GenomeNet

Database: RefSeq
Entry: NC_017630
LinkDB: NC_017630
Original site: NC_017630 
LOCUS       NC_017630             114550 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Escherichia coli UM146 plasmid pUM146, complete sequence.
ACCESSION   NC_017630
VERSION     NC_017630.1  GI:386602509
DBLINK      Project: 162043
            BioProject: PRJNA162043
KEYWORDS    RefSeq.
SOURCE      Escherichia coli UM146
  ORGANISM  Escherichia coli UM146
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Complete genome sequence of adherent invasive Escherichia coli
            UM146 isolated from ileal Crohn's disease biopsy tissue
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 114550)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2010) Research and Testing Laboratory, 4321
            Marsha Sharp Fwy, Lubbock, TX 79407, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002168.
            To obtain a sample of UM146 E coli isolate please contact Denis
            Krause, denis_krause@umanitoba.ca
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..114550
                     /organism="Escherichia coli UM146"
                     /mol_type="genomic DNA"
                     /strain="UM146"
                     /db_xref="taxon:869729"
                     /plasmid="pUM146"
     gene            complement(41..199)
                     /locus_tag="UM146_24031"
                     /db_xref="GeneID:12703351"
     CDS             complement(41..199)
                     /locus_tag="UM146_24031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104018.1"
                     /db_xref="GI:386602510"
                     /db_xref="GeneID:12703351"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERNTVRR"
     gene            complement(237..446)
                     /locus_tag="UM146_24036"
                     /db_xref="GeneID:12703352"
     CDS             complement(237..446)
                     /locus_tag="UM146_24036"
                     /codon_start=1
                     /transl_table=11
                     /product="putative regulator"
                     /protein_id="YP_006104019.1"
                     /db_xref="GI:386602511"
                     /db_xref="GeneID:12703352"
                     /translation="MAKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLXXSERESFNSAA
                     DHRLAELITGKLYDRIPKEIWKYVR"
     misc_feature    complement(249..419)
                     /locus_tag="UM146_24036"
                     /note="Haemolysin expression modulating protein; Region:
                     HHA; pfam05321"
                     /db_xref="CDD:147483"
     gene            complement(492..953)
                     /locus_tag="UM146_24041"
                     /db_xref="GeneID:12703353"
     CDS             complement(492..953)
                     /locus_tag="UM146_24041"
                     /note="COG1525 Micrococcal nuclease (thermonuclease)
                     homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="putative nuclease"
                     /protein_id="YP_006104020.1"
                     /db_xref="GI:386602512"
                     /db_xref="GeneID:12703353"
                     /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKAVR
                     IRLINIDAPEKKQDYGRWSTXMMKSLVAGKTVTVTYFQRDRYGRILGQVYAPDGMNVN
                     QFMVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     misc_feature    complement(534..899)
                     /locus_tag="UM146_24041"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    complement(534..875)
                     /locus_tag="UM146_24041"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    complement(order(690..692,696..701,792..794,801..803,
                     819..821,858..860))
                     /locus_tag="UM146_24041"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            complement(1539..2099)
                     /locus_tag="UM146_24046"
                     /db_xref="GeneID:12703354"
     CDS             complement(1539..2099)
                     /locus_tag="UM146_24046"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer fertility inhibition protein
                     FinO"
                     /protein_id="YP_006104021.1"
                     /db_xref="GI:386602513"
                     /db_xref="GeneID:12703354"
                     /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELTAKKAQARQALSIYLNLPSLDEAVNTLKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEV
                     YAAERLDKIRRQNRIKAELQAVLDEQ"
     misc_feature    complement(1542..2099)
                     /locus_tag="UM146_24046"
                     /note="conjugal transfer fertility inhibition protein
                     FinO; Provisional; Region: PRK13754"
                     /db_xref="CDD:184304"
     misc_feature    complement(1914..2099)
                     /locus_tag="UM146_24046"
                     /note="Fertility inhibition protein N terminal; Region:
                     FinO_N; pfam12602"
                     /db_xref="CDD:153036"
     misc_feature    complement(1554..1988)
                     /locus_tag="UM146_24046"
                     /note="FinO bacterial conjugation repressor domain;  the
                     basic protein FinO is part of the the two component FinOP
                     system which is responsible for repressing bacterial
                     conjugation; the FinOP system represses the transfer (tra)
                     operon of the F-plasmid which...; Region: FinO_conjug_rep;
                     cd00236"
                     /db_xref="CDD:238145"
     misc_feature    complement(1953..1988)
                     /locus_tag="UM146_24046"
                     /note="putative kissing complex interaction region; other
                     site"
                     /db_xref="CDD:238145"
     misc_feature    complement(order(1572..1574,1587..1589,1671..1673,
                     1743..1748,1797..1799,1917..1919,1929..1934,1953..1955,
                     1962..1964,1974..1976))
                     /locus_tag="UM146_24046"
                     /note="putative RNA binding sites [nucleotide binding];
                     other site"
                     /db_xref="CDD:238145"
     gene            complement(2202..3062)
                     /locus_tag="UM146_24051"
                     /db_xref="GeneID:12703355"
     CDS             complement(2202..3062)
                     /locus_tag="UM146_24051"
                     /note="COG1073 Hydrolases of the alpha/beta superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104022.1"
                     /db_xref="GI:386602514"
                     /db_xref="GeneID:12703355"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPC
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKIPFLTVMETLQYKPAESAA
                     KVQCPVLIVIAGQDSVNPPEQGKALYDAVASGTKELYEEADACHYDIYEGAFFERVAA
                     VQTQWFKKHL"
     misc_feature    complement(2799..3032)
                     /locus_tag="UM146_24051"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(<2661..2918)
                     /locus_tag="UM146_24051"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(2235..2903)
                     /locus_tag="UM146_24051"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_1;
                     pfam00561"
                     /db_xref="CDD:249959"
     gene            complement(3121..3867)
                     /locus_tag="UM146_24056"
                     /db_xref="GeneID:12703356"
     CDS             complement(3121..3867)
                     /locus_tag="UM146_24056"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylation protein
                     TraX"
                     /protein_id="YP_006104023.1"
                     /db_xref="GI:386602515"
                     /db_xref="GeneID:12703356"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSXRLYRAEDRAERLALXACLLAVIPALNLAXSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPVFYACHLAVLGVLAL"
     misc_feature    complement(3124..3831)
                     /locus_tag="UM146_24056"
                     /note="conjugal transfer pilus acetylation protein TraX;
                     Provisional; Region: PRK13706"
                     /db_xref="CDD:184262"
     gene            complement(3887..9157)
                     /locus_tag="UM146_24061"
                     /db_xref="GeneID:12703357"
     CDS             complement(3887..9157)
                     /locus_tag="UM146_24061"
                     /note="COG0507 ATP-dependent exoDNAse (exonuclease V),
                     alpha subunit - helicase superfamily I member"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer nickase/helicase TraI"
                     /protein_id="YP_006104024.1"
                     /db_xref="GI:386602516"
                     /db_xref="GeneID:12703357"
                     /translation="MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQ
                     GSVDKDVFTRLLEGRLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRL
                     IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQDPQLHTHV
                     VVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEIRMAE
                     WMQTLKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQF
                     TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
                     RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
                     ELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMVFTPGSTVIVD
                     QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
                     PATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
                     GHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
                     LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASV
                     SEDAMTVVVPGRAEPAXLPVSDSPFTALKLENGWVETPGHSVSDSAXVFASVTQMAMD
                     NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETSLETAISLQ
                     KTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINAQIKR
                     GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSG
                     QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAV
                     GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
                     AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVXIMKEIVRQTPELREAVYXLINR
                     DVERALSGLESVKPSQVPRXEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGETFPDV
                     PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGQEQVMVP
                     VLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLIS
                     PREAVAEGVTLYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
                     QTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVAL
                     SRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVLEPKPDREVMNAQRLFSTARELRDV
                     AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
                     GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
                     GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
                     VRKMAENKPDLPDGKTELAVRDIAGQERDRSAISERETALPESVLRESQREREAVREV
                     ARENLLQERLQQMERDMVRDLQKEKTLGGD"
     misc_feature    complement(3905..9154)
                     /locus_tag="UM146_24061"
                     /note="conjugal transfer nickase/helicase TraI;
                     Provisional; Region: PRK13709"
                     /db_xref="CDD:237478"
     misc_feature    complement(8294..9121)
                     /locus_tag="UM146_24061"
                     /note="conjugative relaxase domain, TrwC/TraI family;
                     Region: relax_trwC; TIGR02686"
                     /db_xref="CDD:233975"
     misc_feature    complement(5699..6256)
                     /locus_tag="UM146_24061"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     misc_feature    complement(4478..4858)
                     /locus_tag="UM146_24061"
                     /note="DNA helicase TraI; Region: TraI; pfam07057"
                     /db_xref="CDD:148585"
     gene            complement(9157..11301)
                     /locus_tag="UM146_24066"
                     /db_xref="GeneID:12703358"
     CDS             complement(9157..11301)
                     /locus_tag="UM146_24066"
                     /note="COG3505 Type IV secretory pathway, VirD4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="YP_006104025.1"
                     /db_xref="GI:386602517"
                     /db_xref="GeneID:12703358"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILXGLX
                     LWVKISWQTFXNGCIYWWCTXLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMI
                     WCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVA
                     RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
                     YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
                     YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQARP
                     KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPVS
                     SVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
                     HPDIQQHMQRREEVNINVHRERGEDVEPGDDF"
     misc_feature    complement(9160..11301)
                     /locus_tag="UM146_24066"
                     /note="conjugal transfer protein TraD; Provisional;
                     Region: PRK13700"
                     /db_xref="CDD:184256"
     misc_feature    complement(10915..11211)
                     /locus_tag="UM146_24066"
                     /note="F sex factor protein N terminal; Region: TraD_N;
                     pfam12615"
                     /db_xref="CDD:257163"
     misc_feature    complement(9628..10872)
                     /locus_tag="UM146_24066"
                     /note="Bacterial conjugation protein TrwB,  ATP binding
                     domain. TrwB is a homohexamer encoded by conjugative
                     plasmids in Gram-negative bacteria. TrwB also has an all
                     alpha domain which has been hypothesized to be responsible
                     for DNA binding. TrwB is a component...; Region: TrwB;
                     cd01127"
                     /db_xref="CDD:238547"
     misc_feature    complement(order(9655..9657,9685..9687,9694..9699,
                     9703..9705,9709..9714,9724..9729,9790..9792,9805..9807,
                     9814..9816,9835..9840,9880..9885,9889..9894,9898..9903,
                     9916..9921,9928..9930,9937..9939,9970..9972,10276..10281,
                     10288..10290,10309..10311,10363..10365,10468..10473,
                     10483..10485,10528..10530,10717..10722,10855..10863))
                     /locus_tag="UM146_24066"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238547"
     misc_feature    complement(10705..10728)
                     /locus_tag="UM146_24066"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238547"
     misc_feature    complement(order(9970..9972,10699..10719))
                     /locus_tag="UM146_24066"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238547"
     misc_feature    complement(10027..10041)
                     /locus_tag="UM146_24066"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238547"
     gene            complement(11352..12089)
                     /locus_tag="UM146_24071"
                     /db_xref="GeneID:12703359"
     CDS             complement(11352..12089)
                     /locus_tag="UM146_24071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104026.1"
                     /db_xref="GI:386602518"
                     /db_xref="GeneID:12703359"
                     /translation="MTSDNIAEYVGENNQFTEKPVTEYPPVIQDNTVTTKDYLYSNNI
                     DTDLLVVIGGLIVILFLMMLIMYFINSLRHKELTEILEKISFPEKSGSNLLKPEAVSC
                     NLLSLCVLAPVLCTPRKLAEVSREIIVASAQEIAWTPGSSRIDGHQGENITWSLSSQS
                     PADKYDLINKTSXVSPDSGRFYEPDTVLDHRERVRLFIQIQFPHGSDWSEVLRLTDIV
                     TEKVSSGRXAGGXHHRHTGYTWSVSVN"
     gene            complement(12292..13023)
                     /locus_tag="UM146_24076"
                     /db_xref="GeneID:12703360"
     CDS             complement(12292..13023)
                     /locus_tag="UM146_24076"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer surface exclusion protein
                     TraT"
                     /protein_id="YP_006104027.1"
                     /db_xref="GI:386602519"
                     /db_xref="GeneID:12703360"
                     /translation="MKMKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIW
                     LEPASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKAD
                     KMDLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVE
                     DVNYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNAN
                     KVNLKFEEAKPVLEDQLAKSIANIL"
     misc_feature    complement(12295..13023)
                     /locus_tag="UM146_24076"
                     /note="conjugal transfer surface exclusion protein TraT;
                     Provisional; Region: PRK13731"
                     /db_xref="CDD:184283"
     gene            complement(13072..13557)
                     /locus_tag="UM146_24081"
                     /db_xref="GeneID:12703361"
     CDS             complement(13072..13557)
                     /locus_tag="UM146_24081"
                     /codon_start=1
                     /transl_table=11
                     /product="Surface exclusion inner membrane protein"
                     /protein_id="YP_006104028.1"
                     /db_xref="GI:386602520"
                     /db_xref="GeneID:12703361"
                     /translation="MIMRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLF
                     IWLFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCV
                     SVREWMQSQVNEQTNEDLHLDFDNMDFHRTNPATGLPMSGIGVDIGGNSYGYSSKRYD
                     E"
     misc_feature    complement(13075..13551)
                     /locus_tag="UM146_24081"
                     /note="Plasmid conjugative transfer entry exclusion
                     protein TraS; Region: TraS; pfam10624"
                     /db_xref="CDD:119144"
     gene            complement(13573..16395)
                     /locus_tag="UM146_24086"
                     /db_xref="GeneID:12703362"
     CDS             complement(13573..16395)
                     /locus_tag="UM146_24086"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraG"
                     /protein_id="YP_006104029.1"
                     /db_xref="GI:386602521"
                     /db_xref="GeneID:12703362"
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMGTRTWDSIEKIALTLSVLAV
                     AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
                     SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDY
                     VQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLK
                     DKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNV
                     TINALKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPV
                     VLSEISQIQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTAS
                     AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
                     SGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQFGSNRG
                     SSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRTSAGMY
                     GDAHAEWGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
                     AEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFV
                     QEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
                     VKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSA
                     QERMPGADSPQELMKRAKEYQDKYKQ"
     misc_feature    complement(13576..16395)
                     /locus_tag="UM146_24086"
                     /note="conjugal transfer mating pair stabilization protein
                     TraG; Provisional; Region: PRK13735"
                     /db_xref="CDD:184287"
     misc_feature    complement(15043..16389)
                     /locus_tag="UM146_24086"
                     /note="TraG-like protein, N-terminal region; Region:
                     TraG_N; pfam07916"
                     /db_xref="CDD:254513"
     gene            complement(16392..17765)
                     /locus_tag="UM146_24091"
                     /db_xref="GeneID:12703363"
     CDS             complement(16392..17765)
                     /locus_tag="UM146_24091"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraH"
                     /protein_id="YP_006104030.1"
                     /db_xref="GI:386602522"
                     /db_xref="GeneID:12703363"
                     /translation="MLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQ
                     PGVWQGQAAGYAYGGSLYARTQVKNIQLISMTLPDINAGCGGIDAYLGSFSFINGDQL
                     QRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQKMASDINSMNLSSCQVAQGIVGG
                     LFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKASDKDKERVLKNI
                     NIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGG
                     TAKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTIIQNKAVSDTPLDDREKGF
                     ISSTTVPVFKYLIDPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYP
                     QTVLDSVLENLNQAQQQIAVFQGQVKVQQDALLVVDRQMSYMRQQLSARMLSRYQNNY
                     HFGGSTL"
     misc_feature    complement(16404..17756)
                     /locus_tag="UM146_24091"
                     /note="conjugal transfer pilus assembly protein TraH;
                     Provisional; Region: PRK13723"
                     /db_xref="CDD:237481"
     gene            complement(17752..18411)
                     /locus_tag="UM146_24096"
                     /db_xref="GeneID:12703364"
     CDS             complement(17752..18411)
                     /locus_tag="UM146_24096"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbF"
                     /protein_id="YP_006104031.1"
                     /db_xref="GI:386602523"
                     /db_xref="GeneID:12703364"
                     /translation="MRNKQVVLLIAGISGIATGIIVSLNIPFIRQGLFYPASPVEIVV
                     SLCLTFSVSVVFFVGAIVGWISVSEIYYSRMNGLNESSEISEETYNERKRNDAELKNR
                     KTKRDYDYERRVSDIYFDLFFVFVAAGTFLWVIMHSIFDACIDSWKADPELNNFRYMW
                     NILMYVIPYTLWAFAGGFLIVYVRNPLNELINGGIRIFRLKRRMRRENKLREGGNNAS
                     H"
     misc_feature    complement(18133..18411)
                     /locus_tag="UM146_24096"
                     /note="conjugal transfer protein TrbJ; Provisional;
                     Region: PRK13711"
                     /db_xref="CDD:184267"
     misc_feature    complement(17755..18135)
                     /locus_tag="UM146_24096"
                     /note="conjugal transfer protein TrbF; Provisional;
                     Region: PRK13743"
                     /db_xref="CDD:184294"
     gene            complement(18401..18946)
                     /locus_tag="UM146_24101"
                     /db_xref="GeneID:12703365"
     CDS             complement(18401..18946)
                     /locus_tag="UM146_24101"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="YP_006104032.1"
                     /db_xref="GI:386602524"
                     /db_xref="GeneID:12703365"
                     /translation="MSLTKLLPVILLMMATGVQASTRDEIERLWNPQGMAVQPAQPAA
                     DTSARTEKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSV
                     FPYTLDGQGDTAFPEALPVPPDVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDA
                     ASFMARMDTVLQMYGEEKGAK"
     misc_feature    complement(18404..18946)
                     /locus_tag="UM146_24101"
                     /note="conjugal transfer protein TrbB; Provisional;
                     Region: PRK13728"
                     /db_xref="CDD:237484"
     gene            complement(18933..19217)
                     /locus_tag="UM146_24106"
                     /db_xref="GeneID:12703366"
     CDS             complement(18933..19217)
                     /locus_tag="UM146_24106"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilin chaperone TraQ"
                     /protein_id="YP_006104033.1"
                     /db_xref="GI:386602525"
                     /db_xref="GeneID:12703366"
                     /translation="MISKXRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLA
                     ELIAAILVLFGAYQVLDAWIARVSLEEREALEARQQAMMEGQQEGGHVSH"
     misc_feature    complement(18975..19214)
                     /locus_tag="UM146_24106"
                     /note="conjugal transfer pilin chaperone TraQ;
                     Provisional; Region: PRK13727"
                     /db_xref="CDD:237483"
     gene            19298..19633
                     /locus_tag="UM146_24111"
                     /db_xref="GeneID:12703367"
     CDS             19298..19633
                     /locus_tag="UM146_24111"
                     /codon_start=1
                     /transl_table=11
                     /product="ArtA"
                     /protein_id="YP_006104034.1"
                     /db_xref="GI:386602526"
                     /db_xref="GeneID:12703367"
                     /translation="MKKLSFKEKLEIVRNIIRESLSGNAAFALLVYSLLHSLPIKTFA
                     DLFVTILLFIAIIAVVIWLFLIIYVYFCELFRSHWIAVWFILWSVVINLTIGFGIYDK
                     LAPVISLMK"
     gene            complement(19614..19955)
                     /locus_tag="UM146_24116"
                     /db_xref="GeneID:12703368"
     CDS             complement(19614..19955)
                     /locus_tag="UM146_24116"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbA"
                     /protein_id="YP_006104035.1"
                     /db_xref="GI:386602527"
                     /db_xref="GeneID:12703368"
                     /translation="MHTGDLCFFTGASLFIVGVVGYFFTGPNNKGVYLLSSFIFFVVN
                     VISVCMLPDNFLFLCGAVMNQCAVPVVSMAVSTIPVITKFDSFRRMFVCIMLSAIWSG
                     VMWFFIISLVK"
     misc_feature    complement(19617..19955)
                     /locus_tag="UM146_24116"
                     /note="conjugal transfer protein TrbA; Provisional;
                     Region: PRK13712"
                     /db_xref="CDD:184268"
     gene            complement(19969..20712)
                     /locus_tag="UM146_24121"
                     /db_xref="GeneID:12703369"
     CDS             complement(19969..20712)
                     /locus_tag="UM146_24121"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal pilus assembly protein TraF"
                     /protein_id="YP_006104036.1"
                     /db_xref="GI:386602528"
                     /db_xref="GeneID:12703369"
                     /translation="MNKALLPLLLCCFIFPASGKDAGWQWYNEKIXPKEKENKPVPAA
                     PRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKA
                     MLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQL
                     AQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGS
                     VRPLSYGFISQDDLAKQFLNVSEDFKPNF"
     misc_feature    complement(19972..20712)
                     /locus_tag="UM146_24121"
                     /note="conjugal pilus assembly protein TraF; Provisional;
                     Region: PRK13703"
                     /db_xref="CDD:184259"
     gene            complement(20705..20962)
                     /locus_tag="UM146_24126"
                     /db_xref="GeneID:12703370"
     CDS             complement(20705..20962)
                     /locus_tag="UM146_24126"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="YP_006104037.1"
                     /db_xref="GI:386602529"
                     /db_xref="GeneID:12703370"
                     /translation="MKVIFTSNRFIDFLIRLLITAXVISPVIIWSWDTVKETTADGXL
                     AAAFVILYSGVLLFILYFCFSALTDLQKTDERKXDERNEDE"
     misc_feature    complement(20711..20962)
                     /locus_tag="UM146_24126"
                     /note="conjugal transfer protein TrbE; Provisional;
                     Region: PRK13718"
                     /db_xref="CDD:172260"
     gene            complement(20989..22839)
                     /locus_tag="UM146_24131"
                     /db_xref="GeneID:12703371"
     CDS             complement(20989..22839)
                     /locus_tag="UM146_24131"
                     /note="COG1004 Predicted UDP-glucose 6-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer mating pair stabilization
                     protein TraN"
                     /protein_id="YP_006104038.1"
                     /db_xref="GI:386602530"
                     /db_xref="GeneID:12703371"
                     /translation="MKRILPLILALVAGMAQADSNSDYRAGSDFARQIQGQGTGSIQG
                     FKPQESIPGYNANPDETKYYGGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKD
                     ILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRSEFTNYTCERDTMVEEYCTRT
                     ASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLSVYAAFFFL
                     NSRYTFMNTTFNVGLANGQSDTYPLSGATGLQVTQGQVLTGSGCTANGNCLPHGNGDR
                     KVYESLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKT
                     GVMEGKPWNITQACWAYRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLH
                     EYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAEAVSQLAALAAAGKDVA
                     ALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLT
                     VSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHPDCRGIT
                     VDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ"
     misc_feature    complement(21019..22839)
                     /locus_tag="UM146_24131"
                     /note="conjugal transfer mating pair stabilization protein
                     TraN; Reviewed; Region: PRK12355"
                     /db_xref="CDD:237072"
     misc_feature    complement(21019..22827)
                     /locus_tag="UM146_24131"
                     /note="Type-1V conjugative transfer system mating pair
                     stabilisation; Region: TraN; cl19475"
                     /db_xref="CDD:267828"
     gene            complement(22836..23474)
                     /locus_tag="UM146_24136"
                     /db_xref="GeneID:12703372"
     CDS             complement(22836..23474)
                     /locus_tag="UM146_24136"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TrbC"
                     /protein_id="YP_006104039.1"
                     /db_xref="GI:386602531"
                     /db_xref="GeneID:12703372"
                     /translation="MNRKIFALFALTAGMHLAVHASENVNTPENRQFLKQQENLSRQL
                     REKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPE
                     EGLKRMLXETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFSQYGI
                     RSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK"
     misc_feature    complement(22839..23474)
                     /locus_tag="UM146_24136"
                     /note="conjugal transfer pilus assembly protein TrbC;
                     Provisional; Region: PRK13730"
                     /db_xref="CDD:184282"
     gene            complement(23483..23788)
                     /locus_tag="UM146_24141"
                     /db_xref="GeneID:12703373"
     CDS             complement(23483..23788)
                     /locus_tag="UM146_24141"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104040.1"
                     /db_xref="GI:386602532"
                     /db_xref="GeneID:12703373"
                     /translation="MATMDSKYIQHLRKISAVLLRLISRTLKLFPFGLVMVPVILFYF
                     APDSFLAEIIHEWKKADISEQVTLVRLYLKVTFTCAFMAVFLNYLFSDEFMPVNSRK"
     misc_feature    complement(23818..24811)
                     /note="potential frameshift: common BLAST hit:
                     gi|302595527|ref|YP_003829145.1| F pilin assembly"
     gene            complement(23818..24216)
                     /locus_tag="UM146_24146"
                     /db_xref="GeneID:12703374"
     CDS             complement(23818..24216)
                     /locus_tag="UM146_24146"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraU"
                     /protein_id="YP_006104041.1"
                     /db_xref="GI:386602533"
                     /db_xref="GeneID:12703374"
                     /translation="MPLPVPFNMPLDVLFWCAGSQGSMYPFNGWVSNESSPLQSSLLV
                     SERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERWRYQMVNMYPDSGQCHPFGRS
                     VMRWETGKNPPNTKKNFGYLMWRKRNCVFL"
     misc_feature    complement(23821..>24198)
                     /locus_tag="UM146_24146"
                     /note="TraU protein; Region: TraU; cl06067"
                     /db_xref="CDD:262770"
     gene            complement(24194..24811)
                     /locus_tag="UM146_24151"
                     /db_xref="GeneID:12703375"
     CDS             complement(24194..24811)
                     /locus_tag="UM146_24151"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraU"
                     /protein_id="YP_006104042.1"
                     /db_xref="GI:386602534"
                     /db_xref="GeneID:12703375"
                     /translation="MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFP
                     LSLGSIKVSQGKVPDTANPSMPIQICPAPPPLFRRIGLAIGYWEPMALTDVTRSPGCM
                     VNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYPLTYWLNIITSLGCLEGGDLD
                     IAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAF"
     misc_feature    complement(<24197..24811)
                     /locus_tag="UM146_24151"
                     /note="TraU protein; Region: TraU; cl06067"
                     /db_xref="CDD:262770"
     gene            complement(24808..25440)
                     /locus_tag="UM146_24156"
                     /db_xref="GeneID:12703376"
     CDS             complement(24808..25440)
                     /locus_tag="UM146_24156"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraW"
                     /protein_id="YP_006104043.1"
                     /db_xref="GI:386602535"
                     /db_xref="GeneID:12703376"
                     /translation="MRCRGLIALLIWGQSVXAADLGTWGDLWPVKEPDMLTVIMQRLT
                     ALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYXSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQXLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEM
                     QKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
     misc_feature    complement(24811..25437)
                     /locus_tag="UM146_24156"
                     /note="conjugal transfer pilus assembly protein TraW;
                     Provisional; Region: PRK13738"
                     /db_xref="CDD:184290"
     gene            complement(25437..25823)
                     /locus_tag="UM146_24161"
                     /db_xref="GeneID:12703377"
     CDS             complement(25437..25823)
                     /locus_tag="UM146_24161"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="YP_006104044.1"
                     /db_xref="GI:386602536"
                     /db_xref="GeneID:12703377"
                     /translation="MTTTQKTTDVTAPRRSHWWWTVPGCLAMVLLNAAXSYGIVRLNA
                     PVTAAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     misc_feature    complement(25440..25823)
                     /locus_tag="UM146_24161"
                     /note="conjugal transfer protein TrbI; Provisional;
                     Region: PRK13717"
                     /db_xref="CDD:184271"
     gene            complement(25820..28450)
                     /locus_tag="UM146_24166"
                     /db_xref="GeneID:12703378"
     CDS             complement(25820..28450)
                     /locus_tag="UM146_24166"
                     /note="COG3451 Type IV secretory pathway, VirB4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer ATP-binding protein TraC"
                     /protein_id="YP_006104045.1"
                     /db_xref="GI:386602537"
                     /db_xref="GeneID:12703378"
                     /translation="MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRL
                     LPYRDYNQESGLFMNDTTMGFMLEAIPINGANKSIVEALDHMLRTKLPRGIPLCIHLM
                     SSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYR
                     VFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVGEMINHNP
                     DSLYPKRRQLDPYSDLNYQCVEDSFDLXVRADYLTLGLRENGRNSTARILNFHLARNP
                     EIAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTS
                     YAKWFPSVEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSF
                     RKNGFELISPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADN
                     PLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSG
                     GFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPN
                     GNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMI
                     VLLDQYTANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENR
                     MYRTPRTLKKLNVIDEGWRLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDS
                     DKASSAARAAWGNSSYKIILKQSAKEFAKYNQLFPDQFQPLQRDMIGKFGAAKDQWFS
                     SFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRXEGXSIHEAVWQLAWKKSG
                     PEMASLEAWLEEHEKYRSVA"
     misc_feature    complement(25826..28357)
                     /locus_tag="UM146_24166"
                     /note="conjugal transfer ATP-binding protein TraC;
                     Provisional; Region: PRK13721"
                     /db_xref="CDD:237480"
     misc_feature    complement(27617..28342)
                     /locus_tag="UM146_24166"
                     /note="F pilus assembly Type-IV secretion system for
                     plasmid transfer; Region: TraC_F_IV; pfam11130"
                     /db_xref="CDD:256307"
     misc_feature    complement(26441..27004)
                     /locus_tag="UM146_24166"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     gene            complement(28576..28674)
                     /locus_tag="UM146_24171"
                     /db_xref="GeneID:12703379"
     CDS             complement(28576..28674)
                     /locus_tag="UM146_24171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104046.1"
                     /db_xref="GI:386602538"
                     /db_xref="GeneID:12703379"
                     /translation="MAEVKRVRENERNKIREKQLQALNDAHSVKER"
     gene            complement(28819..29037)
                     /locus_tag="UM146_24176"
                     /db_xref="GeneID:12703380"
     CDS             complement(28819..29037)
                     /locus_tag="UM146_24176"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104047.1"
                     /db_xref="GI:386602539"
                     /db_xref="GeneID:12703380"
                     /translation="MHTFIFLVLIKNINGGGSWNITPMPNTDVCVQVLRTIESHGGRG
                     FGNTGECIEVKTNKPLNNVMDTLNGGGQ"
     gene            complement(29117..29590)
                     /locus_tag="UM146_24181"
                     /db_xref="GeneID:12703381"
     CDS             complement(29117..29590)
                     /locus_tag="UM146_24181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104048.1"
                     /db_xref="GI:386602540"
                     /db_xref="GeneID:12703381"
                     /translation="MHKSEAEKIDSILDEHQQIYRRHNQINNILAYCACIAWIPCIIA
                     AFGVDGIYLKILFAVLACCGAVCFFIFFFTLLPESLMVLSRQSLLQLMRLTEDVPDAR
                     QELLNRLLSGKKLTGRDEQDIRRLWQEKVDAMQESATRQREQDTIRKFTEGNKSE"
     gene            complement(29583..29804)
                     /locus_tag="UM146_24186"
                     /db_xref="GeneID:12703382"
     CDS             complement(29583..29804)
                     /locus_tag="UM146_24186"
                     /note="COG1734 DnaK suppressor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraR"
                     /protein_id="YP_006104049.1"
                     /db_xref="GI:386602541"
                     /db_xref="GeneID:12703382"
                     /translation="MSDEADEAYSVTEQLTMTGINRIRQKINVHGIPVYLCEACGNPI
                     PEARRKIFPGVTLCVECQAYQEKQRKHYA"
     misc_feature    complement(29586..29804)
                     /locus_tag="UM146_24186"
                     /note="conjugal transfer protein TraR; Provisional;
                     Region: PRK13715"
                     /db_xref="CDD:184270"
     gene            complement(29939..30454)
                     /locus_tag="UM146_24191"
                     /db_xref="GeneID:12703383"
     CDS             complement(29939..30454)
                     /locus_tag="UM146_24191"
                     /note="COG1155 Archaeal/vacuolar-type H+-ATPase subunit A"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraV"
                     /protein_id="YP_006104050.1"
                     /db_xref="GI:386602542"
                     /db_xref="GeneID:12703383"
                     /translation="MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANE
                     KAKKLEQPADAKPAAASLPRLAEGNFRTTTVRAVTAASPSGSGPVVTALPEQKLLAPR
                     PLFTAAREVKTIIPVSSVASVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVI
                     KPSAWGKPRIN"
     misc_feature    complement(29942..30454)
                     /locus_tag="UM146_24191"
                     /note="conjugal transfer protein TraV; Provisional;
                     Region: PRK13733"
                     /db_xref="CDD:184285"
     gene            complement(30451..30684)
                     /locus_tag="UM146_24196"
                     /db_xref="GeneID:12703384"
     CDS             complement(30451..30684)
                     /locus_tag="UM146_24196"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
                     /protein_id="YP_006104051.1"
                     /db_xref="GI:386602543"
                     /db_xref="GeneID:12703384"
                     /translation="MATSKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSS
                     RNTVFENPDIVKTCTVRDLKXDFVNCDEKGEGQ"
     misc_feature    complement(30454..30684)
                     /locus_tag="UM146_24196"
                     /note="conjugal transfer protein TrbG; Provisional;
                     Region: PRK13744"
                     /db_xref="CDD:139817"
     gene            complement(30696..31016)
                     /locus_tag="UM146_24201"
                     /db_xref="GeneID:12703385"
     CDS             complement(30696..31016)
                     /locus_tag="UM146_24201"
                     /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
                     related proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbD"
                     /protein_id="YP_006104052.1"
                     /db_xref="GI:386602544"
                     /db_xref="GeneID:12703385"
                     /translation="MNMRNINAITALSVPGKTMSDDFMHAVLSNCTTRIVLPAPKEFS
                     SESLPHNFNMAAVGVMKEGMSMRLFSSPGHIVVAGQFGGGKSASVKELIDRIIQKYKE
                     PFDE"
     misc_feature    complement(30834..31016)
                     /locus_tag="UM146_24201"
                     /note="Protein of unknown function (DUF2689); Region:
                     DUF2689; pfam10894"
                     /db_xref="CDD:151342"
     gene            complement(31003..31593)
                     /locus_tag="UM146_24206"
                     /db_xref="GeneID:12703386"
     CDS             complement(31003..31593)
                     /locus_tag="UM146_24206"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraP"
                     /protein_id="YP_006104053.1"
                     /db_xref="GI:386602545"
                     /db_xref="GeneID:12703386"
                     /translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMA
                     LFVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQDICHYRAA
                     DAADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLK
                     EVYTEDASLPGKIRKCPVYLPDDRTNRNNGDKNEHA"
     misc_feature    complement(31006..31593)
                     /locus_tag="UM146_24206"
                     /note="conjugal transfer protein TraP; Provisional;
                     Region: PRK13739"
                     /db_xref="CDD:237488"
     gene            complement(31583..33010)
                     /locus_tag="UM146_24211"
                     /db_xref="GeneID:12703387"
     CDS             complement(31583..33010)
                     /locus_tag="UM146_24211"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraB"
                     /protein_id="YP_006104054.1"
                     /db_xref="GI:386602546"
                     /db_xref="GeneID:12703387"
                     /translation="MASINTIVKRKQYLWLGIVVVGAASAIGGVLYLSDVDMSGNGEA
                     VAEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDD
                     QRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPP
                     QGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGTSLPYIPSGS
                     FAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSS
                     ERAIVRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDG
                     IGQGMERASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIP
                     IGAGNEVTVVFQDGFQLKTVEEMALERTQNRAEEDNPESPVPVPPSAESHLNGFNTDQ
                     MLKQLGNLNPQQFMSGSQGGGNDGK"
     misc_feature    complement(31586..33010)
                     /locus_tag="UM146_24211"
                     /note="conjugal transfer pilus assembly protein TraB;
                     Provisional; Region: PRK13729"
                     /db_xref="CDD:184281"
     misc_feature    complement(32435..>32536)
                     /locus_tag="UM146_24211"
                     /note="Extensin-like region; Region: Extensin_2;
                     pfam04554"
                     /db_xref="CDD:252669"
     misc_feature    complement(31784..32374)
                     /locus_tag="UM146_24211"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            complement(33010..33681)
                     /locus_tag="UM146_24216"
                     /db_xref="GeneID:12703388"
     CDS             complement(33010..33681)
                     /locus_tag="UM146_24216"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraK"
                     /protein_id="YP_006104055.1"
                     /db_xref="GI:386602547"
                     /db_xref="GeneID:12703388"
                     /translation="MAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNS
                     LDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDL
                     RGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADA
                     VWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLLAGARMDVYVIR
                     DGEGN"
     misc_feature    complement(33013..33681)
                     /locus_tag="UM146_24216"
                     /note="conjugal transfer protein TraK; Provisional;
                     Region: PRK13736"
                     /db_xref="CDD:237486"
     gene            complement(33724..34290)
                     /locus_tag="UM146_24221"
                     /db_xref="GeneID:12703389"
     CDS             complement(33724..34290)
                     /locus_tag="UM146_24221"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraE"
                     /protein_id="YP_006104056.1"
                     /db_xref="GI:386602548"
                     /db_xref="GeneID:12703389"
                     /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNE
                     QRTAVTPMXFNXPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
                     GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     misc_feature    complement(33727..34290)
                     /locus_tag="UM146_24221"
                     /note="conjugal transfer pilus assembly protein TraE;
                     Provisional; Region: PRK13726"
                     /db_xref="CDD:184278"
     gene            complement(34312..34623)
                     /locus_tag="UM146_24226"
                     /db_xref="GeneID:12703390"
     CDS             complement(34312..34623)
                     /locus_tag="UM146_24226"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraL"
                     /protein_id="YP_006104057.1"
                     /db_xref="GI:386602549"
                     /db_xref="GeneID:12703390"
                     /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIIT
                     SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     misc_feature    complement(34315..34623)
                     /locus_tag="UM146_24226"
                     /note="conjugal transfer pilus assembly protein TraL;
                     Provisional; Region: PRK13707"
                     /db_xref="CDD:184263"
     gene            complement(34638..34997)
                     /locus_tag="UM146_24231"
                     /db_xref="GeneID:12703391"
     CDS             complement(34638..34997)
                     /locus_tag="UM146_24231"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilin subunit TraA"
                     /protein_id="YP_006104058.1"
                     /db_xref="GI:386602550"
                     /db_xref="GeneID:12703391"
                     /translation="MNTVLSVQGASAPVEKKSFFSKFTCLNMLRLVRAVIPVAVLMML
                     FPELAMAAGKGDLMAKGQETVKATFGKNSSIVKWIVLAEVLVGAVMYMMTKNIKFLVG
                     FAILSVFIAVGMSVAGF"
     misc_feature    complement(34641..34997)
                     /locus_tag="UM146_24231"
                     /note="conjugal transfer pilin subunit TraA; Provisional;
                     Region: PRK13734"
                     /db_xref="CDD:237485"
     gene            complement(35031..35258)
                     /locus_tag="UM146_24236"
                     /db_xref="GeneID:12703392"
     CDS             complement(35031..35258)
                     /locus_tag="UM146_24236"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraY"
                     /protein_id="YP_006104059.1"
                     /db_xref="GI:386602551"
                     /db_xref="GeneID:12703392"
                     /translation="MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIR
                     LRDHLKRFPDFYNEEIFREVIEENESTFKEL"
     misc_feature    complement(35049..35258)
                     /locus_tag="UM146_24236"
                     /note="conjugal transfer protein TraY; Provisional;
                     Region: PRK13740"
                     /db_xref="CDD:184292"
     misc_feature    complement(35073..35219)
                     /locus_tag="UM146_24236"
                     /note="TraY domain; Region: TraY; pfam05509"
                     /db_xref="CDD:203264"
     gene            complement(35352..36038)
                     /locus_tag="UM146_24241"
                     /db_xref="GeneID:12703393"
     CDS             complement(35352..36038)
                     /locus_tag="UM146_24241"
                     /codon_start=1
                     /transl_table=11
                     /product="TraJ"
                     /protein_id="YP_006104060.1"
                     /db_xref="GI:386602552"
                     /db_xref="GeneID:12703393"
                     /translation="MCALDRRERPLNSQSVNKYILNVQNIYRNSPVPVCVRNKNRKIL
                     YANGAFIELFSREDKPLSGESYIRLQVEIFLSSLELECQALGHGSAFCRRFNFHGEIY
                     QIRMENVSFYNDESVVLWQINPFPDYPFFALNQSGSNTNTSDKLTIWNDLSPGTLVVF
                     SFYMLGVGHATIARELGITDRASEDRIKPVKRKIKEFFEHFDLFRVSCIYKGEIDSLL
                     SIIREFYGVK"
     misc_feature    complement(35685..35972)
                     /locus_tag="UM146_24241"
                     /note="PAS fold; Region: PAS; pfam00989"
                     /db_xref="CDD:250275"
     misc_feature    complement(<35865..35969)
                     /locus_tag="UM146_24241"
                     /note="PAS domain; Region: PAS_8; pfam13188"
                     /db_xref="CDD:257556"
     gene            complement(36232..36615)
                     /locus_tag="UM146_24246"
                     /db_xref="GeneID:12703394"
     CDS             complement(36232..36615)
                     /locus_tag="UM146_24246"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="YP_006104061.1"
                     /db_xref="GI:386602553"
                     /db_xref="GeneID:12703394"
                     /translation="MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLE
                     LGLRVHEAQMERKESAFNQAEFNKVLLECAVKTQSTVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIRDKVSSEMERFFPENDEE"
     misc_feature    complement(36235..36615)
                     /locus_tag="UM146_24246"
                     /note="TraM protein, DNA-binding; Region: Tra_M;
                     pfam05261"
                     /db_xref="CDD:253121"
     gene            37039..37548
                     /locus_tag="UM146_24251"
                     /db_xref="GeneID:12703395"
     CDS             37039..37548
                     /locus_tag="UM146_24251"
                     /note="COG0741 Soluble lytic murein transglycosylase and
                     related regulatory proteins (some contain LysM/invasin
                     domains)"
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="YP_006104062.1"
                     /db_xref="GI:386602554"
                     /db_xref="GeneID:12703395"
                     /translation="MKKWMLAICLMFINEICQATDCFDLAGRDYKIDPDLLRAISWKE
                     SRYRVNAIGINPVTGYGSGLMQVDSQHFNELDRYGIKPEHLTTDPCMNIYTGAYYLAI
                     AFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYRIYTGIKSSKGIRIPVTKKSL
                     PEINSVQNN"
     misc_feature    <37090..37398
                     /locus_tag="UM146_24251"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    37138..37464
                     /locus_tag="UM146_24251"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(37168..37170,37240..37242,37333..37335,37387..37389)
                     /locus_tag="UM146_24251"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    37168..37170
                     /locus_tag="UM146_24251"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(37845..38666)
                     /locus_tag="UM146_24256"
                     /db_xref="GeneID:12703396"
     CDS             complement(37845..38666)
                     /locus_tag="UM146_24256"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104063.1"
                     /db_xref="GI:386602555"
                     /db_xref="GeneID:12703396"
                     /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERY
                     TYIPTINIINKLRDEGFQPFFACQSRVRDLGRREYSKHMLRLRREGNINGQEVPEIIL
                     LNSHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIVGQVIEGAYEVLGVFD
                     KVTXNMEXMKEIHLNSDEQHLFGRAALMXRYEDENKTPVTPEQIITPRRREDKQNDLW
                     TTCQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWKS"
     misc_feature    complement(37881..38561)
                     /locus_tag="UM146_24256"
                     /note="Domain of unknown function (DUF932); Region:
                     DUF932; pfam06067"
                     /db_xref="CDD:253543"
     gene            39416..39751
                     /locus_tag="UM146_24261"
                     /db_xref="GeneID:12703397"
     CDS             39416..39751
                     /locus_tag="UM146_24261"
                     /codon_start=1
                     /transl_table=11
                     /product="YubN"
                     /protein_id="YP_006104064.1"
                     /db_xref="GI:386602556"
                     /db_xref="GeneID:12703397"
                     /translation="MKHGLRNGVAPYIPAAFCRDARSAGHGATEAARPERSLQARGFA
                     SGMEARQGGDSFAGSVHDSPPRQGDARKRHKQENNKTDNNQGSSNQSQSSNQSQSRRK
                     KRIIKGKVM"
     gene            complement(39988..40146)
                     /locus_tag="UM146_24266"
                     /db_xref="GeneID:12703398"
     CDS             complement(39988..40146)
                     /locus_tag="UM146_24266"
                     /codon_start=1
                     /transl_table=11
                     /product="small toxic polypeptide"
                     /protein_id="YP_006104065.1"
                     /db_xref="GI:386602557"
                     /db_xref="GeneID:12703398"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
                     FMAYESGK"
     misc_feature    complement(39991..40146)
                     /locus_tag="UM146_24266"
                     /note="small toxic polypeptide; Provisional; Region:
                     PRK09738"
                     /db_xref="CDD:182055"
     gene            complement(39992..40204)
                     /locus_tag="UM146_24271"
                     /db_xref="GeneID:12703399"
     CDS             complement(39992..40204)
                     /locus_tag="UM146_24271"
                     /codon_start=1
                     /transl_table=11
                     /product="modulator of post-segregation killing protein"
                     /protein_id="YP_006104066.1"
                     /db_xref="GI:386602558"
                     /db_xref="GeneID:12703399"
                     /translation="MLRQHQDSLLPRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLS
                     DTKIAVRDSLQRRIQGGGGFHGLRIR"
     misc_feature    complement(39995..40204)
                     /locus_tag="UM146_24271"
                     /note="modulator of post-segregation killing protein;
                     Provisional; Region: PRK13720"
                     /db_xref="CDD:172262"
     gene            complement(40422..41141)
                     /locus_tag="UM146_24276"
                     /db_xref="GeneID:12703400"
     CDS             complement(40422..41141)
                     /locus_tag="UM146_24276"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="YP_006104067.1"
                     /db_xref="GI:386602559"
                     /db_xref="GeneID:12703400"
                     /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRHQGNTLAEYPYAGAF
                     FRCLNGSRRISLSDLRFFMPSLTAEELHGXRLQWLYAIDVLIETQGEVCLLPLPGDAA
                     ERLFPSVRFXVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
                     TVGSWHARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKE
                     AGHAVREMERWMVPNKLREVA"
     misc_feature    complement(40425..41141)
                     /locus_tag="UM146_24276"
                     /note="plasmid SOS inhibition protein A; Provisional;
                     Region: PRK13704"
                     /db_xref="CDD:184260"
     gene            complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_24281"
                     /db_xref="GeneID:12703401"
     CDS             complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_24281"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein B"
                     /protein_id="YP_006104068.1"
                     /db_xref="GI:386602560"
                     /db_xref="GeneID:12703401"
                     /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDERRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     misc_feature    complement(41141..41572)
                     /gene="psiB"
                     /locus_tag="UM146_24281"
                     /note="plasmid SOS inhibition protein B; Provisional;
                     Region: psiB; PRK13701"
                     /db_xref="CDD:237477"
     gene            complement(41627..43585)
                     /locus_tag="UM146_24286"
                     /db_xref="GeneID:12703402"
     CDS             complement(41627..43585)
                     /locus_tag="UM146_24286"
                     /note="COG1475 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104069.1"
                     /db_xref="GI:386602561"
                     /db_xref="GeneID:12703402"
                     /translation="MPVTKCEPETTRKASRKYAKTQETVLSALLAQTEEVSVPLASLI
                     KSPLNVRTVPYSAESVSELAESIKGVGLLQNLVVHTLPGDRYGVAAGGRRLAALNMLA
                     ERGIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
                     DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQ
                     SGWGGKPDVRVIRNLITESEVAVAGNSKFRFVGADAFSPDELRTDLFSDDEGGYVDCV
                     ALDAALLEKLQAVAEFLREAEGWEWCAGRMEPVGECREDAGTYRCLPEPEAVLTEAEE
                     ERLNELMARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGGGVVVSWCYGNV
                     CVQRGVQLRSEDDAADDADRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQPD
                     KSLTLLAWTLCLNVFGSGAYSKPAQISLECKHYSLTSDAPSGKEGAAFMALMAEKARL
                     AALLPEGWSRDMTTFLSLSQEVLLSLLSFCTACSLNGVQTREYGHTSRSPLDTLESAI
                     GFHMRDWWQPTKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKD
                     NRWVPGWMCAPRPQTDATERTDNLADAA"
     misc_feature    complement(43193..43480)
                     /locus_tag="UM146_24286"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     misc_feature    complement(42950..43474)
                     /locus_tag="UM146_24286"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    complement(<43007..43132)
                     /locus_tag="UM146_24286"
                     /note="KorB domain; Region: KorB; pfam08535"
                     /db_xref="CDD:254862"
     gene            complement(43644..43877)
                     /locus_tag="UM146_24291"
                     /db_xref="GeneID:12703403"
     CDS             complement(43644..43877)
                     /locus_tag="UM146_24291"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104070.1"
                     /db_xref="GI:386602562"
                     /db_xref="GeneID:12703403"
                     /translation="MSEYFRILQGLPDGSFTREQAEAVAAQYRNVFIEDDQGTHFRLV
                     VRNNSGLVWRTWNFEDGAGYWMNHVIRNFGILK"
     misc_feature    complement(43647..43856)
                     /locus_tag="UM146_24291"
                     /note="Bacterial protein of unknown function (DUF905);
                     Region: DUF905; pfam06006"
                     /db_xref="CDD:114712"
     gene            complement(43934..44461)
                     /locus_tag="UM146_24296"
                     /db_xref="GeneID:12703404"
     CDS             complement(43934..44461)
                     /locus_tag="UM146_24296"
                     /note="COG0629 Single-stranded DNA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_006104071.1"
                     /db_xref="GI:386602563"
                     /db_xref="GeneID:12703404"
                     /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDK
                     QTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTMQMLGSAPQQNAQVQPQPQQNGQPQSADATKKGSAKTKGRGRKAAQPEPQPQ
                     PPEGEDYWFSDDIPF"
     misc_feature    complement(43937..44449)
                     /locus_tag="UM146_24296"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    complement(44153..44437)
                     /locus_tag="UM146_24296"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(44165..44167,44174..44176,44204..44206,
                     44231..44233,44294..44296,44300..44302,44345..44353,
                     44426..44437))
                     /locus_tag="UM146_24296"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(44156..44158,44162..44164,44198..44203,
                     44207..44209,44213..44215,44237..44242,44279..44281,
                     44285..44287,44291..44293,44297..44299,44303..44308,
                     44342..44347,44366..44368,44396..44398,44414..44422))
                     /locus_tag="UM146_24296"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(44219..44221,44225..44227,44231..44233))
                     /locus_tag="UM146_24296"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            44763..45221
                     /locus_tag="UM146_24301"
                     /db_xref="GeneID:12703405"
     CDS             44763..45221
                     /locus_tag="UM146_24301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104072.1"
                     /db_xref="GI:386602564"
                     /db_xref="GeneID:12703405"
                     /translation="MAPDXTTGRDPPQRREARFAKRRCALHPGGLLPGCQELRPRRDR
                     GGATEAARPERSLQAGGFASGMEARQGGDSSAGSVHDSPPRQGDARKRHKQENNKTDS
                     NQSSRKKKNSSSSSSSSSSRNNNIISNRQMTGLKRQKPPSERPRNERGGA"
     gene            complement(45307..45870)
                     /locus_tag="UM146_24306"
                     /db_xref="GeneID:12703406"
     CDS             complement(45307..45870)
                     /locus_tag="UM146_24306"
                     /note="COG0827 Adenine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104073.1"
                     /db_xref="GI:386602565"
                     /db_xref="GeneID:12703406"
                     /translation="MHSQLRERIRLMRARLDNAAPVAEIRAESQLFVSPAPICDRLVT
                     LAEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCG
                     DFMEWQSVQYYSRIIMNPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLP
                     FSDVREELPRGTFAYTDVPTMIIRLRA"
     misc_feature    complement(45424..45711)
                     /locus_tag="UM146_24306"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(45514..45516,45559..45567,45625..45630,
                     45682..45702))
                     /locus_tag="UM146_24306"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(45917..47278)
                     /locus_tag="UM146_24311"
                     /db_xref="GeneID:12703407"
     CDS             complement(45917..47278)
                     /locus_tag="UM146_24311"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104074.1"
                     /db_xref="GI:386602566"
                     /db_xref="GeneID:12703407"
                     /translation="MTLAAITMTAPEAASPVQMYRATYSPDDNKLRLYAASRLDPETY
                     KKVHDAGFRWAPXQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGY
                     SGKRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFER
                     AEYWEERARSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLD
                     LNMAKLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRC
                     HERQIQHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVN
                     KSNGAVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPG
                     EGFREMTKAQWAALPRDCKAVRSVEEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEI
                     PQK"
     misc_feature    complement(46643..47023)
                     /locus_tag="UM146_24311"
                     /note="Domain of unknown function (DUF3560); Region:
                     DUF3560; pfam12083"
                     /db_xref="CDD:256842"
     gene            complement(47653..47790)
                     /locus_tag="UM146_24316"
                     /db_xref="GeneID:12703408"
     CDS             complement(47653..47790)
                     /locus_tag="UM146_24316"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104075.1"
                     /db_xref="GI:386602567"
                     /db_xref="GeneID:12703408"
                     /translation="MFFKNQDLFQAPAIRIYVFCQSSGWQVMRTQEQKEENTGKRQMQ
                     I"
     gene            complement(48522..48713)
                     /locus_tag="UM146_24321"
                     /db_xref="GeneID:12703409"
     CDS             complement(48522..48713)
                     /locus_tag="UM146_24321"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104076.1"
                     /db_xref="GI:386602568"
                     /db_xref="GeneID:12703409"
                     /translation="MNISTETREILRNYRAVINARRREMGQKPLTTAQIVDEICDFVA
                     NQQAVFLGGHYILQGSRNR"
     gene            complement(48710..49132)
                     /locus_tag="UM146_24326"
                     /db_xref="GeneID:12703410"
     CDS             complement(48710..49132)
                     /locus_tag="UM146_24326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104077.1"
                     /db_xref="GI:386602569"
                     /db_xref="GeneID:12703410"
                     /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTD
                     DELETVMQRLDDAFVYGACDRVVSDIVNELMEEKRASRHVTVPAVMLEKVMALAGSEM
                     KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     misc_feature    complement(<48839..49132)
                     /locus_tag="UM146_24326"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:148627"
     misc_feature    complement(<48977..49048)
                     /locus_tag="UM146_24326"
                     /note="Mu B transposition protein, C terminal; Region:
                     Phage-MuB_C; pfam09077"
                     /db_xref="CDD:149951"
     gene            complement(49179..49604)
                     /locus_tag="UM146_24331"
                     /db_xref="GeneID:12703411"
     CDS             complement(49179..49604)
                     /locus_tag="UM146_24331"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104078.1"
                     /db_xref="GI:386602570"
                     /db_xref="GeneID:12703411"
                     /translation="MQYAKPVTLNVEECDRLSFLPYLFGLDFLYAEASVYTLAKKMMP
                     EYEGGFWHFIRLPDGGGYMMPDGDRFHLVNGENWFDRTVSADAAGIILTSLVINRQLW
                     LYHDSGDAGLTHLYRMRDAQLWSHIEFHPECNAIYAALD"
     misc_feature    complement(49182..49481)
                     /locus_tag="UM146_24331"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:251814"
     gene            49761..49901
                     /locus_tag="UM146_24336"
                     /db_xref="GeneID:12703412"
     CDS             49761..49901
                     /locus_tag="UM146_24336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104079.1"
                     /db_xref="GI:386602571"
                     /db_xref="GeneID:12703412"
                     /translation="MNDRKITADGKEGPGDRSGSPYLATRPQKPGYDGGTAQPAHDAE
                     AT"
     gene            complement(50020..50790)
                     /locus_tag="UM146_24341"
                     /db_xref="GeneID:12703280"
     CDS             complement(50020..50790)
                     /locus_tag="UM146_24341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104080.1"
                     /db_xref="GI:386602572"
                     /db_xref="GeneID:12703280"
                     /translation="MNEXLNALIYRHASNLLLAQGWPEETDVDQRNPKYPGWISIYVR
                     LDAPRLATLLIXRHGGVLPPLLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQVSF
                     PYAGEWLAEDEIRAVLGAVRDAVCSVSYQVAEDARRIRAALTTTGQTLLTRQTRRFRL
                     VVKESDHPCWLDEDDENLPVVLDAILNRGARFSSVEMYLVSECVEHILSSGLACDMLR
                     IPDEPPRRWFDRGVLREVVREARNEIRSMADXLAKIRK"
     gene            complement(50835..51269)
                     /locus_tag="UM146_24346"
                     /db_xref="GeneID:12703281"
     CDS             complement(50835..51269)
                     /locus_tag="UM146_24346"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104081.1"
                     /db_xref="GI:386602573"
                     /db_xref="GeneID:12703281"
                     /translation="MYGTCETLCRXLAAKYXGDTPLMLVIWSPEEIQALXDGMDIXLX
                     DHEIRTVLARLEDIPEDQRTESGISSGXAMEIINNVXENRQVTVPAELLASLIQTAEQ
                     ALWKREWAAXDHGLAVPECVTRRQAVVNQVRILLKNNTHEND"
     misc_feature    complement(50856..51269)
                     /locus_tag="UM146_24346"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:148627"
     gene            complement(51283..51504)
                     /locus_tag="UM146_24351"
                     /db_xref="GeneID:12703282"
     CDS             complement(51283..51504)
                     /locus_tag="UM146_24351"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_006104082.1"
                     /db_xref="GI:386602574"
                     /db_xref="GeneID:12703282"
                     /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
                     LTRQTLYRANRLFMEAYTEILELDSCFKD"
     gene            complement(51505..52188)
                     /locus_tag="UM146_24356"
                     /db_xref="GeneID:12703283"
     CDS             complement(51505..52188)
                     /locus_tag="UM146_24356"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methylase"
                     /protein_id="YP_006104083.1"
                     /db_xref="GI:386602575"
                     /db_xref="GeneID:12703283"
                     /translation="MSRFVLGNCIDVMARIPDNAIDFILTDPPYLVGFRDRSGRTIAG
                     DVNDDWLQPASNEMYRVLKKDALMVSFYGWNRVDRFMAAWKRAGFSVAGHLVFTKNYT
                     SKSAYVAYRHECAYILAKGSPARPRNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DNWFEPEAA"
     misc_feature    complement(51508..52188)
                     /locus_tag="UM146_24356"
                     /note="putative methylase; Provisional; Region: PRK13699"
                     /db_xref="CDD:184255"
     gene            complement(52572..52775)
                     /locus_tag="UM146_24361"
                     /db_xref="GeneID:12703284"
     CDS             complement(52572..52775)
                     /locus_tag="UM146_24361"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104084.1"
                     /db_xref="GI:386602576"
                     /db_xref="GeneID:12703284"
                     /translation="MLGGADNPNGELPSYITGADSWQLYERGELVDVLWGELEWSSPT
                     DDDELPEVTGPAWIVDNVAHYGG"
     gene            52840..53988
                     /locus_tag="UM146_24366"
                     /db_xref="GeneID:12703285"
     CDS             52840..53988
                     /locus_tag="UM146_24366"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase protein IstA"
                     /protein_id="YP_006104085.1"
                     /db_xref="GI:386602577"
                     /db_xref="GeneID:12703285"
                     /translation="MIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPPARKTRHKM
                     VKLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKMRPSKRTVR
                     FETQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDAEHTYESLV
                     RAFRYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRACRPRRARTK
                     GKVERMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKETPEQRFALE
                     QEHLQPLPDTDFDTSYFDIRHVSRDSYIEVGGNRYSVPEALCGQPVSIRISLDDELRI
                     YSNEKLVASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
     misc_feature    52843..53655
                     /locus_tag="UM146_24366"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    53152..53535
                     /locus_tag="UM146_24366"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            53988..54785
                     /locus_tag="UM146_24371"
                     /db_xref="GeneID:12703286"
     CDS             53988..54785
                     /locus_tag="UM146_24371"
                     /note="COG1484 DNA replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP-binding protein IstB"
                     /protein_id="YP_006104086.1"
                     /db_xref="GI:386602578"
                     /db_xref="GeneID:12703286"
                     /translation="MHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQ
                     EWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVIL
                     LGPPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYAR
                     VLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAIL
                     DRLLHHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVKSGQHQ"
     misc_feature    53991..54734
                     /locus_tag="UM146_24371"
                     /note="transposase/IS protein; Provisional; Region:
                     PRK09183"
                     /db_xref="CDD:181681"
     misc_feature    54222..54659
                     /locus_tag="UM146_24371"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    54297..54320
                     /locus_tag="UM146_24371"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(54300..54323,54480..54482,54579..54581)
                     /locus_tag="UM146_24371"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    54468..54485
                     /locus_tag="UM146_24371"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    54645..54647
                     /locus_tag="UM146_24371"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(54779..55633)
                     /locus_tag="UM146_24376"
                     /db_xref="GeneID:12703287"
     CDS             complement(54779..55633)
                     /locus_tag="UM146_24376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104087.1"
                     /db_xref="GI:386602579"
                     /db_xref="GeneID:12703287"
                     /translation="MPNWCSNRMYFSGEPAKIAEIKRLASGAVTPFYRRATNEGIQLF
                     LAGSAGLLQTTEDVRFEPCPGLTAAGRGVLSPENITFTRWLKHLQDGVLLDEQNCLML
                     HELWLQSGTGQRRWEGLPDDVRETITVHFTAKRGDWCDIWGNEDVSVWWNRLCDNVLS
                     EKTMPFDLLTVLPTRLDIEVNGFNGGVLNGVPSAYHWYTERYGVKWPCGYDLNISSQG
                     ENFIQVDFDTPWCQPESDVVAELSRRFGCTLEHWYAEQGCNFCGCVNATMFDRYLPFS
                     CPLRYFRY"
     misc_feature    complement(55208..55609)
                     /locus_tag="UM146_24376"
                     /note="Protein of unknown function (DUF1281); Region:
                     DUF1281; pfam06924"
                     /db_xref="CDD:115572"
     gene            complement(55647..55916)
                     /locus_tag="UM146_24381"
                     /db_xref="GeneID:12703288"
     CDS             complement(55647..55916)
                     /locus_tag="UM146_24381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104088.1"
                     /db_xref="GI:386602580"
                     /db_xref="GeneID:12703288"
                     /translation="MWLYACCGLLCPAYPQHFVHGSVDKILGYPGRAGTLIGLHPMQV
                     CRCRRPPHPVTFRRSSSTRCGFGAAPAFVCGRPVTGAARPDGGRM"
     gene            complement(56028..57248)
                     /locus_tag="UM146_24386"
                     /db_xref="GeneID:12703289"
     CDS             complement(56028..57248)
                     /locus_tag="UM146_24386"
                     /note="COG3464 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase protein"
                     /protein_id="YP_006104089.1"
                     /db_xref="GI:386602581"
                     /db_xref="GeneID:12703289"
                     /translation="MDEKSLYAHILNLTAPWQVKSLTLDENAGSVTVTVGIAENTQLT
                     CPTCRKSCSVHDHRHRKWRHLDTCQFMTLVEADVPRVMCPEHGCQTLPVPWAGSGSRY
                     TLLFESFVLSWLKISTVDAVRKQLKLSWNAVDGIMTRAVKRGLSRIKKPLSVRHMNVD
                     EVAFKKGHRYITVVSDRDGRALALTDDRGTESLASYLRSLTDSQLLAIKTLSMDMNAG
                     YIRAARIHLPNAVEKIAFDRFHVAKQLGEVVDKTRQNEHPHLPVESRRQAKGTRFLWQ
                     YSDKWMTESRQEKLMWLREQMQQTSQCWTLKELAKNIWDRPWSTERRNDWLQWISRAS
                     ECDVPMMKNAAKTIKKRLYGILNAMRHRVSNGNAEALNSKIRLLRIKARGYRNRERFK
                     LGVMFHYGKLNMAY"
     misc_feature    complement(56055..57119)
                     /locus_tag="UM146_24386"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    complement(56991..57119)
                     /locus_tag="UM146_24386"
                     /note="zinc-finger of transposase
                     IS204/IS1001/IS1096/IS1165; Region: zf-ISL3; pfam14690"
                     /db_xref="CDD:258828"
     misc_feature    complement(56826..56975)
                     /locus_tag="UM146_24386"
                     /note="Helix-turn-helix domain of transposase family ISL3;
                     Region: HTH_Tnp_ISL3; pfam13542"
                     /db_xref="CDD:257861"
     misc_feature    complement(56070..56774)
                     /locus_tag="UM146_24386"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            complement(57267..57785)
                     /locus_tag="UM146_24391"
                     /db_xref="GeneID:12703290"
     CDS             complement(57267..57785)
                     /locus_tag="UM146_24391"
                     /note="COG4283 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104090.1"
                     /db_xref="GI:386602582"
                     /db_xref="GeneID:12703290"
                     /translation="MSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKG
                     TEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL
                     SYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRL
                     RKWAKNNNISLK"
     misc_feature    complement(57288..57785)
                     /locus_tag="UM146_24391"
                     /note="Protein of unknown function (DUF1706); Region:
                     DUF1706; pfam08020"
                     /db_xref="CDD:254586"
     gene            57920..58168
                     /locus_tag="UM146_24396"
                     /db_xref="GeneID:12703291"
     CDS             57920..58168
                     /locus_tag="UM146_24396"
                     /codon_start=1
                     /transl_table=11
                     /product="UV protection and mutation protein"
                     /protein_id="YP_006104091.1"
                     /db_xref="GI:386602583"
                     /db_xref="GeneID:12703291"
                     /translation="MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRID
                     QGSAPSVSVTGARNDKGKERIQSLLEEIWQDDSWLPAA"
     misc_feature    57965..58159
                     /locus_tag="UM146_24396"
                     /note="DinI-like family; Region: DinI; pfam06183"
                     /db_xref="CDD:114876"
     gene            58165..58602
                     /locus_tag="UM146_24401"
                     /db_xref="GeneID:12703292"
     CDS             58165..58602
                     /locus_tag="UM146_24401"
                     /note="COG1974 SOS-response transcriptional repressors
                     (RecA-mediated autopeptidases)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein UmuD"
                     /protein_id="YP_006104092.1"
                     /db_xref="GI:386602584"
                     /db_xref="GeneID:12703292"
                     /translation="MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDL
                     NSYCISRPAATFFLRTSGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKR
                     LLLRPRPALEPVSDSPEFRTLYPENICIFGIVTHVIHRTRELR"
     misc_feature    58330..58569
                     /locus_tag="UM146_24401"
                     /note="Peptidase S24 LexA-like proteins are involved in
                     the SOS response leading to the repair of single-stranded
                     DNA within the bacterial cell. This family includes: the
                     lambda repressor CI/C2 family and related bacterial
                     prophage repressor proteins; LexA (EC...; Region:
                     S24_LexA-like; cd06529"
                     /db_xref="CDD:119397"
     misc_feature    order(58354..58356,58465..58467)
                     /locus_tag="UM146_24401"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119397"
     misc_feature    58602..59595
                     /note="potential frameshift: common BLAST hit:
                     gi|256855307|ref|YP_003162551.1| DNA repair protein UmuC"
     gene            59625..59873
                     /locus_tag="UM146_24416"
                     /db_xref="GeneID:12703293"
     CDS             59625..59873
                     /locus_tag="UM146_24416"
                     /note="COG0389 Nucleotidyltransferase/DNA polymerase
                     involved in DNA repair"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V subunit UmuC"
                     /protein_id="YP_006104093.1"
                     /db_xref="GI:386602585"
                     /db_xref="GeneID:12703293"
                     /translation="MKAGVMLADFTPSGIAQPGLFDEIQPRKNSEKLMKTLDELNQSG
                     KGKVWFAGRGTAPEWQMKREMLSPSYTTQWTEIPIASF"
     misc_feature    59712..59864
                     /locus_tag="UM146_24416"
                     /note="Domain of unknown function (DUF4113); Region:
                     DUF4113; pfam13438"
                     /db_xref="CDD:257763"
     gene            complement(59878..60270)
                     /locus_tag="UM146_24421"
                     /db_xref="GeneID:12703294"
     CDS             complement(59878..60270)
                     /locus_tag="UM146_24421"
                     /codon_start=1
                     /transl_table=11
                     /product="putative stable plasmid inheritance protein"
                     /protein_id="YP_006104094.1"
                     /db_xref="GI:386602586"
                     /db_xref="GeneID:12703294"
                     /translation="MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAF
                     ISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRTVLTELGASQ
                     SVEKMPPSATDSVQEAMNDVRLKMKKLF"
     misc_feature    complement(60037..60249)
                     /locus_tag="UM146_24421"
                     /note="Plasmid stability protein; Region: Plasmid_stab_B;
                     pfam10784"
                     /db_xref="CDD:119304"
     gene            complement(60275..61246)
                     /locus_tag="UM146_24426"
                     /db_xref="GeneID:12703295"
     CDS             complement(60275..61246)
                     /locus_tag="UM146_24426"
                     /note="COG0145 N-methylhydantoinase A/acetone carboxylase,
                     beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="stable plasmid inheritance protein StbA"
                     /protein_id="YP_006104095.1"
                     /db_xref="GI:386602587"
                     /db_xref="GeneID:12703295"
                     /translation="MNVYCDDGSTTIKLAWNDNGKICKSLSQNSFRHGWKVDGLGIRQ
                     TFNYELDGKKYTYDEVSNQSILTTHIEYQYTDVNLLAVHHALLNSGLAPQPVSLTVTL
                     PISEFYTKECQKNELNIQRKIENLMRPIRLNKGDVFTIEHVDVMPESLPAVFSRLVVD
                     KVGQFEKSLVVDIGGTTLDVGVIVGQFDSVSAIHGNSGIGVSSVTKAAMSALRMASSD
                     TSFLVADELIKRRNDPDFVRQVINDETKTDLVLNTIEGAIASLGEQVVNELGDFHHVN
                     RVYVVGGGAPLIYDSIKTAWHHLGQKVVMMESPQTALVEAIAAFKEE"
     misc_feature    complement(60299..61243)
                     /locus_tag="UM146_24426"
                     /note="Plasmid segregation protein ParM and similar
                     proteins; Region: ParM_like; cd10227"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(60731..60733,61229..61231))
                     /locus_tag="UM146_24426"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(60386..60388,60398..60403,60722..60730,
                     61208..61210,61214..61225))
                     /locus_tag="UM146_24426"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212669"
     misc_feature    complement(order(60695..60697,60746..60748,60809..60811,
                     60992..60994,61064..61072,61079..61081,61145..61147,
                     61151..61153))
                     /locus_tag="UM146_24426"
                     /note="putative protofilament interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212669"
     gene            61475..62119
                     /locus_tag="UM146_24431"
                     /db_xref="GeneID:12703296"
     CDS             61475..62119
                     /locus_tag="UM146_24431"
                     /note="COG1192 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104096.1"
                     /db_xref="GI:386602588"
                     /db_xref="GeneID:12703296"
                     /translation="MITVVGGNKGGSGKTTIASNLAIALANKGREVCLLNGDLQRTAA
                     KHHAEREAAGLLPAITLVEKFDNLTQTLQALNEKFDDVIVDVAGRNSKEFITSGVVAH
                     QIIAPLQCSQPDLDTLTELEQQIDAMRNLNPELKVYCLQSMATTNPVLRGNERKEFLE
                     YLEEFPTIQVLDSVICFRKVYRDCMSNGTGVVETNNTAAKAEIEHLMNEVFGPW"
     misc_feature    61475..62086
                     /locus_tag="UM146_24431"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    61478..61894
                     /locus_tag="UM146_24431"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    61499..62092
                     /locus_tag="UM146_24431"
                     /note="VirC1 protein; Region: VirC1; cl17401"
                     /db_xref="CDD:247955"
     misc_feature    61499..61519
                     /locus_tag="UM146_24431"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(61517..61519,61727..61729)
                     /locus_tag="UM146_24431"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            62113..62388
                     /locus_tag="UM146_24436"
                     /db_xref="GeneID:12703297"
     CDS             62113..62388
                     /locus_tag="UM146_24436"
                     /note="COG0587 DNA polymerase III, alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104097.1"
                     /db_xref="GI:386602589"
                     /db_xref="GeneID:12703297"
                     /translation="MVKKPSQQALNRAAVTVEQAEALAQRLADKPYGAPEKPEPEKQC
                     RTTISLGESMLVTIEDLALRNKRNGKDPKNVSAIVRVALEQYLKTLT"
     misc_feature    62176..>62235
                     /locus_tag="UM146_24436"
                     /note="Periplasmic glucan biosynthesis protein, MdoG;
                     Region: MdoG; cl15433"
                     /db_xref="CDD:246963"
     misc_feature    62245..62376
                     /locus_tag="UM146_24436"
                     /note="Ribbon-helix-helix protein, copG family; Region:
                     RHH_1; pfam01402"
                     /db_xref="CDD:201775"
     misc_feature    complement(62526..63334)
                     /note="potential frameshift: common BLAST hit:
                     gi|256855302|ref|YP_003162546.1| putative resolvase"
     gene            complement(63335..63640)
                     /locus_tag="UM146_24451"
                     /db_xref="GeneID:12703298"
     CDS             complement(63335..63640)
                     /locus_tag="UM146_24451"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdB"
                     /protein_id="YP_006104098.1"
                     /db_xref="GI:386602590"
                     /db_xref="GeneID:12703298"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     misc_feature    complement(63338..63640)
                     /locus_tag="UM146_24451"
                     /note="plasmid maintenance protein CcdB; Provisional;
                     Region: PRK13708"
                     /db_xref="CDD:184264"
     gene            complement(63642..63860)
                     /locus_tag="UM146_24456"
                     /db_xref="GeneID:12703299"
     CDS             complement(63642..63860)
                     /locus_tag="UM146_24456"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdA"
                     /protein_id="YP_006104099.1"
                     /db_xref="GI:386602591"
                     /db_xref="GeneID:12703299"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     KAENQEGMAEVARFIEMNGSFADENRDW"
     misc_feature    complement(63645..63860)
                     /locus_tag="UM146_24456"
                     /note="plasmid maintenance protein CcdA; Provisional;
                     Region: PRK13710"
                     /db_xref="CDD:184266"
     gene            65052..65219
                     /locus_tag="UM146_24461"
                     /db_xref="GeneID:12703300"
     CDS             65052..65219
                     /locus_tag="UM146_24461"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104100.1"
                     /db_xref="GI:386602592"
                     /db_xref="GeneID:12703300"
                     /translation="MTVRETEENIEQIFPELSNLIDIINKWLSHGNIDPELAHFIIYL
                     LDYLTTTHKSI"
     gene            66045..66185
                     /locus_tag="UM146_24466"
                     /db_xref="GeneID:12703301"
     CDS             66045..66185
                     /locus_tag="UM146_24466"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104101.1"
                     /db_xref="GI:386602593"
                     /db_xref="GeneID:12703301"
                     /translation="MCQESRLPGKRPLAAHLLDTKAELKGSREDVRKLQSLARHDGKA
                     KK"
     gene            68021..68974
                     /locus_tag="UM146_24471"
                     /db_xref="GeneID:12703302"
     CDS             68021..68974
                     /locus_tag="UM146_24471"
                     /codon_start=1
                     /transl_table=11
                     /product="IncFIB replication protein RepA"
                     /protein_id="YP_006104102.1"
                     /db_xref="GI:386602594"
                     /db_xref="GeneID:12703302"
                     /translation="MTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNTLSRTDATE
                     ELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVELPFVEFAK
                     LCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSAYYDTERDI
                     VQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPISLARLR
                     ARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKFFCIHYRRPRLKAPNDES
                     KENQLPPSPAEKISPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            complement(69217..69957)
                     /locus_tag="UM146_24476"
                     /db_xref="GeneID:12703303"
     CDS             complement(69217..69957)
                     /locus_tag="UM146_24476"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative site-specific recombinase protein"
                     /protein_id="YP_006104103.1"
                     /db_xref="GI:386602595"
                     /db_xref="GeneID:12703303"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGVRPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWPVTDETMRNWLKQAV
                     KRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLK"
     misc_feature    complement(69316..69804)
                     /locus_tag="UM146_24476"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(69322..69324,69427..69432,69652..69654,
                     69730..69735))
                     /locus_tag="UM146_24476"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(69322..69324,69349..69351,69418..69420,
                     69427..69429,69652..69654,69733..69735))
                     /locus_tag="UM146_24476"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(69322..69324,69349..69351,69418..69420,
                     69427..69429,69733..69735))
                     /locus_tag="UM146_24476"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(69322..69324,69418..69420,69733..69735))
                     /locus_tag="UM146_24476"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     gene            complement(73366..73557)
                     /locus_tag="UM146_24491"
                     /db_xref="GeneID:12703304"
     CDS             complement(73366..73557)
                     /locus_tag="UM146_24491"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="insertion element IS2 transposase InsD"
                     /protein_id="YP_006104104.1"
                     /db_xref="GI:386602596"
                     /db_xref="GeneID:12703304"
                     /translation="MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWKYRGKS
                     TSLLFRKDFSGSKQRSMPD"
     misc_feature    complement(<73444..73557)
                     /locus_tag="UM146_24491"
                     /note="IS2 transposase TnpB; Reviewed; Region: PRK09409"
                     /db_xref="CDD:181829"
     gene            complement(73515..73880)
                     /locus_tag="UM146_24496"
                     /db_xref="GeneID:12703305"
     CDS             complement(73515..73880)
                     /locus_tag="UM146_24496"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="insertion sequence 2 OrfA protein"
                     /protein_id="YP_006104105.1"
                     /db_xref="GI:386602597"
                     /db_xref="GeneID:12703305"
                     /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAAS
                     QLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVE
                     YGRAKKWIAHAPLLPGDGE"
     misc_feature    complement(73518..73880)
                     /locus_tag="UM146_24496"
                     /note="IS2 repressor TnpA; Reviewed; Region: PRK09413"
                     /db_xref="CDD:181833"
     misc_feature    complement(73539..73865)
                     /locus_tag="UM146_24496"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            74162..76132
                     /locus_tag="UM146_24501"
                     /db_xref="GeneID:12703306"
     CDS             74162..76132
                     /locus_tag="UM146_24501"
                     /note="COG1629 Outer membrane receptor proteins, mostly Fe
                     transport"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hemin receptor"
                     /protein_id="YP_006104106.1"
                     /db_xref="GI:386602598"
                     /db_xref="GeneID:12703306"
                     /translation="MYMNVIRNVICTLIILPIGLQAETSHSSMAKDTITVVATGNQNT
                     VFETPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVL
                     VLVDGIRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADF
                     LPPGETNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGERAP
                     NKEKPAALFAKGSVGITDSNKAGASLRLYRNNTTEPGNPTQTHGDSGLRDRKTVQNDV
                     QFWYQYAPVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFP
                     GAHQLSYGAEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDR
                     YKSFNPRAGELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRK
                     GKPNYWVPNLNLKPENNITREIGAGIQLDGLLTGNDRLQLKGGYFGTDARNYIATRVD
                     MKRMRSYSYNVSRARIWGWDMQGNYQSDYFDWMLSYNRTESMDASSREWLGSGNPDTL
                     ISDISIPVGHGGVSAGWRAELSAAATHVKKGDPHQAGYAVHSFSLSYKPVSVKGFEAS
                     VTLDNAFNKLAMNGKGVPLSGRTVSLYTRYQW"
     misc_feature    74255..76129
                     /locus_tag="UM146_24501"
                     /note="TonB-dependent heme/hemoglobin receptor family
                     protein; Region: TonB-hemin; TIGR01785"
                     /db_xref="CDD:233576"
     misc_feature    74312..76129
                     /locus_tag="UM146_24501"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    order(74312..74341,74369..74398,74432..74449,74468..74491,
                     74531..74563,74597..74623)
                     /locus_tag="UM146_24501"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    75080..75082
                     /locus_tag="UM146_24501"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            76139..76930
                     /locus_tag="UM146_24506"
                     /db_xref="GeneID:12703307"
     CDS             76139..76930
                     /locus_tag="UM146_24506"
                     /note="COG5266 ABC-type Co2+ transport system, periplasmic
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104107.1"
                     /db_xref="GI:386602599"
                     /db_xref="GeneID:12703307"
                     /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNITAEIGYGHN
                     FPSKGTIPDRRNFFENPRIYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGY
                     WSRTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLS
                     DISRFSEDVKLKVLYKTSPLAGAIMELDSVSYLKSSRHTHAVEHKHPVHKAELTFVTN
                     EDGIVTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
     misc_feature    76142..76918
                     /locus_tag="UM146_24506"
                     /note="ABC-type Co2+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: CbiK; COG5266"
                     /db_xref="CDD:227591"
     misc_feature    76193..76849
                     /locus_tag="UM146_24506"
                     /note="Domain of unknown function (DUF4198); Region:
                     DUF4198; pfam10670"
                     /db_xref="CDD:256113"
     gene            complement(76993..77424)
                     /locus_tag="UM146_24511"
                     /db_xref="GeneID:12703308"
     CDS             complement(76993..77424)
                     /locus_tag="UM146_24511"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104108.1"
                     /db_xref="GI:386602600"
                     /db_xref="GeneID:12703308"
                     /translation="MTAEQRLAERQLKTKPLLKSLESWLREKMKTLSRHSELAKAFAY
                     ALNQWPALTYYADDGWAEADNNIAENALRMVSLGRKNYLFFGSDHGGERGALLYSLIG
                     TCKLNGVEPESYLRYVLDVIADWPINRVGELLPWRVALPTE"
     misc_feature    complement(77146..>77424)
                     /locus_tag="UM146_24511"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     misc_feature    complement(77014..77130)
                     /locus_tag="UM146_24511"
                     /note="IS66 C-terminal element; Region: DDE_Tnp_IS66_C;
                     pfam13817"
                     /db_xref="CDD:258097"
     STS             77015..77097
                     /standard_name="RH124512"
                     /db_xref="UniSTS:161334"
     gene            complement(77669..78448)
                     /locus_tag="UM146_24516"
                     /db_xref="GeneID:12703309"
     CDS             complement(77669..78448)
                     /locus_tag="UM146_24516"
                     /note="COG1484 DNA replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase/IS protein"
                     /protein_id="YP_006104109.1"
                     /db_xref="GI:386602601"
                     /db_xref="GeneID:12703309"
                     /translation="MMELQHQRLMVLAGQLQLESLISAAPALSQQAVDQEWSYMDFLE
                     HLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERN
                     ENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQR
                     GVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDA
                     ALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     misc_feature    complement(77672..78448)
                     /locus_tag="UM146_24516"
                     /note="transposase/IS protein; Provisional; Region:
                     PRK09183"
                     /db_xref="CDD:181681"
     misc_feature    complement(<77888..78190)
                     /locus_tag="UM146_24516"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(78101..78124)
                     /locus_tag="UM146_24516"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(77936..77938,78098..78121))
                     /locus_tag="UM146_24516"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(77933..77950)
                     /locus_tag="UM146_24516"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(78448..79470)
                     /locus_tag="UM146_24521"
                     /db_xref="GeneID:12703310"
     CDS             complement(78448..79470)
                     /locus_tag="UM146_24521"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_006104110.1"
                     /db_xref="GI:386602602"
                     /db_xref="GeneID:12703310"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRGFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     misc_feature    complement(78598..79470)
                     /locus_tag="UM146_24521"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(79348..>79446)
                     /locus_tag="UM146_24521"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    complement(order(79360..79368,79372..79377))
                     /locus_tag="UM146_24521"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     misc_feature    complement(78745..79119)
                     /locus_tag="UM146_24521"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(79484..80242)
                     /locus_tag="UM146_24526"
                     /db_xref="GeneID:12703311"
     CDS             complement(79484..80242)
                     /locus_tag="UM146_24526"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006104111.1"
                     /db_xref="GI:386602603"
                     /db_xref="GeneID:12703311"
                     /translation="MYDPAVQRPLRQTRTRKPFPESLPRDEKRLLPAAPCCPNCGGSL
                     SYLGEDTAEQLELMRSAFRVIRTVREKHACTQCDAIVQAPAPSRPIERGIAGPGLLAR
                     VLTSKYAEHTPLYRQSEIYGRQGVELSRSLLSGWVDACCRLLSPLEEALHGYVLTDGK
                     LHADDTPVPVLLPGNKKTKTGRLWTYVRDDRNAGSTLAPAVWFAYSPDRKGIHPQTHL
                     AGFSGVLQADAVTNGAIVLHTQRLKSDPGGNLLS"
     misc_feature    complement(79739..80221)
                     /locus_tag="UM146_24526"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    complement(80009..80146)
                     /locus_tag="UM146_24526"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     gene            complement(80244..80501)
                     /locus_tag="UM146_24531"
                     /db_xref="GeneID:12703312"
     CDS             complement(80244..80501)
                     /locus_tag="UM146_24531"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006104112.1"
                     /db_xref="GI:386602604"
                     /db_xref="GeneID:12703312"
                     /translation="MSSSLPDDINALKRLLAEQEALNRALLEKLNEREREIDHLQAQL
                     DKLRRMNFGSRSEKVSRRIAQMEADLNRLQKESDRERYADW"
     misc_feature    complement(<80349..>80465)
                     /locus_tag="UM146_24531"
                     /note="Autophagy protein Apg6; Region: APG6; pfam04111"
                     /db_xref="CDD:252382"
     gene            complement(80550..80897)
                     /locus_tag="UM146_24536"
                     /db_xref="GeneID:12703313"
     CDS             complement(80550..80897)
                     /locus_tag="UM146_24536"
                     /note="COG3436 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS66 family element"
                     /protein_id="YP_006104113.1"
                     /db_xref="GI:386602605"
                     /db_xref="GeneID:12703313"
                     /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTTLKDDPMSGHVF
                     IFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLEGIDW
                     RQPKRLLTSLTML"
     misc_feature    complement(80577..80897)
                     /locus_tag="UM146_24536"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    complement(80577..80882)
                     /locus_tag="UM146_24536"
                     /note="IS66 Orf2 like protein; Region: TnpB_IS66;
                     pfam05717"
                     /db_xref="CDD:253347"
     gene            complement(80894..81298)
                     /locus_tag="UM146_24541"
                     /db_xref="GeneID:12703314"
     CDS             complement(80894..81298)
                     /locus_tag="UM146_24541"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="ISSfl3 protein"
                     /protein_id="YP_006104114.1"
                     /db_xref="GI:386602606"
                     /db_xref="GeneID:12703314"
                     /translation="MKSLTAVRKKSPNYPVEFKIKMVELSHRPEISVAQLAREHGIND
                     NLLFKWRQYWREGKLRPPSTTENNVPELLPITLDAEDVVPTTSPRSQPVAAATPESLN
                     ISCEVTFRHGSLRLNGAISENILNLLIRELKR"
     misc_feature    complement(<81107..81277)
                     /locus_tag="UM146_24541"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     misc_feature    complement(<81086..81274)
                     /locus_tag="UM146_24541"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            complement(81327..81683)
                     /locus_tag="UM146_24546"
                     /db_xref="GeneID:12703315"
     CDS             complement(81327..81683)
                     /locus_tag="UM146_24546"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006104115.1"
                     /db_xref="GI:386602607"
                     /db_xref="GeneID:12703315"
                     /translation="MAFIIDVFAGYIVGWRVSSSMETTFVLDALEQALWARRPSGTVH
                     HSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGLYKAEVIHRKSWKNR
                     KRRLSTVWQILKFLRE"
     misc_feature    complement(81405..>81680)
                     /locus_tag="UM146_24546"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(81800..83323)
                     /locus_tag="UM146_24551"
                     /db_xref="GeneID:12703316"
     CDS             complement(81800..83323)
                     /locus_tag="UM146_24551"
                     /note="COG3344 Retron-type reverse transcriptase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative group II intron-encoded reverse
                     transcriptase"
                     /protein_id="YP_006104116.1"
                     /db_xref="GI:386602608"
                     /db_xref="GeneID:12703316"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRIVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGR
                     WVIEGDLSSYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVP
                     QGGVISPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPA
                     VAYCRYADDFVLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLG
                     HRIIRKRSRYGEMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWA
                     MFYQFVDFKAKVFSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLF
                     GKTNHGKLSGEILYWLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
     misc_feature    complement(82424..83314)
                     /locus_tag="UM146_24551"
                     /note="Retron-type reverse transcriptase [DNA replication,
                     recombination, and repair]; Region: COG3344"
                     /db_xref="CDD:225881"
     misc_feature    complement(82313..83065)
                     /locus_tag="UM146_24551"
                     /note="RT_G2_intron: Reverse transcriptases (RTs) with
                     group II intron origin. RT transcribes DNA using RNA as
                     template. Proteins in this subfamily are found in
                     bacterial and mitochondrial group II introns. Their most
                     probable ancestor was a retrotransposable...; Region:
                     RT_G2_intron; cd01651"
                     /db_xref="CDD:238828"
     misc_feature    complement(order(82322..82327,82469..82474,82478..82480,
                     82664..82669,82811..82828))
                     /locus_tag="UM146_24551"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    complement(order(82472..82474,82667..82669,82811..82828))
                     /locus_tag="UM146_24551"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    complement(82664..82666)
                     /locus_tag="UM146_24551"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    complement(82019..82210)
                     /locus_tag="UM146_24551"
                     /note="Group II intron, maturase-specific domain; Region:
                     GIIM; pfam08388"
                     /db_xref="CDD:254769"
     gene            complement(83915..84139)
                     /locus_tag="UM146_24556"
                     /db_xref="GeneID:12703317"
     CDS             complement(83915..84139)
                     /locus_tag="UM146_24556"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for insertion sequence element"
                     /protein_id="YP_006104117.1"
                     /db_xref="GI:386602609"
                     /db_xref="GeneID:12703317"
                     /translation="MARLMAVMGLAGVLRGKKVRTTVSRKAVAAGDRVNRQFVAERPD
                     QLWVADFTYGVPGVQGGHGCLNEPRVCLEY"
     misc_feature    complement(<83981..>84136)
                     /locus_tag="UM146_24556"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            84417..85916
                     /locus_tag="UM146_24561"
                     /db_xref="GeneID:12703318"
     CDS             84417..85916
                     /locus_tag="UM146_24561"
                     /note="COG4584 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104118.1"
                     /db_xref="GI:386602610"
                     /db_xref="GeneID:12703318"
                     /translation="MTFNTSQVSYYMTQRKKGITQHISAMKAGISVRSGRRIEKGEWA
                     KNSVRHWRTRKDPLEAVWDSMLVPLLKERPALTPTTLLEMLQDKYPGQYPNSLRRTMQ
                     RRVCEWKLQYGAEQEVMFRQRHQPGLRGLSDFTELKGVVVTIAGKLLAHKLYHFRLEW
                     SHWSWMRVVLGGESFSALAEGLQEALGQLGGVPVEHKTDSLRAAWKQQGEDGRRELTE
                     RYAALCQHYGMQGVHNNAGRGHENGSVESAHGHLKRRICQALILRGSNDFSTIEEYQA
                     FITQQVMRHNRNNQDLVKEERLHLKPLPLRRSADYDELTVRVSRSSTINVKHVVYSVP
                     SRLVGQLLRVRLWDDRLSCYVGSSEVMSCPRVRPEKGKTRARRIDFRHVIDSLAKKPG
                     AFCHATLRNDILPDDEWRRLWRRLCNHLEPDMAGRLMVHALKLAAGYDDISVVAKGME
                     QMLNTPGNVDLHRLMRFLGIKEKALPVVNVKQHNLSSYEQLLRGKGGSQ"
     misc_feature    84780..85184
                     /locus_tag="UM146_24561"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            85913..86668
                     /locus_tag="UM146_24566"
                     /db_xref="GeneID:12703319"
     CDS             85913..86668
                     /locus_tag="UM146_24566"
                     /note="COG1484 DNA replication protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative IS element ATP-binding protein"
                     /protein_id="YP_006104119.1"
                     /db_xref="GI:386602611"
                     /db_xref="GeneID:12703319"
                     /translation="MSNIHHLERSLRKLRLTRVGAEWHALEKRALAEGWTPSRYLLTL
                     CNEELLWRESEKLRRYKKEARLPVAKTLSEYDFSQVPELNGAQFRQLCETTDWVDAGE
                     NVLLFGASGLGKSHLAAAIVDGVVGQGYRARFYSAGELLQELRKARAQLKLNELLLKL
                     DRYRVIVVDDLGYVKRDSAETGVLFELIAHRYERGSLVITSNHPFSMWGSIFVDETMA
                     VAAADRLIHHGYMFELKGESYRKKTAKAVTSAT"
     misc_feature    85919..86638
                     /locus_tag="UM146_24566"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    86201..86530
                     /locus_tag="UM146_24566"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    86234..86257
                     /locus_tag="UM146_24566"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(86237..86260,86417..86419,86516..86518)
                     /locus_tag="UM146_24566"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    86405..86422
                     /locus_tag="UM146_24566"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(86810..87136)
                     /locus_tag="UM146_24571"
                     /db_xref="GeneID:12703320"
     CDS             complement(86810..87136)
                     /locus_tag="UM146_24571"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS629 orfA"
                     /protein_id="YP_006104120.1"
                     /db_xref="GI:386602612"
                     /db_xref="GeneID:12703320"
                     /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWATICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEF
                     DRLWKK"
     misc_feature    complement(86891..87136)
                     /locus_tag="UM146_24571"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    complement(86813..87133)
                     /locus_tag="UM146_24571"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            87201..87467
                     /locus_tag="UM146_24576"
                     /db_xref="GeneID:12703321"
     CDS             87201..87467
                     /locus_tag="UM146_24576"
                     /codon_start=1
                     /transl_table=11
                     /product="IS1294 transposase"
                     /protein_id="YP_006104121.1"
                     /db_xref="GI:386602613"
                     /db_xref="GeneID:12703321"
                     /translation="MVRYFGFLANRVCGEKLPQVYRALGMDKPEAVAKVCYAQMVKQF
                     LSRDPFECVLCGGRMVYRRAIAGLNVSGLKKNARDISLLRYMPA"
     gene            complement(87990..89264)
                     /locus_tag="UM146_24581"
                     /db_xref="GeneID:12703322"
     CDS             complement(87990..89264)
                     /locus_tag="UM146_24581"
                     /note="COG3391 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative enterotoxin protein SenB"
                     /protein_id="YP_006104122.1"
                     /db_xref="GI:386602614"
                     /db_xref="GeneID:12703322"
                     /translation="MDIWRGHSFLMTISARFRQYVFSLMSILLQERKMNIFTLSKAPL
                     YLLISLFLPTMAMAIDPPERELSRFALKTNYLQSPDEGVYELAFDNASKKVFAAVTDR
                     VNREANKGYLYSFNSDSLKVENKYTMPYRAFSLAINQDKHQLYIGHTQSASLRISMFD
                     TPTGKLVRTSDRLSFKAANAADSRFEHFRHMVYSQDSDTLFVSYSNMLKTAEGMKPLH
                     KLLMLDGTTLALKGEVKDAYKGTAYGLTMDEKTQKIYVGGRDYINEIDAKNQTLLRTI
                     PLKDPRPQITSVQNLAVDSASDRAFVVVFDHDDRSGTKDGLYIFDLRDGKQLGYVHTG
                     AGANAVKYNPKYNELYVTNFTSGTISVVDATKYSITREFNMPVYPNQMVLSDDMDTLY
                     IGIKEGFNRDWDPDVFVEGAKERILSIDLKKS"
     misc_feature    complement(88089..89021)
                     /locus_tag="UM146_24581"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3391"
                     /db_xref="CDD:225926"
     misc_feature    complement(88110..88220)
                     /locus_tag="UM146_24581"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     gene            complement(89234..91495)
                     /locus_tag="UM146_24586"
                     /db_xref="GeneID:12703323"
     CDS             complement(89234..91495)
                     /locus_tag="UM146_24586"
                     /note="COG1629 Outer membrane receptor proteins, mostly Fe
                     transport"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent colicin J protein CjrC"
                     /protein_id="YP_006104123.1"
                     /db_xref="GI:386602615"
                     /db_xref="GeneID:12703323"
                     /translation="MNVIKLAIGSGILLLSCGAYSQSISEKTNSDKKGAAEFSPLSVS
                     VGKTTSEQEALEKTGATSSRTTDKNLQSLDATVRSMPGTYTQIDPGQGAISVNIRGMS
                     GFGRVNTMVDGITQSFYGTSTSGTTTHGSTNNMAGVLIDPNLLVAVDVTRGDSSGSEG
                     INALAGSANMRTIGVDDVIFNGNTYGLRSRFSVGSNGLGRSGMIALGGKSDAFTDTGS
                     IGVMAAVSGSSVYSNFSNGSGINSKEFGYDKYMKQNPKSQLYKMDIRPDEFNSFELSA
                     RTYENKFTRRDITSDDYYIKYHYTPFSELIDFNVTASTSRGNQKYRDGSLYTFYKTSA
                     QNRSDALDINNTSRFTVADNDLEFMLGSKLMRTRYDRTIHSAAGDPKANQESIENNPF
                     APSGQQDISALYTGLKVTRGIWEADFNLNYTRNRITGYKPACDSRVICVPQGSYDIDD
                     KEGGFNPSVQLSAQVTPWLQPFIGYSKSMRAPNIQEMFFSNSGGASMNPFLKPERAET
                     WQAGFNIDTRDLLVEQDALRFKALAYRSRIQNYIYSESYLVCSGGRKCSLPEVIGNGW
                     EGISDEYSDNMYIYVNSASDVIAKGFELEMDYDAGFAFGRLSFSQQQTDQPTSIASTH
                     FGAGDITELPRKYMTLDTGVRFFDNALTLGTIIKYTGKARRLSPDFEQDEHTGAIIKQ
                     DLPQIPTIIDLYGTYEYNRNLTLKLSVQNLMNRDYSEALNKLNMMPGLGDETHPANSA
                     RGRTWIFGGDIRF"
     misc_feature    complement(89309..91375)
                     /locus_tag="UM146_24586"
                     /note="TonB-dependent heme/hemoglobin receptor family
                     protein; Region: TonB-hemin; TIGR01785"
                     /db_xref="CDD:233576"
     misc_feature    complement(89237..91297)
                     /locus_tag="UM146_24586"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            complement(91664..92440)
                     /locus_tag="UM146_24591"
                     /db_xref="GeneID:12703324"
     CDS             complement(91664..92440)
                     /locus_tag="UM146_24591"
                     /note="COG0810 Periplasmic protein TonB, links inner and
                     outer membranes"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent colicin J protein CjrB"
                     /protein_id="YP_006104124.1"
                     /db_xref="GI:386602616"
                     /db_xref="GeneID:12703324"
                     /translation="MMNILHFSQSVKWSSWFICSLLLHGLIFLAFIWRFSEVQPAMSP
                     APAIMLQWAEIIEAPSSPLSLPVGIAQQESAVTEEKQQTEDRQQRPVTEDSDATIEIT
                     RKKKSSDGEKKKTRPPRKIKAQTSDSNPTAVSSNAAPQALVESSRIAAPFNSDSTKRD
                     NSEASWESRVKGHLNRYKRYPGDARKRARTGTAVVTFTVNTEGTIVSSFLEISSGTFS
                     LDREAIAVLERAQPLPKPPPEILEGGLFKVKMPITFKLKE"
     misc_feature    complement(91670..92383)
                     /locus_tag="UM146_24591"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    complement(91670..91891)
                     /locus_tag="UM146_24591"
                     /note="TonB family C-terminal domain; Region: tonB_Cterm;
                     TIGR01352"
                     /db_xref="CDD:213607"
     gene            complement(92448..93365)
                     /locus_tag="UM146_24596"
                     /db_xref="GeneID:12703325"
     CDS             complement(92448..93365)
                     /locus_tag="UM146_24596"
                     /note="COG3016 Uncharacterized iron-regulated protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CjrA"
                     /protein_id="YP_006104125.1"
                     /db_xref="GI:386602617"
                     /db_xref="GeneID:12703325"
                     /translation="MSINIWKHIVSDGNMRKFILISMITLASVSLGACRQNVTIKQDA
                     PGQKAFLTDGQIYDLHSGKIISSSELLADLATAQHLIIGEKHDNAEHHQIELWLIQNL
                     LIQRPQGSVLLEMLTSEQQPRVNQVKCWLKDNPVVRDSRVQELLNWQKGWSWEMYGDI
                     VMQLLRGPYPLLNANIGREQILALYKKNEFPKGKKSTAPVVQEALRETIISMHEGNLE
                     SQQLTSMLSIQQQRDRYMARQLLSAPVPSLLIAGGYHASKSMGVPLHMEDLATGTHPV
                     VLMLAEKGMNITVDHADYVWFVAPDTTKR"
     misc_feature    complement(92562..93173)
                     /locus_tag="UM146_24596"
                     /note="Protein of unknown function, DUF399; Region:
                     DUF399; pfam04187"
                     /db_xref="CDD:252436"
     gene            complement(93655..94221)
                     /locus_tag="UM146_24601"
                     /db_xref="GeneID:12703326"
     CDS             complement(93655..94221)
                     /locus_tag="UM146_24601"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104126.1"
                     /db_xref="GI:386602618"
                     /db_xref="GeneID:12703326"
                     /translation="MNGHAHLLYALNIAVRTAPDSSVKALKYAAAIERSLCEKLCADV
                     NYSGLICKNPFHLEWQVMEWREEAYTLDELADYLDLSASARRSIDKHYGMGRNCHLFE
                     MTRKWAYRAIRQGWPEFSQWLDAVIQRVEMYNASLPVPLSPPECRAIGKSIAKYTHRN
                     FTPETFAQYVADTHTLTYVFVPLALTPR"
     misc_feature    complement(93985..>94218)
                     /locus_tag="UM146_24601"
                     /note="Replicase family; Region: Replicase; pfam03090"
                     /db_xref="CDD:251722"
     misc_feature    complement(93745..93969)
                     /locus_tag="UM146_24601"
                     /note="Primase C terminal 1 (PriCT-1); Region: PriCT_1;
                     pfam08708"
                     /db_xref="CDD:254989"
     gene            complement(94472..94564)
                     /locus_tag="UM146_24606"
                     /db_xref="GeneID:12703327"
     CDS             complement(94472..94564)
                     /locus_tag="UM146_24606"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104127.1"
                     /db_xref="GI:386602619"
                     /db_xref="GeneID:12703327"
                     /translation="MQPSKNDSGAFFWFGLVFSCLFAFFAPESG"
     gene            94798..94980
                     /locus_tag="UM146_24611"
                     /db_xref="GeneID:12703328"
     CDS             94798..94980
                     /locus_tag="UM146_24611"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104128.1"
                     /db_xref="GI:386602620"
                     /db_xref="GeneID:12703328"
                     /translation="MKYDFINGSSILIIVWMTIAVIIRVTNWKFNKKTAPAISLFLAF
                     PASIVILLVYIFFFDK"
     gene            complement(95793..96128)
                     /locus_tag="UM146_24616"
                     /db_xref="GeneID:12703329"
     CDS             complement(95793..96128)
                     /locus_tag="UM146_24616"
                     /note="COG0365 Acyl-coenzyme A synthetases/AMP-(fatty)
                     acid ligases"
                     /codon_start=1
                     /transl_table=11
                     /product="immunity protein"
                     /protein_id="YP_006104129.1"
                     /db_xref="GI:386602621"
                     /db_xref="GeneID:12703329"
                     /translation="MNRKYYFNNMWWGWVTGGYMLYMSWDYDFKYRLLFWCISLCGMV
                     LYPVAKWYIEDTALKFTRPDFWNSGFFTDTPGKMGLLAVYTGTVFILSLPLSMIYILS
                     VIIKRLSVR"
     misc_feature    complement(95892..>95999)
                     /locus_tag="UM146_24616"
                     /note="Colicin E1 (microcin) immunity protein; Region:
                     Microcin; pfam03526"
                     /db_xref="CDD:112349"
     gene            complement(96624..97133)
                     /locus_tag="UM146_24621"
                     /db_xref="GeneID:12703330"
     CDS             complement(96624..97133)
                     /locus_tag="UM146_24621"
                     /codon_start=1
                     /transl_table=11
                     /product="YdeA"
                     /protein_id="YP_006104130.1"
                     /db_xref="GI:386602622"
                     /db_xref="GeneID:12703330"
                     /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGPVLTRDIERVLEQSGEA
                     PVYGPNLRASCRRLEDAGWLRTLRAPNLQLAVELTDAGRAVAQPLLPAGGTSATDLAV
                     ELNGITYQACRGDFVVRLDGSTCLQLWNKEGRVVRREGDPLEVAQWLQACHDAGMEVR
                     VQINESAAP"
     gene            complement(97130..97390)
                     /locus_tag="UM146_24626"
                     /db_xref="GeneID:12703331"
     CDS             complement(97130..97390)
                     /locus_tag="UM146_24626"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104131.1"
                     /db_xref="GI:386602623"
                     /db_xref="GeneID:12703331"
                     /translation="MDQEMTFSLSYEQLTRFAEKRIRECNLDSHGVTYLCESAKAGAV
                     LIFWHELAINGYTSMNAIKRQEIIDADHQRLRKLIWPEDDWK"
     gene            97492..97818
                     /locus_tag="UM146_24631"
                     /db_xref="GeneID:12703332"
     CDS             97492..97818
                     /locus_tag="UM146_24631"
                     /note="COG2963 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative IS629 transposase OrfA"
                     /protein_id="YP_006104132.1"
                     /db_xref="GI:386602624"
                     /db_xref="GeneID:12703332"
                     /translation="MTKNTRFSPEVRQRAIRMVLESQGEYDSQWAAICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTTAERQRLKELERENRELRRSNDILRQASAYFAKAEF
                     DRLWKK"
     misc_feature    97492..97737
                     /locus_tag="UM146_24631"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    97495..97815
                     /locus_tag="UM146_24631"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            97815..98297
                     /locus_tag="UM146_24636"
                     /db_xref="GeneID:12703333"
     CDS             97815..98297
                     /locus_tag="UM146_24636"
                     /note="COG2801 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase ORF B, IS629"
                     /protein_id="YP_006104133.1"
                     /db_xref="GI:386602625"
                     /db_xref="GeneID:12703333"
                     /translation="MMPLLDKLRKLYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSAR
                     AQRDDWLKKEILRVYDGNHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRG
                     KKVRTTVSRKAVAAGDRVNRQFVAERPDQLWVADFTYGVPGVQGGHGCLNEPRVCLEY
                     "
     misc_feature    97950..98126
                     /locus_tag="UM146_24636"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     gene            98889..99392
                     /locus_tag="UM146_24641"
                     /db_xref="GeneID:12703334"
     CDS             98889..99392
                     /locus_tag="UM146_24641"
                     /note="COG3344 Retron-type reverse transcriptase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase protein"
                     /protein_id="YP_006104134.1"
                     /db_xref="GI:386602626"
                     /db_xref="GeneID:12703334"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRISIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMI
                     RQWERSQ"
     misc_feature    98898..>99269
                     /locus_tag="UM146_24641"
                     /note="Retron-type reverse transcriptase [DNA replication,
                     recombination, and repair]; Region: COG3344"
                     /db_xref="CDD:225881"
     misc_feature    99147..>99218
                     /locus_tag="UM146_24641"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:261455"
     misc_feature    <99225..99356
                     /locus_tag="UM146_24641"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(99431..99751)
                     /locus_tag="UM146_24646"
                     /db_xref="GeneID:12703335"
     CDS             complement(99431..99751)
                     /locus_tag="UM146_24646"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104135.1"
                     /db_xref="GI:386602627"
                     /db_xref="GeneID:12703335"
                     /translation="MGTMDPTFNPVITDDSAAFSQKAVQAMEKERSQMQLDDSYQLLA
                     QMTDYKDSPSCKEKQQCSLTEAKDAFREGANKQVMSSQADSLIKISRIWADFCPANTS
                     NQPI"
     misc_feature    complement(<99521..>99751)
                     /locus_tag="UM146_24646"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:264352"
     gene            complement(99726..100175)
                     /locus_tag="UM146_24651"
                     /db_xref="GeneID:12703336"
     CDS             complement(99726..100175)
                     /locus_tag="UM146_24651"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glucose-1-phosphatase"
                     /protein_id="YP_006104136.1"
                     /db_xref="GI:386602628"
                     /db_xref="GeneID:12703336"
                     /translation="MKKLILAAAVAGAVLLSSAAQAQTTPEGYQLQQVLMMSRHNLRA
                     PLANNGSVLEQSTPNQWPEWDVPGGQLTTKGGVLEIYMGHYMREWLAELGMVTSGECP
                     TPDTVYTYANSLQRTVATAQFFITGAFPGCDIPVHHQEKNGHDGPNV"
     misc_feature    complement(<99732..100088)
                     /locus_tag="UM146_24651"
                     /note="Histidine phosphatase domain found in histidine
                     acid phosphatases and phytases; contains a His residue
                     which is phosphorylated during the reaction; Region:
                     HP_HAP_like; cd07061"
                     /db_xref="CDD:132717"
     misc_feature    complement(order(99828..99830,100047..100049,
                     100056..100061))
                     /locus_tag="UM146_24651"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132717"
     gene            complement(100297..100782)
                     /locus_tag="UM146_24656"
                     /db_xref="GeneID:12703337"
     CDS             complement(100297..100782)
                     /locus_tag="UM146_24656"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104137.1"
                     /db_xref="GI:386602629"
                     /db_xref="GeneID:12703337"
                     /translation="MAFIWNDESLAILRENAGILTTEQIAQLLHTNITAVRNMAYRLK
                     LSLRVTAYNHRRIAQVQALYASETLSLKEIAAKTGLTASTVQYIVYVKSKNKPYATTE
                     YVSFETENAVHYRVQKEFVDTERSLLDNISDNTRFRELYLTDGTFYCARNIKYEVFIS
                     E"
     gene            complement(100807..101292)
                     /locus_tag="UM146_24661"
                     /db_xref="GeneID:12703338"
     CDS             complement(100807..101292)
                     /locus_tag="UM146_24661"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="putative disulfide reductase"
                     /protein_id="YP_006104138.1"
                     /db_xref="GI:386602630"
                     /db_xref="GeneID:12703338"
                     /translation="MRWHNVLLLAAAILISGCKEEKLAVGAPAPALAAFDLQGQESGL
                     ERWQGKAVYLNFWSAGCGGCLAEMDTLEALSKKWGDKVVVVAVNTDPETVRINDLLAK
                     HQITYPVVRDQLNITQERYQVIGTPTSVLIDSEGRVLELHQGMRKPSELEATFARLAA
                     R"
     misc_feature    complement(100861..101202)
                     /locus_tag="UM146_24661"
                     /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
                     similar proteins. TlpA, ResA and DsbE are bacterial
                     protein disulfide reductases with important roles in
                     cytochrome maturation. They are membrane-anchored proteins
                     with a soluble TRX domain containing a...; Region:
                     TlpA_like_family; cd02966"
                     /db_xref="CDD:239264"
     misc_feature    complement(order(101101..101103,101110..101112))
                     /locus_tag="UM146_24661"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239264"
     gene            complement(101279..101974)
                     /locus_tag="UM146_24666"
                     /db_xref="GeneID:12703339"
     CDS             complement(101279..101974)
                     /locus_tag="UM146_24666"
                     /note="COG1136 ABC-type antimicrobial peptide transport
                     system, ATPase component"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum transport ATP-binding protein modC"
                     /protein_id="YP_006104139.1"
                     /db_xref="GI:386602631"
                     /db_xref="GeneID:12703339"
                     /translation="MSVTHIPQVAIETRHLYKRFGDVTALDDINLRIAQGEFVAIMGA
                     SGSGKTTLMNILTCLDTATEGQVFLDGTDAAALDEEGRRRFRAEKIGLVFQQFHLIPF
                     LTALENIMLAQHYHSVVDEAAARKVLEQVGLGHRVTHLPSQLSGGEQQRVCIARALVN
                     EPPVIFADEPTGNLDEENEQRVLDLLTDLHRQGRTIVMVTHNPALGQFADRILRLQHG
                     KYLGEEANQHALA"
     misc_feature    complement(101318..101947)
                     /locus_tag="UM146_24666"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    complement(101318..101944)
                     /locus_tag="UM146_24666"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    complement(101825..101848)
                     /locus_tag="UM146_24666"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(order(101372..101374,101468..101473,
                     101690..101692,101822..101830,101834..101839))
                     /locus_tag="UM146_24666"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(101690..101701)
                     /locus_tag="UM146_24666"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(101516..101545)
                     /locus_tag="UM146_24666"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(101468..101485)
                     /locus_tag="UM146_24666"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(101450..101461)
                     /locus_tag="UM146_24666"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    complement(101366..101386)
                     /locus_tag="UM146_24666"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            complement(101990..103108)
                     /locus_tag="UM146_24671"
                     /db_xref="GeneID:12703340"
     CDS             complement(101990..103108)
                     /locus_tag="UM146_24671"
                     /note="COG0577 ABC-type antimicrobial peptide transport
                     system, permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter permease"
                     /protein_id="YP_006104140.1"
                     /db_xref="GI:386602632"
                     /db_xref="GeneID:12703340"
                     /translation="MAAKRTMLWLLVWRALRLRFQRVSVVFAALMVGATIVTALFAVW
                     FDINTKMSEELRTFGANFYIGPGHGSSMPQQELQSILDQAPQGLVHGASPWLYGMART
                     ELEKVVMVGVWFESLQKLVPYWQVTGSWIGVSFDDRNAMIGVKLAERLNVQPGDSITL
                     VDHNQRKNLQIKGIVESGDATDNMLIVSLDVAQAWLHQPGKISHGLLSVSNDVGQVEN
                     YASRLQAQYPDLEIRPVRKVSASEGQVLDKIKGLMGLVSIVILALSSLCVNTTLMAIV
                     GERAREFALQKALGSSNGDIVRQILLETSIIALAAVACGWVLGYLLAQLLGLTVFNAA
                     ISLRLPVLPITLVLSLLVAILAAIVPVRRAVASSLLKC"
     misc_feature    complement(102017..103090)
                     /locus_tag="UM146_24671"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    complement(102434..103072)
                     /locus_tag="UM146_24671"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    complement(102002..102346)
                     /locus_tag="UM146_24671"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(103098..104381)
                     /locus_tag="UM146_24676"
                     /db_xref="GeneID:12703341"
     CDS             complement(103098..104381)
                     /locus_tag="UM146_24676"
                     /note="COG0577 ABC-type antimicrobial peptide transport
                     system, permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_006104141.1"
                     /db_xref="GI:386602633"
                     /db_xref="GeneID:12703341"
                     /translation="MLWRMLRQSWGRNLRRKVLAIITVFLASSLISALLAVSIDIGDK
                     MSRELKSYGANILIEPAGQAALPALFSESSNPLSGQDFLDEAELPNIKDIFWRNNIVG
                     FAPMLGGEASVEGEPVRILGTFFSQPVDIPDEEGYETGQKTVSPYWQVTGDWPQEPAG
                     AEPQTLVGHALARQMGWKPGDKLTLRTEGEAVQVTVSGILSSGGDEDNQLVMPLSTVQ
                     HLLGLPGKVQAIRVSALTVPENELSRRARENLDALNAEEYDLWYCTAYVSSIAHQLEE
                     AISGAEVRPVWQVAASEGVVIDKIQLLMAVVTVAALVASAMGIASLMTSTIMERAKEI
                     GLMKALGARQWQIMLLFYLEAASSGLAGGALGCIAGWGLAKAIGVMLFDAPLNFAWIV
                     VPCVLVIAVLIALIGTWFPARRIARLYPVEVLYGR"
     misc_feature    complement(103680..104375)
                     /locus_tag="UM146_24676"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    complement(103101..104339)
                     /locus_tag="UM146_24676"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    complement(103122..103433)
                     /locus_tag="UM146_24676"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(104384..105763)
                     /locus_tag="UM146_24681"
                     /db_xref="GeneID:12703342"
     CDS             complement(104384..105763)
                     /locus_tag="UM146_24681"
                     /note="COG4393 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104142.1"
                     /db_xref="GI:386602634"
                     /db_xref="GeneID:12703342"
                     /translation="MSYFFVTTLQVFFCIALLSGVLWSRNDPPSLRPLTWTLLTGLIA
                     GVLAGLFIHGSQPVQLLLVGAEVMVSLLFVLSFWWASTRIRYLWQGILIFGAARHWAL
                     DPNLGGLTSTHVLNTDLLLNLTAVVLAFAILCLAGVLCAMLLRRIRGLYWPLTLILLV
                     MIWLPLSGNLLLLLMKLQVVPLGKSLLSFVAKVTNNTALYNWAGAALLLALALCWLPA
                     LLRAFRQTRETEEPIAHRLALAQRRNALRLWLVTIGCAVVVIAGQLWWDKVASQPPQL
                     SEAVPVTLGSDGMVRLPVEQLRDGKLHRFVWVADDGKAVRFFVINRYPDKLRFGVVFD
                     ACLLCGDQGYVMEGNQVICVACGVHIFIPSIGKAGGCNPVPIENWHNDEKELVIPGKE
                     LATGVNYFSTVMTIKVTDPVDGSTLTNTSADYKYSYGGKTWFFSSEANYERFRETPEQ
                     FVPADMREE"
     misc_feature    complement(104549..105763)
                     /locus_tag="UM146_24681"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4393"
                     /db_xref="CDD:226828"
     misc_feature    complement(104564..104878)
                     /locus_tag="UM146_24681"
                     /note="Predicted membrane protein (DUF2318); Region:
                     DUF2318; pfam10080"
                     /db_xref="CDD:150722"
     misc_feature    complement(104408..104548)
                     /locus_tag="UM146_24681"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3350"
                     /db_xref="CDD:225886"
     gene            complement(105867..106394)
                     /locus_tag="UM146_24686"
                     /db_xref="GeneID:12703343"
     CDS             complement(105867..106394)
                     /locus_tag="UM146_24686"
                     /note="COG3470 Uncharacterized protein probably involved
                     in high-affinity Fe2+ transport"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104143.1"
                     /db_xref="GI:386602635"
                     /db_xref="GeneID:12703343"
                     /translation="MTMKKTLIASAVMASIFIAPAAFAFKEYPAGEPVTMNEMELAAV
                     YLQPIDMEPRGMGLPAAKADVHLEADIHAVEGNKNGFGAGEWIPYLTISYTLVNNDTG
                     EKQEGTFMPMVASDGPHYGANIKMMGVGNYKVTYHIEPPSKAGMHRHTDSETGVGRWW
                     KPFDVSYEFKYVGLN"
     misc_feature    complement(105870..106394)
                     /locus_tag="UM146_24686"
                     /note="Uncharacterized protein probably involved in
                     high-affinity Fe2+ transport [Inorganic ion transport and
                     metabolism]; Region: Tpd; COG3470"
                     /db_xref="CDD:226001"
     gene            complement(108667..109428)
                     /locus_tag="UM146_24691"
                     /db_xref="GeneID:12703344"
     CDS             complement(108667..109428)
                     /locus_tag="UM146_24691"
                     /note="COG2869 Na+-transporting NADH:ubiquinone
                     oxidoreductase, subunit NqrC"
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)-translocating NADH-quinone reductase
                     subunit C"
                     /protein_id="YP_006104144.1"
                     /db_xref="GI:386602636"
                     /db_xref="GeneID:12703344"
                     /translation="MRKGKIIVASMMVLCVLIFVAAAAWFMLFQGEMTEPTEEEKQAA
                     ILHAAGLMKSETQDKKSVETLYHRYIIQRHVNLDSGELVAGSSADTARQKCEKLAPER
                     DPAQVRQRCTVADVFFVKDKNNEIQQVIIPVTGKGAKSMMHAFLALGLDGRTVRNLYY
                     YQQRETPFLGARVEDANWRKQWPGKRLLDNSGHPALKIVQDKPEHADEYTVDGISGAT
                     LTSTGVEKSINYWMGPQGYGQFLQRLASDRNNLNL"
     misc_feature    complement(108679..109422)
                     /locus_tag="UM146_24691"
                     /note="Na+-transporting NADH:ubiquinone oxidoreductase,
                     subunit NqrC [Energy production and conversion]; Region:
                     NqrC; COG2869"
                     /db_xref="CDD:225424"
     misc_feature    complement(108697..109413)
                     /locus_tag="UM146_24691"
                     /note="Na(+)-translocating NADH-quinone reductase subunit
                     C; Provisional; Region: PRK05346"
                     /db_xref="CDD:235423"
     gene            complement(109665..110171)
                     /locus_tag="UM146_24696"
                     /db_xref="GeneID:12703345"
     CDS             complement(109665..110171)
                     /locus_tag="UM146_24696"
                     /note="COG0526 Thiol-disulfide isomerase and thioredoxins"
                     /codon_start=1
                     /transl_table=11
                     /product="suppressor for copper-sensitivity ScsD"
                     /protein_id="YP_006104145.1"
                     /db_xref="GI:386602637"
                     /db_xref="GeneID:12703345"
                     /translation="MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLH
                     TLDGETVTLASISEERPVLLYFWASWCGICRFTTPDVARLQSEGESVMTIALRSGNDG
                     EVSRWLSRKRVTFPVVNDSGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKL
                     RLWRAAMF"
     misc_feature    complement(109683..110039)
                     /locus_tag="UM146_24696"
                     /note="TlpA-like family, suppressor for copper sensitivity
                     D protein (ScsD) and actinobacterial DsbE homolog
                     subfamily; composed of ScsD, the DsbE homolog of
                     Mycobacterium tuberculosis (MtbDsbE) and similar proteins,
                     all containing a redox-active CXXC motif; Region:
                     TlpA_like_ScsD_MtbDsbE; cd03011"
                     /db_xref="CDD:239309"
     misc_feature    complement(order(109950..109952,109959..109961))
                     /locus_tag="UM146_24696"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239309"
     gene            complement(110161..110319)
                     /locus_tag="UM146_24701"
                     /db_xref="GeneID:12703346"
     CDS             complement(110161..110319)
                     /locus_tag="UM146_24701"
                     /note="COG1651 Protein-disulfide isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104146.1"
                     /db_xref="GI:386602638"
                     /db_xref="GeneID:12703346"
                     /translation="METLSTNLQLARLVGVQGTPATIIGDEMIPGAVSWETLEAVVKE
                     KLAVAHAQ"
     misc_feature    complement(110191..>110319)
                     /locus_tag="UM146_24701"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(110418..111122)
                     /locus_tag="UM146_24706"
                     /db_xref="GeneID:12703347"
     CDS             complement(110418..111122)
                     /locus_tag="UM146_24706"
                     /note="COG3316 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="IS26 transposase protein"
                     /protein_id="YP_006104147.1"
                     /db_xref="GI:386602639"
                     /db_xref="GeneID:12703347"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYLFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMGALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     misc_feature    complement(110481..111122)
                     /locus_tag="UM146_24706"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    complement(<110946..111110)
                     /locus_tag="UM146_24706"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    complement(110574..110900)
                     /locus_tag="UM146_24706"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(112178..113035)
                     /locus_tag="UM146_24711"
                     /db_xref="GeneID:12703348"
     CDS             complement(112178..113035)
                     /locus_tag="UM146_24711"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_006104148.1"
                     /db_xref="GI:386602640"
                     /db_xref="GeneID:12703348"
                     /translation="MTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVGFTSR
                     FDFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
                     SEDAVAAARRSRVEWENKQRKKQGLDTLGMDELIAKAWRFVRERFCSYQTELKSRGIK
                     RARARRDANRERQDIVTLVKRQLTREISEGRFSASREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     misc_feature    complement(112181..113035)
                     /locus_tag="UM146_24711"
                     /note="replication protein; Provisional; Region: PRK13750"
                     /db_xref="CDD:184300"
     gene            complement(113335..113595)
                     /locus_tag="UM146_24716"
                     /db_xref="GeneID:12703349"
     CDS             complement(113335..113595)
                     /locus_tag="UM146_24716"
                     /note="COG1123 ATPase components of various ABC-type
                     transport systems, contain duplicated ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_006104149.1"
                     /db_xref="GI:386602641"
                     /db_xref="GeneID:12703349"
                     /translation="MSQIENAVTSSPKRIYRKGNPLTGAEKQRISVSRKKGTHKAINV
                     FIQSELKDDLTQLCKDSGLTQKEMIEHWILKEKAAMTDANRK"
     misc_feature    complement(113347..113595)
                     /locus_tag="UM146_24716"
                     /note="replication protein; Provisional; Region: PRK13702"
                     /db_xref="CDD:184258"
     gene            complement(113835..114425)
                     /locus_tag="UM146_24721"
                     /db_xref="GeneID:12703350"
     CDS             complement(113835..114425)
                     /locus_tag="UM146_24721"
                     /note="COG1112 Superfamily I DNA and RNA helicases and
                     helicase subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006104150.1"
                     /db_xref="GI:386602642"
                     /db_xref="GeneID:12703350"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERILSGGEYWQRQKTLLTEREVSFMKGLFRIVDMKRWYLCPQVRVADIVQLNGNIRP
                     RSRQWWQLFRMVSQWHVDVVIVERRSFSIVAAVELDDASHLRPERRRRDILLEEVLRQ
                     AGIPLLRSHDARKLLQMTGEWLNTTGAVQQSPEHRS"
     misc_feature    complement(113925..114254)
                     /locus_tag="UM146_24721"
                     /note="Protein of unknown function (DUF2726); Region:
                     DUF2726; pfam10881"
                     /db_xref="CDD:256190"
CONTIG      join(CP002168.1:1..114550)
//
DBGET integrated database retrieval system