                     SEAVPVTLGSDGMVRLPVEQLRDGKLHRFVWVADDGKAVRFFVINRYPDKLRFGVVFD
                     ACLLCGDQGYVMEGNQVICVACGVHIFIPSIGKAGGCNPVPIENWHNDEKELVIPGKE
                     LATGVNYFSTVMTIKVTDPVDGSTLTNTSADYKYSYGGKTWFFSSEANYERFRETPEQ
                     FVPADMREE"
     gene            complement(105867..106397)
                     /locus_tag="UM146_RS27720"
                     /old_locus_tag="UM146_24686"
     CDS             complement(105867..106397)
                     /locus_tag="UM146_RS27720"
                     /old_locus_tag="UM146_24686"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_012602140.1"
                     /translation="MMTMKKTLIASAVMASIFIAPAAFAFKEYPAGEPVTMNEMELAA
                     VYLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDT
                     GEKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRW
                     WKPFDVSYEFKYVGLN"
     gene            complement(<106446..108380)
                     /locus_tag="UM146_RS25365"
                     /pseudo
     CDS             complement(<106446..108380)
                     /locus_tag="UM146_RS25365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405944.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="iron permease"
     gene            complement(108323..108508)
                     /locus_tag="UM146_RS27725"
     CDS             complement(108323..108508)
                     /locus_tag="UM146_RS27725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001332814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001332814.1"
                     /translation="MCSSRFDEINLHNLSSADIFMIQVMYNATKRYDNNYHLYSLAVC
                     TCVTSVTLCWLLSLACL"
     gene            complement(108667..109482)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
     CDS             complement(108667..109482)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone reductase (Na(+)-transporting)
                     subunit C"
                     /protein_id="WP_012372823.1"
                     /translation="MIRSGDFFDFHFDRDNNSMRKGKIIVASMMVLCVLIFVAAAAWF
                     MLFQGEMTEPTEEEKQAAILHAAGLMKSETQDKKSVETLYHRYIIQRHVNLDSGELVA
                     GSSADTARQKCEKLAPERDPAQVRQRCTVADVFFVKDKNNEIQQVIIPVTGKGAKSMM
                     HAFLALGLDGRTVRNLYYYQQRETPFLGARVEDANWRKQWPGKRLLDNSGHPALKIVQ
                     DKPEHADEYTVDGISGATLTSTGVEKSINYWMGPQGYGQFLQRLASDRNNLNL"
     gene            complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
     CDS             complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide oxidoreductase"
                     /protein_id="WP_000949451.1"
                     /translation="MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLH
                     TLDGETVTLASISEERPVLLYFWASWCGICRFTTPDVARLQSEGESVMTIALRSGNDG
                     EVSRWLSRKRVTFPVVNDSGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKL
                     RLWRAAMF"
     gene            complement(110161..110388)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
     CDS             complement(110161..110388)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="scsC protein"
                     /protein_id="WP_077459403.1"
                     /translation="MANFATVPSTIILYIQTDPDEKSMETLSTNLQLARLVGVQGTPA
                     TIIGDEMIPGAVSWETLEAVVKEKLAVAHAQ"
     gene            complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
     CDS             complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_020324562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6 family transposase"
                     /protein_id="WP_001067837.1"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYLFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMGALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            111099..>111185
                     /locus_tag="UM146_RS28360"
                     /pseudo
     CDS             111099..>111185
                     /locus_tag="UM146_RS28360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001110652.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA"
     gene            111475..111606
                     /locus_tag="UM146_RS27735"
     CDS             111475..111606
                     /locus_tag="UM146_RS27735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001330800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA4"
                     /protein_id="WP_071531798.1"
                     /translation="MRELLCAVGVVPTRVYPKSGRISALAGRQGRLRACTEDFQPEH"
     gene            complement(112178..113047)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
     CDS             complement(112178..113047)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="incFII family plasmid replication initiator
                     RepA"
                     /protein_id="WP_001332847.1"
                     /translation="MQDGVTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVG
                     FTSRFDFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLA
                     IECGLATESGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFA
                     ALDVSEDAVAAARRSRVEWENKQRKKQGLDTLGMDELIAKAWRFVRERFCSYQTELKS
                     RGIKRARARRDANRERQDIVTLVKRQLTREISEGRFSASREAVKREVERRVKERMILS
                     RNRNYSRLATASP"
     gene            complement(113028..113102)
                     /locus_tag="UM146_RS25400"
     CDS             complement(113028..113102)
                     /locus_tag="UM146_RS25400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001365705.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="positive regulator of RepFIC repA1 expression"
                     /protein_id="WP_001365705.1"
                     /translation="MPGKVQDFFLCSLLLRIVSAGWCD"
     gene            113148..113294
                     /locus_tag="UM146_RS27745"
     CDS             113148..113294
                     /locus_tag="UM146_RS27745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001584988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA"
                     /protein_id="WP_071527739.1"
                     /translation="MLAPVIFFVAKHRKIIGVFAFLAPVNPHQNQFPATLRRGQPQNS
                     LNDQ"
     gene            complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
     CDS             complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_000078109.1"
                     /translation="MSQIENAVTSSPKRIYRKGNPLTGAEKQRISVSRKKGTHKAINV
                     FIQSELKDDLTQLCKDSGLTQKEMIEHWILKEKAAMTDANRK"
     gene            complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
     CDS             complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002405969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DUF2726 domain-containing protein"
                     /protein_id="WP_000766808.1"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERILSGGEYWQRQKTLLTEREVSFMKGLFRIVDMKRWYLCPQVRVADIVQLNGNIRP
                     RSRQWWQLFRMVSQWHVDVVIVERRSFSIVAAVELDDASHLRPERRRRDILLEEVLRQ
                     AGIPLLRSHDARKLLQMTGEWLNTTGAVQQSPEHRS"
CONTIG      join(CP002168.1:1..114550)
//
DBGET integrated database retrieval system