GenomeNet

Database: RefSeq
Entry: NC_017630
LinkDB: NC_017630
Original site: NC_017630 
LOCUS       NC_017630             114550 bp    DNA     circular CON 18-FEB-2017
DEFINITION  Escherichia coli UM146 plasmid pUM146, complete sequence.
ACCESSION   NC_017630
VERSION     NC_017630.1  GI:386602509
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00017915
            Assembly: GCF_000148605.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli UM146
  ORGANISM  Escherichia coli UM146
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Complete genome sequence of adherent invasive Escherichia coli
            UM146 isolated from ileal Crohn's disease biopsy tissue
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 114550)
  AUTHORS   Krause,D.O., Little,A.C., Dowd,S.E. and Bernstein,C.N.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2010) Research and Testing Laboratory, 4321
            Marsha Sharp Fwy, Lubbock, TX 79407, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP002168.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 01/23/2017 15:32:56
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.0
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 5,357
            CDS (total)                       :: 5,245
            Genes (coding)                    :: 4,927
            CDS (coding)                      :: 4,927
            Genes (RNA)                       :: 112
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 84
            ncRNAs                            :: 6
            Pseudo Genes (total)              :: 318
            Pseudo Genes (ambiguous residues) :: 4 of 318
            Pseudo Genes (frameshifted)       :: 206 of 318
            Pseudo Genes (incomplete)         :: 76 of 318
            Pseudo Genes (internal stop)      :: 75 of 318
            Pseudo Genes (multiple problems)  :: 39 of 318
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..114550
                     /organism="Escherichia coli UM146"
                     /mol_type="genomic DNA"
                     /strain="UM146"
                     /db_xref="taxon:869729"
                     /plasmid="pUM146"
     gene            complement(join(114463..114550,1..>2))
                     /locus_tag="UM146_RS27530"
                     /pseudo
     CDS             complement(join(114463..114550,1..>2))
                     /locus_tag="UM146_RS27530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958726.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(join(114500..114550,1..199))
                     /locus_tag="UM146_RS25575"
                     /old_locus_tag="UM146_24031"
                     /pseudo
     CDS             complement(join(114500..114550,1..199))
                     /locus_tag="UM146_RS25575"
                     /old_locus_tag="UM146_24031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001734701.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
     CDS             complement(237..446)
                     /locus_tag="UM146_RS24715"
                     /old_locus_tag="UM146_24036"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958726.1"
                     /note="with Hns involved in transcriptional regulation of
                     hemolysin; non-specific DNA-binding protein which affects
                     the production of multiple proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_014639534.1"
                     /db_xref="GI:504452432"
                     /translation="MAKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLXXSERESFNSAA
                     DHRLAELITGKLYDRIPKEIWKYVR"
     gene            complement(492..953)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
     CDS             complement(492..953)
                     /locus_tag="UM146_RS24720"
                     /old_locus_tag="UM146_24041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_001233843.1"
                     /db_xref="GI:447156587"
                     /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKAVR
                     IRLINIDAPEKKQDYGRWSTXMMKSLVAGKTVTVTYFQRDRYGRILGQVYAPDGMNVN
                     QFMVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     gene            complement(1156..1304)
                     /locus_tag="UM146_RS27535"
                     /pseudo
     CDS             complement(1156..1304)
                     /locus_tag="UM146_RS27535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792594.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(1198..1410)
                     /locus_tag="UM146_RS24725"
     CDS             complement(1198..1410)
                     /locus_tag="UM146_RS24725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001448735.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001309245.1"
                     /db_xref="GI:485668076"
                     /translation="MNGTGRDSQNSGVWRYRQVGRRAVRLEVRGDWPGAAEAWLRAAQ
                     SAPRTDWQQFARKRAEHCHRRCRGRV"
     gene            complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
     CDS             complement(1539..2099)
                     /locus_tag="UM146_RS24730"
                     /old_locus_tag="UM146_24046"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fertility inhibition protein"
                     /protein_id="WP_000139321.1"
                     /db_xref="GI:446061466"
                     /translation="MTEQKRPVLTLKRKTEGETPTRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELTAKKAQARQALSIYLNLPSLDEAVNTLKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEV
                     YAAERLDKIRRQNRIKAELQAVLDEQ"
     gene            complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
     CDS             complement(2202..3062)
                     /locus_tag="UM146_RS24735"
                     /old_locus_tag="UM146_24051"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_000704523.1"
                     /db_xref="GI:446627177"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPC
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDNESKVFFEKVKGQYPEMDIKIPFLTVMETLQYKPAESAA
                     KVQCPVLIVIAGQDSVNPPEQGKALYDAVASGTKELYEEADACHYDIYEGAFFERVAA
                     VQTQWFKKHL"
     gene            complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
     CDS             complement(3121..3867)
                     /locus_tag="UM146_RS24740"
                     /old_locus_tag="UM146_24056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylase TraX"
                     /protein_id="WP_000205724.1"
                     /db_xref="GI:446127869"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLM
                     VLDHINLIFQLKQEWMFLAGRGAFPLFALVWGLNLSRHAHIRQPAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSXRLYRAEDRAERLALXACLLAVIPALNLAXSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPVFYACHLAVLGVLAL"
     gene            complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
     CDS             complement(3887..9157)
                     /locus_tag="UM146_RS24745"
                     /old_locus_tag="UM146_24061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraI"
                     /protein_id="WP_000948350.1"
                     /db_xref="GI:446871094"
                     /translation="MLSFSVVKSAGSAGNYYTDKDNYYVLGSMGERWAGQGAEQLGLQ
                     GSVDKDVFTRLLEGRLPDGADLSRMQDGSNKHRPGYDLTFSAPKSVSMMAMLGGDKRL
                     IDAHNQAVDFAVRQVEALASTRVMTDGQSETVLTGNLVMALFNHDTSRDQDPQLHTHV
                     VVANVTQHNGEWKTLSSDKVGKTGFSENVLANRIAFGKIYQSELRQRVEALGYETEVV
                     GKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEIRMAE
                     WMQTLKETGFDIRAYRDAADQRAEIRTQAPGPASQDGPDVQQAVTQAIAGLSERKVQF
                     TYTDVLARTVGILPPENGVIERARAGIDEAISREQLIPLDREKGLFTSGIHVLDELSV
                     RALSRDIMKQNRVTVHPEKSVPRTAGYSDAVSVLAQDRPSLAIVSGQGGAAGQRERVA
                     ELVMMAREQGREVQIIAADRRSQMNLKQDERLSGELITGRRQLQEGMVFTPGSTVIVD
                     QGEKLSLKETLTLLDGAARHNVQVLITDSGQRTGTGSALMAMKDAGVNTYRWQGGEQR
                     PATIISEPDRNVRYDRLAGDFAASVKAGEESVAQVSGVREQAILTQAIRSELKTQGVL
                     GHPEVTMTALSPVWLDSRSRYLRDMYRPGMVMEQWNPETRSHDRYVIDRVTAQSHSLT
                     LRDAQGETQVVRISSLDSSWSLFRPEKMPVADGERLRVTGKIPGLRVSGGDRLQVASV
                     SEDAMTVVVPGRAEPAXLPVSDSPFTALKLENGWVETPGHSVSDSAXVFASVTQMAMD
                     NATLNGLARSGRDVRLYSSLDETRTAEKLARHPSFTVVSEQIKARAGETSLETAISLQ
                     KTGLHTPAQQAIHLALPVLESKNLAFSMVDLLTEAKSFAAEGTGFTELGGEINAQIKR
                     GDLLYVDVAKGYGTGLLVSRASYEAEKSILRHILEGKEAVTPLMERVPGELMETLTSG
                     QRAATRMILETSDRFTVVQGYAGVGKTTQFRAVMSAVNMLPASERPRVVGLGPTHRAV
                     GEMRSAGVDAQTLASFLHDTQLQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIA
                     AGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAADVXIMKEIVRQTPELREAVYXLINR
                     DVERALSGLESVKPSQVPRXEGAWAPEHSVTEFSHSQEAKLAEAQQKAMLKGETFPDV
                     PMTLYEAIVRDYTGRTPEAREQTLIVTHLNEDRRVLNSMIHDAREKAGELGQEQVMVP
                     VLNTANIRDGELRRLSTWENNPDALALVDSVYHRIAGISKDDGLITLEDAEGNTRLIS
                     PREAVAEGVTLYTPDKIRVGTGDRMRFTKSDRERGYVANSVWTVTAVSGDSVTLSDGQ
                     QTRVIRPGQERAEQHIDLAYAITAHGAQGASETFAIALEGTEGNRKLMAGFESAYVAL
                     SRMKQHVQVYTDNRQGWTDAINNAVQKGTAHDVLEPKPDREVMNAQRLFSTARELRDV
                     AAGRAVLRQAGLAGGDSPARFIAPGRKYPQPYVALPAFDRNGKSAGIWLNPLTTDDGN
                     GLRGFSGEGRVKGSGDAQFVALQGSRNGESLLADNMQDGVRIARDNPDSGVVVRIAGE
                     GRPWNPGAITGGRVWGDIPDNSVQPGAGNGEPVTAEVLAQRQAEEAIRRETERRADEI
                     VRKMAENKPDLPDGKTELAVRDIAGQERDRSAISERETALPESVLRESQREREAVREV
                     ARENLLQERLQQMERDMVRDLQKEKTLGGD"
     gene            complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
     CDS             complement(9157..11301)
                     /locus_tag="UM146_RS24750"
                     /old_locus_tag="UM146_24066"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="WP_000009377.1"
                     /db_xref="GI:445931522"
                     /translation="MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILXGLX
                     LWVKISWQTFXNGCIYWWCTXLEGMRDLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMI
                     WCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQQSENEVTGGRQLTDNPKDVA
                     RMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYARQRGDMVVI
                     YDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDP
                     FWQGSGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIE
                     KTAISIRAVLTNYVKAIRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHA
                     SLKPVISMWLSIAIRGLLAMGENRNRRVWFFCDELPTLHKLPDLVEILPEARKFGGCY
                     VFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIAEFAAGEIGEKEHLKASEQ
                     YSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSLKYQARP
                     KVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPVS
                     SVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQEN
                     HPDIQQHMQRREEVNINVHRERGEDVEPGDDF"
     gene            complement(11352..12089)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
     CDS             complement(11352..12089)
                     /locus_tag="UM146_RS24755"
                     /old_locus_tag="UM146_24071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016831975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000199902.1"
                     /db_xref="GI:446122047"
                     /translation="MTSDNIAEYVGENNQFTEKPVTEYPPVIQDNTVTTKDYLYSNNI
                     DTDLLVVIGGLIVILFLMMLIMYFINSLRHKELTEILEKISFPEKSGSNLLKPEAVSC
                     NLLSLCVLAPVLCTPRKLAEVSREIIVASAQEIAWTPGSSRIDGHQGENITWSLSSQS
                     PADKYDLINKTSXVSPDSGRFYEPDTVLDHRERVRLFIQIQFPHGSDWSEVLRLTDIV
                     TEKVSSGRXAGGXHHRHTGYTWSVSVN"
     gene            complement(12292..13017)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
     CDS             complement(12292..13017)
                     /locus_tag="UM146_RS24760"
                     /old_locus_tag="UM146_24076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_309339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraT"
                     /protein_id="WP_072093944.1"
                     /db_xref="GI:1114668551"
                     /translation="MKKLMMVALVSSTLALSGCGAMSTAIKKRNLEVKTQMSETIWLE
                     PASERTVFLQIKNTSDKDMSGLQGKIADAVKAKGYQVVTSPDKAYYWIQANVLKADKM
                     DLRESQGWLNRGYEGAAVGAALGAGITGYNSNSAGATLGVGLAAGLVGMAADAMVEDV
                     NYTMITDVQIAERTKATVTTDNVAALRQGTSGAKIQTSTETGNQHKYQTRVVSNANKV
                     NLKFEEAKPVLEDQLAKSIANIL"
     gene            complement(13072..13551)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
     CDS             complement(13072..13551)
                     /locus_tag="UM146_RS24765"
                     /old_locus_tag="UM146_24081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016236308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001363115.1"
                     /db_xref="GI:485735884"
                     /translation="MRCLTHITLVTVIQFIACYLAGWGNAETIFMLFFIVLWQGLFIW
                     LFSQIRKKRNVSDEFKFSKGVWYITIPVSSLLSPLLSLMVFIIGTLYELRRVSGCVSV
                     REWMQSQVNEQTNEDLHLDFDNMDFHRTNPATGLPMSGIGVDIGGNSYGYSSKRYDE"
     gene            complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
     CDS             complement(13573..16395)
                     /locus_tag="UM146_RS24770"
                     /old_locus_tag="UM146_24086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraG"
                     /protein_id="WP_001007080.1"
                     /db_xref="GI:446929824"
                     /translation="MNEVYVIAGGEWLSNNLNAIAAFMGTRTWDSIEKIALTLSVLAV
                     AVMWVQRHNVMDLLGWVAVFVLISLLVNVRTSVQIIDNSDLVKVHRVDNVPVGLAMPL
                     SLTTRIGHAMVASYEMIFTQPDSVTYSKTGMLFGAELVSKSTDFLSRNPEIANLFQDY
                     VQNCVMGDIYLNHKYTLEELMASADPYTLIFSRPSPLRGVYDSNNNFVTCKDASVSLK
                     DKLNLDTQSGGKTWHYYAQQLFGGRPDPNLLFSTLIGDSYSYFYGSSKSASQIIRQNV
                     TINALKEGITSYAARNGDSASLVNLATTSSMEKQRLAHVSIGHVAMRTLPMTQTILTG
                     IAIGIFPLLVLAAVFNKLTLSVLKGYVFALMWLQSWPMLYAILNSAMTFYAKQNGAPV
                     VLSEISQIQLKYSDLASTAGYLSMMIPPLSWMMVRGLGAGFSSVYSHFASSAISPTAS
                     AAGSVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMMYQTGSGATATQTRDGNMVMDA
                     SGAMSRLPVGINATRQIAAAQQEMAREASNRAESALHGFSSSIASAWNSLSQFGSNRG
                     SSDSVTGGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQATQELASRSTRTSAGMY
                     GDAHAEWGVKPKILGVGGGLGVRGGGRAGIDWEDNDAHTASSNTQSSHNARHDIDARA
                     TQDFKEASDYFTSRKVSESGSHTDNNADSRVDQLSAALNSAKQSYDQYTTNMTRSHEY
                     AEMASRTESMSGQMSEDLSQQFAQYVMKHAPQDAEAILTNTSSPEIAERRRAMAWSFV
                     QEQVQPGVDNAWRESRGDIGKGMESVPSGGGSQDIIADHQGHQAIIEQRTQDSNIRND
                     VKHQVDNMVTEYKGNIGDTQNSVRGEENIVRGQYSELQNHHKTEALSQNNKYNEEKSA
                     QERMPGADSPQELMKRAKEYQDKYKQ"
     gene            complement(16392..17765)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
     CDS             complement(16392..17765)
                     /locus_tag="UM146_RS24775"
                     /old_locus_tag="UM146_24091"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001572125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraH"
                     /protein_id="WP_000944329.1"
                     /db_xref="GI:446867073"
                     /translation="MLRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQ
                     PGVWQGQAAGYAYGGSLYARTQVKNIQLISMTLPDINAGCGGIDAYLGSFSFINGDQL
                     QRFVKQIMSNAAGYFFDLALQATVPEIKTAKDFLQKMASDINSMNLSSCQVAQGIVGG
                     LFPQTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSSSVRDKASDKDKERVLKNI
                     NIIWDSLSKNRMLDGNKELKEFIMTLTGTLIFGEDSEITPLPARTTDRDILRAIMEGG
                     TAKVYHCNDSDKCLKVVADANVTIARDKALKSQITKLLTIIQNKAVSDTPLDDREKGF
                     ISSTTVPVFKYLIDPQMLGVSSSVVYQLTDYIGYDIMLQYIQELLQQARAMIATGNYP
                     QTVLDSVLENLNQAQQQIAVFQGQVKVQQDALLVVDRQMSYMRQQLSARMLSRYQNNY
                     HFGGSTL"
     gene            complement(17752..18471)
                     /locus_tag="UM146_RS27540"
                     /old_locus_tag="UM146_24096"
     CDS             complement(17752..18471)
                     /locus_tag="UM146_RS27540"
                     /old_locus_tag="UM146_24096"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001244886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbJ"
                     /protein_id="WP_077260827.1"
                     /db_xref="GI:1148473006"
                     /translation="MPPVLWRGWIPFCRCTERKKVRNKQVVLLIAGISGIATGIIVSL
                     NIPFIRQGLFYPASPVEIVVSLCLTFSVSVVFFVGAIVGWISVSEIYYSRMNGLNESS
                     EISEETYNERKRNDAELKNRKTKRDYDYERRVSDIYFDLFFVFVAAGTFLWVIMHSIF
                     DACIDSWKADPELNNFRYMWNILMYVIPYTLWAFAGGFLIVYVRNPLNELINGGIRIF
                     RLKRRMRRENKLREGGNNASH"
     gene            complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
     CDS             complement(18401..18946)
                     /locus_tag="UM146_RS24790"
                     /old_locus_tag="UM146_24101"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000052622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="WP_000059830.1"
                     /db_xref="GI:445981975"
                     /translation="MSLTKLLPVILLMMATGVQASTRDEIERLWNPQGMAVQPAQPAA
                     DTSARTEKPAPRWFRLSNGRQVNLADWKVVLFMQGHCPYCHQFDPVLKQLAQQYGFSV
                     FPYTLDGQGDTAFPEALPVPPDVMQTFFPNIPVATPTTFLVNVNTLEALPLLQGATDA
                     ASFMARMDTVLQMYGEEKGAK"
     gene            complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
     CDS             complement(18933..19217)
                     /locus_tag="UM146_RS24795"
                     /old_locus_tag="UM146_24106"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001617873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type-F conjugative transfer system pilin
                     chaperone TraQ"
                     /protein_id="WP_000624160.1"
                     /db_xref="GI:446546814"
                     /translation="MISKXRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLA
                     ELIAAILVLFGAYQVLDAWIARVSLEEREALEARQQAMMEGQQEGGHVSH"
     gene            19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
     CDS             19298..19633
                     /locus_tag="UM146_RS24800"
                     /old_locus_tag="UM146_24111"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000736414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000736414.1"
                     /db_xref="GI:446659068"
                     /translation="MKKLSFKEKLEIVRNIIRESLSGNAAFALLVYSLLHSLPIKTFA
                     DLFVTILLFIAIIAVVIWLFLIIYVYFCELFRSHWIAVWFILWSVVINLTIGFGIYDK
                     LAPVISLMK"
     gene            complement(19614..19955)
                     /locus_tag="UM146_RS27545"
                     /old_locus_tag="UM146_24116"
     CDS             complement(19614..19955)
                     /locus_tag="UM146_RS27545"
                     /old_locus_tag="UM146_24116"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001530454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbA"
                     /protein_id="WP_001298557.1"
                     /db_xref="GI:485653426"
                     /translation="MHTGDLCFFTGASLFIVGVVGYFFTGPNNKGVYLLSSFIFFVVN
                     VISVCMLPDNFLFLCGAVMNQCAVPVVSMAVSTIPVITKFDSFRRMFVCIMLSAIWSG
                     VMWFFIISLVK"
     gene            complement(19969..20712)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
     CDS             complement(19969..20712)
                     /locus_tag="UM146_RS24805"
                     /old_locus_tag="UM146_24121"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001030376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraF"
                     /protein_id="WP_001030404.1"
                     /db_xref="GI:446953148"
                     /translation="MNKALLPLLLCCFIFPASGKDAGWQWYNEKIXPKEKENKPVPAA
                     PRQEPDIMQKLAALQTATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKA
                     MLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKLAEHYGIMFFYRGQDPIDGQL
                     AQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMMLVDPKQGS
                     VRPLSYGFISQDDLAKQFLNVSEDFKPNF"
     gene            complement(20705..20962)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
     CDS             complement(20705..20962)
                     /locus_tag="UM146_RS24810"
                     /old_locus_tag="UM146_24126"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000864329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbE"
                     /protein_id="WP_000864334.1"
                     /db_xref="GI:446787078"
                     /translation="MKVIFTSNRFIDFLIRLLITAXVISPVIIWSWDTVKETTADGXL
                     AAAFVILYSGVLLFILYFCFSALTDLQKTDERKXDERNEDE"
     gene            complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
     CDS             complement(20989..22839)
                     /locus_tag="UM146_RS24815"
                     /old_locus_tag="UM146_24131"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001403430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraN"
                     /protein_id="WP_000821853.1"
                     /db_xref="GI:446744597"
                     /translation="MKRILPLILALVAGMAQADSNSDYRAGSDFARQIQGQGTGSIQG
                     FKPQESIPGYNANPDETKYYGGVTAGGDGGLKNDGTTEWATGETGKTITESFMNKPKD
                     ILSPDAPFIQTGRDVVNRADSIVGNTGQQCSAQQINRSEFTNYTCERDTMVEEYCTRT
                     ASITGDWKYTDEYREVTIPHSQFRFSMNGLKLVFSVTAPVTGTVESASLSVYAAFFFL
                     NSRYTFMNTTFNVGLANGQSDTYPLSGATGLQVTQGQVLTGSGCTANGNCLPHGNGDR
                     KVYESLVSGASTFTLKLRMKVRDKEWVPRVEWVESCPFNKADGVLTGTECSEPGGTKT
                     GVMEGKPWNITQACWAYRDKYVTQSADNGTCQKYVDNPACTLASRQCAFYSDEGTCLH
                     EYATYSCESKTSGKVMVCGGDVFCLDGECDKAQSGQSNDFAEAVSQLAALAAAGKDVA
                     ALNGVDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKALAKAKSNKLT
                     VSVGEFCSKKVLGVCLQKKRSYCQFDSKLAQIVQQQGRNGQLRIGFGSAKHPDCRGIT
                     VDELQKIQFDRLDFTNFYEDLMNNQKIPDSGVLTQKVKEQIADQLKQAGQ"
     gene            complement(22836..23474)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
     CDS             complement(22836..23474)
                     /locus_tag="UM146_RS24820"
                     /old_locus_tag="UM146_24136"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001733892.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbC"
                     /protein_id="WP_001080252.1"
                     /db_xref="GI:447002996"
                     /translation="MNRKIFALFALTAGMHLAVHASENVNTPENRQFLKQQENLSRQL
                     REKPDHQLKAWAEKQVLENPLQRSDNHFLDELVRKQQASQDGKPRQGALYFVSFSIPE
                     EGLKRMLXETRHYGIPATLRGMVNNDLKTTAEAVLSLVKDGATDGVQIDPTLFSQYGI
                     RSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDSGK"
     gene            complement(23483..23788)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
     CDS             complement(23483..23788)
                     /locus_tag="UM146_RS24825"
                     /old_locus_tag="UM146_24141"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001505125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000224418.1"
                     /db_xref="GI:446146563"
                     /translation="MATMDSKYIQHLRKISAVLLRLISRTLKLFPFGLVMVPVILFYF
                     APDSFLAEIIHEWKKADISEQVTLVRLYLKVTFTCAFMAVFLNYLFSDEFMPVNSRK"
     gene            complement(23818..24811)
                     /locus_tag="UM146_RS24830"
                     /pseudo
     CDS             complement(23818..24811)
                     /locus_tag="UM146_RS24830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004150659.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraU"
     gene            complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
     CDS             complement(24808..25440)
                     /locus_tag="UM146_RS24835"
                     /old_locus_tag="UM146_24156"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001203750.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus assembly protein TraW"
                     /protein_id="WP_014639537.1"
                     /db_xref="GI:504452435"
                     /translation="MRCRGLIALLIWGQSVXAADLGTWGDLWPVKEPDMLTVIMQRLT
                     ALEQSGEMGRKMDAFKERVIRNSLRPPAVPGIGRTEKYXSRLFDPSVRLAADIRDNEG
                     RVFARQGEVMNPLQYVPFNQXLYFINGDDPAQVAWMKRQTPPTLESKIILVQGSIPEM
                     QKSLDSRVYFDQNGVLCQRLGIDQVPARVSAVPGDRFLKVEFIPAEEGRK"
     gene            complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
     CDS             complement(25437..25823)
                     /locus_tag="UM146_RS24840"
                     /old_locus_tag="UM146_24161"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000214080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbI"
                     /protein_id="WP_000214087.1"
                     /db_xref="GI:446136232"
                     /translation="MTTTQKTTDVTAPRRSHWWWTVPGCLAMVLLNAAXSYGIVRLNA
                     PVTAAFNMKQTVDAFFDSASQKQLSEAQSKALSARFNTALEASLQAWQQKHHAVILVS
                     PAVVQGAPDITREIQQDIARRMRAEP"
     gene            complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
     CDS             complement(25820..28450)
                     /locus_tag="UM146_RS24845"
                     /old_locus_tag="UM146_24166"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000069745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein TraC"
                     /protein_id="WP_000069779.1"
                     /db_xref="GI:445991924"
                     /translation="MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRL
                     LPYRDYNQESGLFMNDTTMGFMLEAIPINGANKSIVEALDHMLRTKLPRGIPLCIHLM
                     SSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAATQFPLPEGMNLPLTLRHYR
                     VFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIVGEMINHNP
                     DSLYPKRRQLDPYSDLNYQCVEDSFDLXVRADYLTLGLRENGRNSTARILNFHLARNP
                     EIAFLWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTS
                     YAKWFPSVEKEAKEWGELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSF
                     RKNGFELISPRFNHMRNFLTCLPFMAGKGLFKQLKEAGVVQRAESFNVANLMPLVADN
                     PLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGAGKTGLIQPLIRSVLDSG
                     GFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSVMASPN
                     GNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMI
                     VLLDQYTANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENR
                     MYRTPRTLKKLNVIDEGWRLLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDS
                     DKASSAARAAWGNSSYKIILKQSAKEFAKYNQLFPDQFQPLQRDMIGKFGAAKDQWFS
                     SFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRXEGXSIHEAVWQLAWKKSG
                     PEMASLEAWLEEHEKYRSVA"
     gene            complement(28576..28791)
                     /locus_tag="UM146_RS27550"
                     /pseudo
     CDS             complement(28576..28791)
                     /locus_tag="UM146_RS27550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000836674.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(28819..29037)
                     /locus_tag="UM146_RS27555"
                     /old_locus_tag="UM146_24176"
     CDS             complement(28819..29037)
                     /locus_tag="UM146_RS27555"
                     /old_locus_tag="UM146_24176"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000556745.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000556746.1"
                     /db_xref="GI:446478892"
                     /translation="MHTFIFLVLIKNINGGGSWNITPMPNTDVCVQVLRTIESHGGRG
                     FGNTGECIEVKTNKPLNNVMDTLNGGGQ"
     gene            complement(29117..29590)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
     CDS             complement(29117..29590)
                     /locus_tag="UM146_RS24850"
                     /old_locus_tag="UM146_24181"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000549572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000549566.1"
                     /db_xref="GI:446471712"
                     /translation="MHKSEAEKIDSILDEHQQIYRRHNQINNILAYCACIAWIPCIIA
                     AFGVDGIYLKILFAVLACCGAVCFFIFFFTLLPESLMVLSRQSLLQLMRLTEDVPDAR
                     QELLNRLLSGKKLTGRDEQDIRRLWQEKVDAMQESATRQREQDTIRKFTEGNKSE"
     gene            complement(29583..29804)
                     /locus_tag="UM146_RS27560"
                     /old_locus_tag="UM146_24186"
     CDS             complement(29583..29804)
                     /locus_tag="UM146_RS27560"
                     /old_locus_tag="UM146_24186"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001278680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraR"
                     /protein_id="WP_001278694.1"
                     /db_xref="GI:447201438"
                     /translation="MSDEADEAYSVTEQLTMTGINRIRQKINVHGIPVYLCEACGNPI
                     PEARRKIFPGVTLCVECQAYQEKQRKHYA"
     gene            complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
     CDS             complement(29939..30454)
                     /locus_tag="UM146_RS24860"
                     /old_locus_tag="UM146_24191"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016233168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraV"
                     /protein_id="WP_000809889.1"
                     /db_xref="GI:446732633"
                     /translation="MKQISLFIPLLGTLLLSGCAGTSTEFECNATTSDTCMTMEQANE
                     KAKKLEQPADAKPAAASLPRLAEGNFRTTTVRAVTAASPSGSGPVVTALPEQKLLAPR
                     PLFTAAREVKTIIPVSSVASVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVI
                     KPSAWGKPRIN"
     gene            complement(30451..30703)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
                     /pseudo
     CDS             complement(30451..30703)
                     /locus_tag="UM146_RS24865"
                     /old_locus_tag="UM146_24196"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001038337.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbG"
     gene            complement(30696..31049)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
     CDS             complement(30696..31049)
                     /locus_tag="UM146_RS24870"
                     /old_locus_tag="UM146_24201"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001377845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbD"
                     /protein_id="WP_071586423.1"
                     /db_xref="GI:1102615323"
                     /translation="MTEQTETTEIKMNMRNINAITALSVPGKTMSDDFMHAVLSNCTT
                     RIVLPAPKEFSSESLPHNFNMAAVGVMKEGMSMRLFSSPGHIVVAGQFGGGKSASVKE
                     LIDRIIQKYKEPFDE"
     gene            complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
     CDS             complement(31003..31593)
                     /locus_tag="UM146_RS24875"
                     /old_locus_tag="UM146_24206"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001528624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraP"
                     /protein_id="WP_000002787.1"
                     /db_xref="GI:445924932"
                     /translation="MANNMSSRQACHAARYVVARVLRGLFWCLKYTVILPLATMALMA
                     LFVLWKDNTTPGKLLVKEINFVRQTAPAGQFPVSECWFSSSDSSGRSEIQDICHYRAA
                     DAADYVRETDRSLMQLVTALWATLALMYVSLAAITGKYPVRPGKMKCIRVVTADEHLK
                     EVYTEDASLPGKIRKCPVYLPDDRTNRNNGDKNEHA"
     gene            complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
     CDS             complement(31583..33010)
                     /locus_tag="UM146_RS24880"
                     /old_locus_tag="UM146_24211"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001553749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraB"
                     /protein_id="WP_000146665.1"
                     /db_xref="GI:446068810"
                     /translation="MASINTIVKRKQYLWLGIVVVGAASAIGGVLYLSDVDMSGNGEA
                     VAEQEPVPDMTGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRGDD
                     QRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPASPPGPEGEPQPGNTPVSFPP
                     QGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGTSLPYIPSGS
                     FAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSS
                     ERAIVRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDG
                     IGQGMERASQPAVGLGATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIP
                     IGAGNEVTVVFQDGFQLKTVEEMALERTQNRAEEDNPESPVPVPPSAESHLNGFNTDQ
                     MLKQLGNLNPQQFMSGSQGGGNDGK"
     gene            complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
     CDS             complement(33010..33681)
                     /locus_tag="UM146_RS24885"
                     /old_locus_tag="UM146_24216"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001425793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraK"
                     /protein_id="WP_001340581.1"
                     /db_xref="GI:485707951"
                     /translation="MAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNS
                     LDGALTNNEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDL
                     RGTGEEAGAWETSTPYESLLVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADA
                     VWTGNHLKMVRFAVENKTLSALNIRESDFWQPGTRAVMFSQPASQLLAGARMDVYVIR
                     DGEGN"
     gene            complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
     CDS             complement(33724..34290)
                     /locus_tag="UM146_RS24890"
                     /old_locus_tag="UM146_24221"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraE"
                     /protein_id="WP_000399783.1"
                     /db_xref="GI:446321928"
                     /translation="MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNE
                     QRTAVTPMXFNXPFAVSQNSADASYLQQMALSFIALRLNVSSETVDASHQALLQYIRP
                     GAQNQMKVILAEEAKRIKNDNVNSAFFQTSVRVWPQYGRVEIRGVLKTWIGDSKPFTD
                     IKHYILILKRENGVTWLDNFGETDDEKK"
     gene            complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
     CDS             complement(34312..34623)
                     /locus_tag="UM146_RS24895"
                     /old_locus_tag="UM146_24226"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraL"
                     /protein_id="WP_000012100.1"
                     /db_xref="GI:445934245"
                     /translation="MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIIT
                     SKYLFGIGAAVLVYFGIKKLKKGRGSSWLRDLIYWYMPTALLRGIFHNVPDSCFRQWI
                     K"
     gene            complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
     CDS             complement(34638..34997)
                     /locus_tag="UM146_RS24900"
                     /old_locus_tag="UM146_24231"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001673167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraA"
                     /protein_id="WP_001098988.1"
                     /db_xref="GI:447021732"
                     /translation="MNTVLSVQGASAPVEKKSFFSKFTCLNMLRLVRAVIPVAVLMML
                     FPELAMAAGKGDLMAKGQETVKATFGKNSSIVKWIVLAEVLVGAVMYMMTKNIKFLVG
                     FAILSVFIAVGMSVAGF"
     gene            complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
     CDS             complement(35031..35258)
                     /locus_tag="UM146_RS24905"
                     /old_locus_tag="UM146_24236"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001676655.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="relaxosome protein TraY"
                     /protein_id="WP_001254388.1"
                     /db_xref="GI:447177132"
                     /translation="MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIR
                     LRDHLKRFPDFYNEEIFREVIEENESTFKEL"
     gene            complement(35352..36038)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
     CDS             complement(35352..36038)
                     /locus_tag="UM146_RS24910"
                     /old_locus_tag="UM146_24241"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001496379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein TraJ"
                     /protein_id="WP_000332487.1"
                     /db_xref="GI:446254632"
                     /translation="MCALDRRERPLNSQSVNKYILNVQNIYRNSPVPVCVRNKNRKIL
                     YANGAFIELFSREDKPLSGESYIRLQVEIFLSSLELECQALGHGSAFCRRFNFHGEIY
                     QIRMENVSFYNDESVVLWQINPFPDYPFFALNQSGSNTNTSDKLTIWNDLSPGTLVVF
                     SFYMLGVGHATIARELGITDRASEDRIKPVKRKIKEFFEHFDLFRVSCIYKGEIDSLL
                     SIIREFYGVK"
     gene            complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
     CDS             complement(36232..36615)
                     /locus_tag="UM146_RS24915"
                     /old_locus_tag="UM146_24246"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraM"
                     /protein_id="WP_001151562.1"
                     /db_xref="GI:447074306"
                     /translation="MAKVQAYVSDEIVYKINKIVERRRAEGAKSTDVSFSSISTMLLE
                     LGLRVHEAQMERKESAFNQAEFNKVLLECAVKTQSTVAKILGIESLSPHVSGNPKFEY
                     ANMVEDIRDKVSSEMERFFPENDEE"
     gene            complement(36918..37097)
                     /locus_tag="UM146_RS27565"
     CDS             complement(36918..37097)
                     /locus_tag="UM146_RS27565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004150673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004150673.1"
                     /db_xref="GI:490252646"
                     /translation="MAWQISFINIRQMANIHFFIFPPLVTLSVNNLTHSTKRLNRLVV
                     LTTKSTTHYAKTSFC"
     gene            37039..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
     CDS             37039..37548
                     /locus_tag="UM146_RS24920"
                     /old_locus_tag="UM146_24251"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lytic transglycosylase"
                     /protein_id="WP_000759167.1"
                     /db_xref="GI:446681821"
                     /translation="MKKWMLAICLMFINEICQATDCFDLAGRDYKIDPDLLRAISWKE
                     SRYRVNAIGINPVTGYGSGLMQVDSQHFNELDRYGIKPEHLTTDPCMNIYTGAYYLAI
                     AFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYRIYTGIKSSKGIRIPVTKKSL
                     PEINSVQNN"
     gene            complement(37845..38666)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
     CDS             complement(37845..38666)
                     /locus_tag="UM146_RS24925"
                     /old_locus_tag="UM146_24256"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001234492.1"
                     /db_xref="GI:447157236"
                     /translation="MRLASRFGRYNSIRRERPLTDDELMQFVPSVFSGDKHESRSERY
                     TYIPTINIINKLRDEGFQPFFACQSRVRDLGRREYSKHMLRLRREGNINGQEVPEIIL
                     LNSHDGSSSYQMIPGIFRFVCTNGLVCGNNFGEIRVPHKGDIVGQVIEGAYEVLGVFD
                     KVTXNMEXMKEIHLNSDEQHLFGRAALMXRYEDENKTPVTPEQIITPRRREDKQNDLW
                     TTCQRVQENMIKGGLSGRSASGKNTRTRAITGIDGDIRINKALWVIAEQFRKWKS"
     gene            complement(38785..39072)
                     /locus_tag="UM146_RS24930"
     CDS             complement(38785..39072)
                     /locus_tag="UM146_RS24930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162292.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000107526.1"
                     /db_xref="GI:446029671"
                     /translation="MSTRNIHVNTASYTILVAGREKNTGEEWDVLEFSSLTELKKYRK
                     SHPEKMAFSYSYALSRGVDTQFRHINIAEADHFKQFLRQIKRAGLDIRAIC"
     gene            complement(39097..39302)
                     /locus_tag="UM146_RS27570"
                     /pseudo
     CDS             complement(39097..39302)
                     /locus_tag="UM146_RS27570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162293.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
     gene            complement(39299..39493)
                     /locus_tag="UM146_RS24940"
     CDS             complement(39299..39493)
                     /locus_tag="UM146_RS24940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001500139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032140920.1"
                     /db_xref="GI:692947029"
                     /translation="MACAPGIPAKGRRDVRRNAVSQTVLHVVAAGPCPLLCPVPFTCL
                     SPCRRGLIQPQPAALTVQGK"
     gene            39416..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
     CDS             39416..39751
                     /locus_tag="UM146_RS24945"
                     /old_locus_tag="UM146_24261"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012896899.1"
                     /db_xref="GI:502660848"
                     /translation="MKHGLRNGVAPYIPAAFCRDARSAGHGATEAARPERSLQARGFA
                     SGMEARQGGDSFAGSVHDSPPRQGDARKRHKQENNKTDNNQGSSNQSQSSNQSQSRRK
                     KRIIKGKVM"
     gene            complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
     CDS             complement(39988..40146)
                     /locus_tag="UM146_RS24950"
                     /old_locus_tag="UM146_24266"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="stable plasmid inheritance protein"
                     /protein_id="WP_001302184.1"
                     /db_xref="GI:485658258"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
                     FMAYESGK"
     gene            40224..>40397
                     /locus_tag="UM146_RS24955"
                     /pseudo
     CDS             40224..>40397
                     /locus_tag="UM146_RS24955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001695169.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="protein sok"
     gene            complement(40378..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
                     /pseudo
     CDS             complement(40378..41141)
                     /locus_tag="UM146_RS24960"
                     /old_locus_tag="UM146_24276"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052659.1"
                     /note="PsiA; frameshifted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
     gene            complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
     CDS             complement(41138..41572)
                     /gene="psiB"
                     /locus_tag="UM146_RS24965"
                     /old_locus_tag="UM146_24281"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_000845910.1"
                     /db_xref="GI:446768654"
                     /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDERRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     gene            complement(41627..43585)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
     CDS             complement(41627..43585)
                     /locus_tag="UM146_RS24970"
                     /old_locus_tag="UM146_24286"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001145500.1"
                     /db_xref="GI:447068244"
                     /translation="MPVTKCEPETTRKASRKYAKTQETVLSALLAQTEEVSVPLASLI
                     KSPLNVRTVPYSAESVSELAESIKGVGLLQNLVVHTLPGDRYGVAAGGRRLAALNMLA
                     ERGIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
                     DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQ
                     SGWGGKPDVRVIRNLITESEVAVAGNSKFRFVGADAFSPDELRTDLFSDDEGGYVDCV
                     ALDAALLEKLQAVAEFLREAEGWEWCAGRMEPVGECREDAGTYRCLPEPEAVLTEAEE
                     ERLNELMARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGGGVVVSWCYGNV
                     CVQRGVQLRSEDDAADDADRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQPD
                     KSLTLLAWTLCLNVFGSGAYSKPAQISLECKHYSLTSDAPSGKEGAAFMALMAEKARL
                     AALLPEGWSRDMTTFLSLSQEVLLSLLSFCTACSLNGVQTREYGHTSRSPLDTLESAI
                     GFHMRDWWQPTKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKD
                     NRWVPGWMCAPRPQTDATERTDNLADAA"
     gene            complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
     CDS             complement(43644..43877)
                     /locus_tag="UM146_RS24975"
                     /old_locus_tag="UM146_24291"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000006018.1"
                     /db_xref="GI:445928163"
                     /translation="MSEYFRILQGLPDGSFTREQAEAVAAQYRNVFIEDDQGTHFRLV
                     VRNNSGLVWRTWNFEDGAGYWMNHVIRNFGILK"
     gene            complement(43934..44461)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
     CDS             complement(43934..44461)
                     /locus_tag="UM146_RS24980"
                     /old_locus_tag="UM146_24296"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_000290833.1"
                     /db_xref="GI:446212978"
                     /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSETWRDK
                     QTGEMKEQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTMQMLGSAPQQNAQVQPQPQQNGQPQSADATKKGSAKTKGRGRKAAQPEPQPQ
                     PPEGEDYWFSDDIPF"
     gene            complement(44487..44627)
                     /locus_tag="UM146_RS27575"
     CDS             complement(44487..44627)
                     /locus_tag="UM146_RS27575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001487054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001445060.1"
                     /db_xref="GI:485831554"
                     /translation="MRQAVAVMPLAAKVLKQVMVNTGGNKRQVPAKRQNRGSRNSTDD
                     GG"
     gene            44526..44754
                     /locus_tag="UM146_RS27580"
                     /pseudo
     CDS             44526..44754
                     /locus_tag="UM146_RS27580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001444076.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(44693..44955)
                     /locus_tag="UM146_RS27585"
                     /pseudo
     CDS             complement(44693..44955)
                     /locus_tag="UM146_RS27585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001438627.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(44952..45176)
                     /locus_tag="UM146_RS27590"
     CDS             complement(44952..45176)
                     /locus_tag="UM146_RS27590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001316556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_074405460.1"
                     /db_xref="GI:1123875595"
                     /translation="MSFQTCHLSVTDDVVVPATATATATATVLLFSTALITVCFVVLL
                     LMPFPGVPLAGRAVVNGASGAVSALAGFHP"
     gene            complement(45071..45307)
                     /locus_tag="UM146_RS27595"
     CDS             complement(45071..45307)
                     /locus_tag="UM146_RS27595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001580312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_077260828.1"
                     /db_xref="GI:1148473007"
                     /translation="MTQGWREDKCPSXRAGKXPRVGGAERGRAHAPPLSLRGRSDGGF
                     CLFRPVICLLLMMLLFLLLLLLLLLLLFFFFLLL"
     gene            complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
     CDS             complement(45307..45870)
                     /locus_tag="UM146_RS24990"
                     /old_locus_tag="UM146_24306"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052654.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_001298559.1"
                     /db_xref="GI:485653429"
                     /translation="MHSQLRERIRLMRARLDNAAPVAEIRAESQLFVSPAPICDRLVT
                     LAEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCG
                     DFMEWQSVQYYSRIIMNPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLP
                     FSDVREELPRGTFAYTDVPTMIIRLRA"
     gene            complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
     CDS             complement(45917..47278)
                     /locus_tag="UM146_RS24995"
                     /old_locus_tag="UM146_24311"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_000170697.1"
                     /db_xref="GI:446092842"
                     /translation="MTLAAITMTAPEAASPVQMYRATYSPDDNKLRLYAASRLDPETY
                     KKVHDAGFRWAPXQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGY
                     SGKRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFER
                     AEYWEERARSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLD
                     LNMAKLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRC
                     HERQIQHQQRWVNHYQNRLIYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVN
                     KSNGAVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPG
                     EGFREMTKAQWAALPRDCKAVRSVEEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEI
                     PQK"
     gene            complement(47330..47560)
                     /locus_tag="UM146_RS25000"
     CDS             complement(47330..47560)
                     /locus_tag="UM146_RS25000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000155844.1"
                     /db_xref="GI:446077989"
                     /translation="MTISIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIAR
                     SFHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
     gene            complement(47780..47899)
                     /locus_tag="UM146_RS27600"
     CDS             complement(47780..47899)
                     /locus_tag="UM146_RS27600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001332787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032292014.1"
                     /db_xref="GI:693155544"
                     /translation="MPLAAKVLKRVKFIPQGIQQQVPAKRQNRGSQNSTGDVL"
     gene            complement(47981..48231)
                     /locus_tag="UM146_RS27605"
                     /pseudo
     CDS             complement(47981..48231)
                     /locus_tag="UM146_RS27605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001365574.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(<48373..48604)
                     /locus_tag="UM146_RS27610"
                     /pseudo
     CDS             complement(<48373..48604)
                     /locus_tag="UM146_RS27610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001418877.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
     CDS             complement(48522..48713)
                     /locus_tag="UM146_RS25005"
                     /old_locus_tag="UM146_24321"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781773.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001027516.1"
                     /db_xref="GI:446950260"
                     /translation="MNISTETREILRNYRAVINARRREMGQKPLTTAQIVDEICDFVA
                     NQQAVFLGGHYILQGSRNR"
     gene            complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
     CDS             complement(48710..49132)
                     /locus_tag="UM146_RS25010"
                     /old_locus_tag="UM146_24326"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000271708.1"
                     /db_xref="GI:446193853"
                     /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWSLTD
                     DELETVMQRLDDAFVYGACDRVVSDIVNELMEEKRASRHVTVPAVMLEKVMALAGSEM
                     KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     gene            complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
     CDS             complement(49179..49604)
                     /locus_tag="UM146_RS25015"
                     /old_locus_tag="UM146_24331"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein YubI"
                     /protein_id="WP_001198903.1"
                     /db_xref="GI:447121647"
                     /translation="MQYAKPVTLNVEECDRLSFLPYLFGLDFLYAEASVYTLAKKMMP
                     EYEGGFWHFIRLPDGGGYMMPDGDRFHLVNGENWFDRTVSADAAGIILTSLVINRQLW
                     LYHDSGDAGLTHLYRMRDAQLWSHIEFHPECNAIYAALD"
     gene            complement(49577..50147)
                     /locus_tag="UM146_RS27615"
                     /pseudo
     CDS             complement(49577..50147)
                     /locus_tag="UM146_RS27615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052648.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(<50466..50790)
                     /locus_tag="UM146_RS27620"
                     /pseudo
     CDS             complement(<50466..50790)
                     /locus_tag="UM146_RS27620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001428429.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
     CDS             complement(50835..51269)
                     /locus_tag="UM146_RS25025"
                     /old_locus_tag="UM146_24346"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781769.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000274516.1"
                     /db_xref="GI:446196661"
                     /translation="MYGTCETLCRXLAAKYXGDTPLMLVIWSPEEIQALXDGMDIXLX
                     DHEIRTVLARLEDIPEDQRTESGISSGXAMEIINNVXENRQVTVPAELLASLIQTAEQ
                     ALWKREWAAXDHGLAVPECVTRRQAVVNQVRILLKNNTHEND"
     gene            complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
     CDS             complement(51283..51504)
                     /locus_tag="UM146_RS25030"
                     /old_locus_tag="UM146_24351"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_958723.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001104873.1"
                     /db_xref="GI:447027617"
                     /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
                     LTRQTLYRANRLFMEAYTEILELDSCFKD"
     gene            complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
     CDS             complement(51505..52188)
                     /locus_tag="UM146_RS25035"
                     /old_locus_tag="UM146_24356"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_000086169.1"
                     /db_xref="GI:446008314"
                     /translation="MSRFVLGNCIDVMARIPDNAIDFILTDPPYLVGFRDRSGRTIAG
                     DVNDDWLQPASNEMYRVLKKDALMVSFYGWNRVDRFMAAWKRAGFSVAGHLVFTKNYT
                     SKSAYVAYRHECAYILAKGSPARPRNPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DNWFEPEAA"
     gene            complement(52264..52575)
                     /locus_tag="UM146_RS25040"
     CDS             complement(52264..52575)
                     /locus_tag="UM146_RS25040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858330.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310011.1"
                     /db_xref="GI:485668905"
                     /translation="MKYDGDGRATARFFSGKGCRRAPLFTAPADAARHKRCLWSVSRV
                     RWARDGRFYRSRLASVTVYASLSPFSDERPSSRFRGIALPSERRRLRYSTVGLTRYRT
                     R"
     gene            complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
     CDS             complement(52572..52775)
                     /locus_tag="UM146_RS25045"
                     /old_locus_tag="UM146_24361"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001298677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001298677.1"
                     /db_xref="GI:485653556"
                     /translation="MLGGADNPNGELPSYITGADSWQLYERGELVDVLWGELEWSSPT
                     DDDELPEVTGPAWIVDNVAHYGG"
     gene            52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
     CDS             52816..53988
                     /locus_tag="UM146_RS25050"
                     /old_locus_tag="UM146_24366"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005147430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_000952372.1"
                     /db_xref="GI:446875116"
                     /translation="MLSREDFYMIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVIFAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVEVEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGCVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLADHYNFLPRAC
                     RPRRARTKGKVERMVKYLKENFFVRYRRFDSFTHVNQQLEQWIADVADKRELRQFKET
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSRDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRIYSNEKLVASHRLCSASSGWQTVPEHHAPLWQQVSQVEHRPLSAYEELL"
     gene            53985..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
     CDS             53985..54785
                     /locus_tag="UM146_RS25055"
                     /old_locus_tag="UM146_24371"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002409325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_012602155.1"
                     /db_xref="GI:501616532"
                     /translation="MMHELEVLLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQ
                     QEWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERSENVI
                     LLGPPGVGKTHLAIALGVKAVDAGHRVLFMPLDRLIATLMKAKQENRLERQLQQLSYA
                     RVLILDEIGYLPMNREEASLFFRLLNRRYEKASIILTSNKGFADWGEMFGDHVLATAI
                     LDRLLHHSTTLNIKGESYRLKEKRKAGVLTKNTTPISDDEMVKSGQHQ"
     gene            complement(54779..55633)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
     CDS             complement(54779..55633)
                     /locus_tag="UM146_RS25060"
                     /old_locus_tag="UM146_24376"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001134351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001134351.1"
                     /db_xref="GI:447057095"
                     /translation="MPNWCSNRMYFSGEPAKIAEIKRLASGAVTPFYRRATNEGIQLF
                     LAGSAGLLQTTEDVRFEPCPGLTAAGRGVLSPENITFTRWLKHLQDGVLLDEQNCLML
                     HELWLQSGTGQRRWEGLPDDVRETITVHFTAKRGDWCDIWGNEDVSVWWNRLCDNVLS
                     EKTMPFDLLTVLPTRLDIEVNGFNGGVLNGVPSAYHWYTERYGVKWPCGYDLNISSQG
                     ENFIQVDFDTPWCQPESDVVAELSRRFGCTLEHWYAEQGCNFCGCVNATMFDRYLPFS
                     CPLRYFRY"
     gene            complement(55647..55916)
                     /locus_tag="UM146_RS27625"
                     /old_locus_tag="UM146_24381"
     CDS             complement(55647..55916)
                     /locus_tag="UM146_RS27625"
                     /old_locus_tag="UM146_24381"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310013.1"
                     /db_xref="GI:485668907"
                     /translation="MWLYACCGLLCPAYPQHFVHGSVDKILGYPGRAGTLIGLHPMQV
                     CRCRRPPHPVTFRRSSSTRCGFGAAPAFVCGRPVTGAARPDGGRM"
     gene            complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
     CDS             complement(56028..57248)
                     /locus_tag="UM146_RS25065"
                     /old_locus_tag="UM146_24386"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002407867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ISL3 family transposase"
                     /protein_id="WP_000343766.1"
                     /db_xref="GI:446265911"
                     /translation="MDEKSLYAHILNLTAPWQVKSLTLDENAGSVTVTVGIAENTQLT
                     CPTCRKSCSVHDHRHRKWRHLDTCQFMTLVEADVPRVMCPEHGCQTLPVPWAGSGSRY
                     TLLFESFVLSWLKISTVDAVRKQLKLSWNAVDGIMTRAVKRGLSRIKKPLSVRHMNVD
                     EVAFKKGHRYITVVSDRDGRALALTDDRGTESLASYLRSLTDSQLLAIKTLSMDMNAG
                     YIRAARIHLPNAVEKIAFDRFHVAKQLGEVVDKTRQNEHPHLPVESRRQAKGTRFLWQ
                     YSDKWMTESRQEKLMWLREQMQQTSQCWTLKELAKNIWDRPWSTERRNDWLQWISRAS
                     ECDVPMMKNAAKTIKKRLYGILNAMRHRVSNGNAEALNSKIRLLRIKARGYRNRERFK
                     LGVMFHYGKLNMAY"
     gene            complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
     CDS             complement(57267..57785)
                     /locus_tag="UM146_RS25070"
                     /old_locus_tag="UM146_24391"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002407031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ClbS/DfsB family four-helix bundle protein"
                     /protein_id="WP_000115885.1"
                     /db_xref="GI:446038030"
                     /translation="MSVPQTKAELLLAIDKNFSKLISYLNTIPPEITSDKSMDGHAKG
                     TEMSVRDLVSYLLGWNALVVKWIASDAKGLPVDFPETGYKWNQLGLLAQKFYSDYSEL
                     SYELLVAELQTVKNEIVNLINDRTDDILYGRPWYTKWTMGRMISFNTSSPYANANGRL
                     RKWAKNNNISLK"
     gene            57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
     CDS             57920..58168
                     /locus_tag="UM146_RS25075"
                     /old_locus_tag="UM146_24396"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781765.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein impC"
                     /protein_id="WP_000619112.1"
                     /db_xref="GI:446541766"
                     /translation="MIRIEILFDRQSTKNLKSGTLQALQNEIEQRLKPHYPEIWLRID
                     QGSAPSVSVTGARNDKGKERIQSLLEEIWQDDSWLPAA"
     gene            58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
     CDS             58165..58602
                     /locus_tag="UM146_RS25080"
                     /old_locus_tag="UM146_24401"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006781764.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_000109079.1"
                     /db_xref="GI:446031224"
                     /translation="MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDL
                     NSYCISRPAATFFLRTSGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKR
                     LLLRPRPALEPVSDSPEFRTLYPENICIFGIVTHVIHRTRELR"
     gene            59005..59873
                     /locus_tag="UM146_RS25085"
                     /pseudo
     CDS             59005..59873
                     /locus_tag="UM146_RS25085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000538103.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase V"
     gene            complement(59878..60270)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
     CDS             complement(59878..60270)
                     /locus_tag="UM146_RS25090"
                     /old_locus_tag="UM146_24421"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001555635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000340835.1"
                     /db_xref="GI:446262980"
                     /translation="MDDERKRKKYTLYLHPEKAADFQTLEAIESVPRSERGELFRNAF
                     ISGMALHQLDPRLPVLLTAILSEEFSADQVVTLLSQTTGWKPSQADIRTVLTELGASQ
                     SVEKMPPSATDSVQEAMNDVRLKMKKLF"
     gene            complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
     CDS             complement(60275..61246)
                     /locus_tag="UM146_RS25095"
                     /old_locus_tag="UM146_24426"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001505082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001103694.1"
                     /db_xref="GI:447026438"
                     /translation="MNVYCDDGSTTIKLAWNDNGKICKSLSQNSFRHGWKVDGLGIRQ
                     TFNYELDGKKYTYDEVSNQSILTTHIEYQYTDVNLLAVHHALLNSGLAPQPVSLTVTL
                     PISEFYTKECQKNELNIQRKIENLMRPIRLNKGDVFTIEHVDVMPESLPAVFSRLVVD
                     KVGQFEKSLVVDIGGTTLDVGVIVGQFDSVSAIHGNSGIGVSSVTKAAMSALRMASSD
                     TSFLVADELIKRRNDPDFVRQVINDETKTDLVLNTIEGAIASLGEQVVNELGDFHHVN
                     RVYVVGGGAPLIYDSIKTAWHHLGQKVVMMESPQTALVEAIAAFKEE"
     gene            61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
     CDS             61475..62119
                     /locus_tag="UM146_RS25100"
                     /old_locus_tag="UM146_24431"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000633910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_000633911.1"
                     /db_xref="GI:446556565"
                     /translation="MITVVGGNKGGSGKTTIASNLAIALANKGREVCLLNGDLQRTAA
                     KHHAEREAAGLLPAITLVEKFDNLTQTLQALNEKFDDVIVDVAGRNSKEFITSGVVAH
                     QIIAPLQCSQPDLDTLTELEQQIDAMRNLNPELKVYCLQSMATTNPVLRGNERKEFLE
                     YLEEFPTIQVLDSVICFRKVYRDCMSNGTGVVETNNTAAKAEIEHLMNEVFGPW"
     gene            62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
     CDS             62113..62388
                     /locus_tag="UM146_RS25105"
                     /old_locus_tag="UM146_24436"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000241708.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000239529.1"
                     /db_xref="GI:446161674"
                     /translation="MVKKPSQQALNRAAVTVEQAEALAQRLADKPYGAPEKPEPEKQC
                     RTTISLGESMLVTIEDLALRNKRNGKDPKNVSAIVRVALEQYLKTLT"
     gene            complement(62526..63334)
                     /locus_tag="UM146_RS25110"
                     /pseudo
     CDS             complement(62526..63334)
                     /locus_tag="UM146_RS25110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016237314.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
     gene            complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
     CDS             complement(63335..63640)
                     /locus_tag="UM146_RS25115"
                     /old_locus_tag="UM146_24451"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052635.1"
                     /note="controlled cell death protein; post-segregation
                     toxin; toxin addiction system; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin CcdB"
                     /protein_id="WP_001159871.1"
                     /db_xref="GI:447082615"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     gene            complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
     CDS             complement(63642..63860)
                     /locus_tag="UM146_RS25120"
                     /old_locus_tag="UM146_24456"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin CcdA"
                     /protein_id="WP_000813634.1"
                     /db_xref="GI:446736378"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     KAENQEGMAEVARFIEMNGSFADENRDW"
     gene            64498..64725
                     /locus_tag="UM146_RS27630"
     CDS             64498..64725
                     /locus_tag="UM146_RS27630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001310015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001310015.1"
                     /db_xref="GI:485668910"
                     /translation="MADLNLIPENCQRCEDEESITAKAVIPPHPASSYVETYVGRAVP
                     TGQYRIDRPSGPLTSLYDKGGLANYCTVSLF"
     gene            complement(65965..66195)
                     /locus_tag="UM146_RS27635"
     CDS             complement(65965..66195)
                     /locus_tag="UM146_RS27635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_010892533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322637.1"
                     /db_xref="GI:485688517"
                     /translation="MSAFTFSPSRHDGPGTEVYGRPPGILSAQLSYPAGAPPAVFFPG
                     ADFPGTYSFRSYPQNLWITVAPLLREKALLTA"
     gene            66182..66823
                     /locus_tag="UM146_RS25125"
     CDS             66182..66823
                     /locus_tag="UM146_RS25125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000990667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000990667.1"
                     /db_xref="GI:446913411"
                     /translation="MNADTWTRLQAFRHALELTSCEASLTAGYDHLKDFPAGCSELAS
                     QTLTDYLTEDGSNLYSCIVGMQWDNGPGRYGHVIADPARDYIDLTLDQFPGYHNRIVA
                     EPVESGGQLAADLNREPAISTADGIVASPSDKVNYITEQKNRQPMVIITECYKLIRMT
                     ARFIPMCQSSQLFQHQVFPRLFIISDVGSCSLFRNTLDRLATDWKVTLSILSL"
     gene            66880..67086
                     /locus_tag="UM146_RS27640"
     CDS             66880..67086
                     /locus_tag="UM146_RS27640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322638.1"
                     /db_xref="GI:485688518"
                     /translation="MFEDPEIRIHKLQPCTLCPRLEDLRFSWYFHYIHDRCLRSSACH
                     QDPVTLSTDRLWHTVGLVRSRVNN"
     gene            67305..67687
                     /locus_tag="UM146_RS25130"
                     /pseudo
     CDS             67305..67687
                     /locus_tag="UM146_RS25130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001773859.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            67834..68004
                     /locus_tag="UM146_RS25135"
     CDS             67834..68004
                     /locus_tag="UM146_RS25135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322640.1"
                     /db_xref="GI:485688520"
                     /translation="MVSTPDSVVKYRLQVFLQSVDGVLTHDFLFILLLSTGRRLSGKR
                     KFRHQKTVRRGG"
     gene            67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
     CDS             67997..68974
                     /locus_tag="UM146_RS25140"
                     /old_locus_tag="UM146_24471"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepB family plasmid replication initiator
                     protein"
                     /protein_id="WP_001309253.1"
                     /db_xref="GI:485668084"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PISLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKFFCIHYRRPR
                     LKAPNDESKENQLPPSPAEKISPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
     CDS             complement(69217..69957)
                     /locus_tag="UM146_RS25145"
                     /old_locus_tag="UM146_24476"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006792584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_001066947.1"
                     /db_xref="GI:446989691"
                     /translation="MNNVIPLQNSPERVSLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGVRPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWPVTDETMRNWLKQAV
                     KRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLK"
     gene            complement(70078..70266)
                     /locus_tag="UM146_RS25150"
     CDS             complement(70078..70266)
                     /locus_tag="UM146_RS25150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001332784.1"
                     /db_xref="GI:485699419"
                     /translation="MASDTFSCRRRLSAGFFSVSACSWHYPNSPKNGKPALSPHHDWL
                     KTGSLRQNAPLRIWFYPQ"
     gene            70633..>70919
                     /locus_tag="UM146_RS27645"
                     /pseudo
     CDS             70633..>70919
                     /locus_tag="UM146_RS27645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001363099.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            70953..71801
                     /locus_tag="UM146_RS25155"
     CDS             70953..71801
                     /locus_tag="UM146_RS25155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016245172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_016245172.1"
                     /db_xref="GI:510924394"
                     /translation="MAFIYVLYCAFDFDQSVKDNSGWLSILSIGVLIVVISAIINTRY
                     LEYDLSFKNNRMKLLRRVQIYLIIPLSIALLVHLQVIPLEMVFRNIETSDKSINFKVI
                     AELAFMSYFIFILTILPGLIYLKMNPQHKLSKRISSAFVASLMILLVISTQITVLPVI
                     FTHSVIKLSGISDFKIHSYIIKTSEYPEEFFSNAVWGKKNIKPGEYYSVQAVSMFTTN
                     QFILLCPKDIIRFYRESWKFDLLNVDFDTNTRKKLQEEAAYCVPISAISVKRWDMPLQ
                     GSKPSN"
     gene            complement(<72027..>72202)
                     /locus_tag="UM146_RS27650"
                     /pseudo
     CDS             complement(<72027..>72202)
                     /locus_tag="UM146_RS27650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013095193.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing start and stop; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(72648..72919)
                     /locus_tag="UM146_RS27655"
                     /pseudo
     CDS             complement(72648..72919)
                     /locus_tag="UM146_RS27655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322642.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
     gene            complement(<73444..73557)
                     /locus_tag="UM146_RS27660"
                     /pseudo
     CDS             complement(<73444..73557)
                     /locus_tag="UM146_RS27660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_414895.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(73515..73880)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
     CDS             complement(73515..73880)
                     /locus_tag="UM146_RS25165"
                     /old_locus_tag="UM146_24496"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_007372369.1"
                     /note="represses IS2 gene transcription; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000567766.1"
                     /db_xref="GI:446489912"
                     /translation="MIDVLGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAAS
                     QLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLLGKKTMENELLKEAVE
                     YGRAKKWIAHAPLLPGDGE"
     gene            73891..74001
                     /locus_tag="UM146_RS27665"
     CDS             73891..74001
                     /locus_tag="UM146_RS27665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005033001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_032140919.1"
                     /db_xref="GI:692947028"
                     /translation="MTSLKTSIKTITYLSDIGCLEIQGASLNSVLLVLYR"
     gene            74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
     CDS             74162..76132
                     /locus_tag="UM146_RS25170"
                     /old_locus_tag="UM146_24501"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001555799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_001298664.1"
                     /db_xref="GI:485653542"
                     /translation="MYMNVIRNVICTLIILPIGLQAETSHSSMAKDTITVVATGNQNT
                     VFETPSMVSVVTNDTPWSQNAVTSAGMLKGVAGLSQTGAGRTNGQTFNLRGYDKSGVL
                     VLVDGIRQLSDMAKSSGTYLDPALVKRIEVVRGPNSSLYGSGGLGGVVDFRTADAADF
                     LPPGETNGLSLWGNIASGDHSTGSGLTWFGKTGKTDALLSVIMRKRGNIYQSDGERAP
                     NKEKPAALFAKGSVGITDSNKAGASLRLYRNNTTEPGNPTQTHGDSGLRDRKTVQNDV
                     QFWYQYAPVDNSLINVKSTLYLSDITIKTNGHNKTAEWRNNRTSGVNVVNRSHTLIFP
                     GAHQLSYGAEYYRQQQKPEGSATLYPEGNIDFTSLYFQDEMTMKSYPVNIIVGSRYDR
                     YKSFNPRAGELKAERLSPRAAISVSPTDWLMMYGSISSAFRAPTMAEMYRDDVHFYRK
                     GKPNYWVPNLNLKPENNITREIGAGIQLDGLLTGNDRLQLKGGYFGTDARNYIATRVD
                     MKRMRSYSYNVSRARIWGWDMQGNYQSDYFDWMLSYNRTESMDASSREWLGSGNPDTL
                     ISDISIPVGHGGVSAGWRAELSAAATHVKKGDPHQAGYAVHSFSLSYKPVSVKGFEAS
                     VTLDNAFNKLAMNGKGVPLSGRTVSLYTRYQW"
     gene            76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
     CDS             76139..76930
                     /locus_tag="UM146_RS25175"
                     /old_locus_tag="UM146_24506"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000977390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_000977394.1"
                     /db_xref="GI:446900138"
                     /translation="MMKNTGYILALCLTASGHVLAHDVWITGKQAENNITAEIGYGHN
                     FPSKGTIPDRRNFFENPRIYNGKETITLKPASTDYVYKTESASKDNGYVLSTYMKPGY
                     WSRTSSGWKPVSREGRNDVAYCEFVTKYAKSFIPGEQQMPAQLYQSPTGHELEIIPLS
                     DISRFSEDVKLKVLYKTSPLAGAIMELDSVSYLKSSRHTHAVEHKHPVHKAELTFVTN
                     EDGIVTVPSLHIGQWLAKVQNKKSFQDKSLCDETVDVATLSFSRN"
     gene            complement(76993..>77601)
                     /locus_tag="UM146_RS27670"
                     /old_locus_tag="UM146_24511"
                     /pseudo
     CDS             complement(76993..>77601)
                     /locus_tag="UM146_RS27670"
                     /old_locus_tag="UM146_24511"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_308357.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     STS             77015..77097
                     /standard_name="RH124512"
                     /db_xref="UniSTS:161334"
     gene            complement(77669..78451)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
     CDS             complement(77669..78451)
                     /locus_tag="UM146_RS25185"
                     /old_locus_tag="UM146_24516"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002407499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001300609.1"
                     /db_xref="GI:485656465"
                     /translation="MMMELQHQRLMVLAGQLQLESLISAAPALSQQAVDQEWSYMDFL
                     EHLLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIER
                     NENIVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQ
                     RGVMAPRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGD
                     AALTSAMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     gene            complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
     CDS             complement(78448..79470)
                     /locus_tag="UM146_RS25190"
                     /old_locus_tag="UM146_24521"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002407500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_001310017.1"
                     /db_xref="GI:485668912"
                     /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEP
                     PKYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRGFIR
                     SLSVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMR
                     YDTLETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFS
                     PRLCRPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVA
                     NQRKHETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDS
                     FCRGVA"
     gene            complement(79484..80501)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
                     /pseudo
     CDS             complement(79484..80501)
                     /locus_tag="UM146_RS25195"
                     /old_locus_tag="UM146_24526"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001571902.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
     CDS             complement(80550..80897)
                     /locus_tag="UM146_RS25205"
                     /old_locus_tag="UM146_24536"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001402532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000612626.1"
                     /db_xref="GI:446535280"
                     /translation="MIPLPSGTKIWLVAGITDMRNGFNGLAAKVQTTLKDDPMSGHVF
                     IFRGRNGSQVKLLWSTGDGLCLLTKRLERGRFAWPSARDGKVFLTPAQLAMLLEGIDW
                     RQPKRLLTSLTML"
     gene            complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
     CDS             complement(80894..81298)
                     /locus_tag="UM146_RS25210"
                     /old_locus_tag="UM146_24541"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000839180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000839179.1"
                     /db_xref="GI:446761923"
                     /translation="MKSLTAVRKKSPNYPVEFKIKMVELSHRPEISVAQLAREHGIND
                     NLLFKWRQYWREGKLRPPSTTENNVPELLPITLDAEDVVPTTSPRSQPVAAATPESLN
                     ISCEVTFRHGSLRLNGAISENILNLLIRELKR"
     gene            complement(81327..81725)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
     CDS             complement(81327..81725)
                     /locus_tag="UM146_RS25215"
                     /old_locus_tag="UM146_24546"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005058971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071586782.1"
                     /db_xref="GI:1102615682"
                     /translation="MPLTLLSTWQGVVYVAFIIDVFAGYIVGWRVSSSMETTFVLDAL
                     EQALWARRPSGTVHHSDKGSQYVSLAYTQRLKEAGLLASTGSTGDSYDNAMAESINGL
                     YKAEVIHRKSWKNRKRRLSTVWQILKFLRE"
     gene            complement(81800..83323)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
     CDS             complement(81800..83323)
                     /locus_tag="UM146_RS25220"
                     /old_locus_tag="UM146_24551"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group II intron reverse transcriptase/maturase"
                     /protein_id="WP_000587108.1"
                     /db_xref="GI:446509580"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRIVQRAMLMAMEPIWESDFHTLSYGFRPERSVHHAIRTVKLQLTDCGETRGR
                     WVIEGDLSSYFDTVHHRLLMKAVRRRISDARFMTLLWKTIKAGHIDVGLFRAASEGVP
                     QGGVISPLLSNIMLNEFDQYLHERYLSGKARKDRWYWNNSIQRGRSTAVRENWQWKPA
                     VAYCRYADDFVLIVKGTKAQAEAIREECRGVLEGSLKLRLNMDKTKITHVNDGFIFLG
                     HRIIRKRSRYGEMRVVSTIPQEKARNFAASLTALLSGNYSESKVDMAEQLNRKLKGWA
                     MFYQFVDFKAKVFSYIDRVVFWKLAHWLARKYRTGIASLMRWWCKSPKPGQSKTWVLF
                     GKTNHGKLSGEILYWLVGQGKKLFRWRLPEGNPYLRTETRNTYTSRFTEVAMAFASI"
     gene            83277..83702
                     /locus_tag="UM146_RS25225"
     CDS             83277..83702
                     /locus_tag="UM146_RS25225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323220.1"
                     /db_xref="GI:485689122"
                     /translation="MAAHVASLRCISLIIKGLHLVRSVNSRRKHIQTASLRHVMGFPH
                     RGLLRKLRQPARHRSHAPLTSVADLPRFTCLDSGILRRLPVALFILACRKLAEVSNAS
                     VIDAAAPVFRIHVKTPSTGSAYVSLPVPPARPVRSRRPW"
     gene            83737..83988
                     /locus_tag="UM146_RS25230"
     CDS             83737..83988
                     /locus_tag="UM146_RS25230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011069507.1"
                     /db_xref="GI:499381936"
                     /translation="MFFSLSVLNLEDHLGLVISPQSPLSAGYITLRACRRSLPLRFST
                     VTPGGIVGFLIVSYRFNIPDRLAVHLSIHARPELRAHRK"
     gene            complement(83915..84337)
                     /locus_tag="UM146_RS27675"
                     /pseudo
     CDS             complement(83915..84337)
                     /locus_tag="UM146_RS27675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001128921.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
     CDS             84417..85916
                     /locus_tag="UM146_RS25240"
                     /old_locus_tag="UM146_24561"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004118622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000143800.1"
                     /db_xref="GI:446065945"
                     /translation="MTFNTSQVSYYMTQRKKGITQHISAMKAGISVRSGRRIEKGEWA
                     KNSVRHWRTRKDPLEAVWDSMLVPLLKERPALTPTTLLEMLQDKYPGQYPNSLRRTMQ
                     RRVCEWKLQYGAEQEVMFRQRHQPGLRGLSDFTELKGVVVTIAGKLLAHKLYHFRLEW
                     SHWSWMRVVLGGESFSALAEGLQEALGQLGGVPVEHKTDSLRAAWKQQGEDGRRELTE
                     RYAALCQHYGMQGVHNNAGRGHENGSVESAHGHLKRRICQALILRGSNDFSTIEEYQA
                     FITQQVMRHNRNNQDLVKEERLHLKPLPLRRSADYDELTVRVSRSSTINVKHVVYSVP
                     SRLVGQLLRVRLWDDRLSCYVGSSEVMSCPRVRPEKGKTRARRIDFRHVIDSLAKKPG
                     AFCHATLRNDILPDDEWRRLWRRLCNHLEPDMAGRLMVHALKLAAGYDDISVVAKGME
                     QMLNTPGNVDLHRLMRFLGIKEKALPVVNVKQHNLSSYEQLLRGKGGSQ"
     gene            86036..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
     CDS             86036..86668
                     /locus_tag="UM146_RS25245"
                     /old_locus_tag="UM146_24566"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AAA family ATPase"
                     /protein_id="WP_071594740.1"
                     /db_xref="GI:1102726452"
                     /translation="MTLCNEELLWRESEKLRRYKKEARLPVAKTLSEYDFSQVPELNG
                     AQFRQLCETTDWVDAGENVLLFGASGLGKSHLAAAIVDGVVGQGYRARFYSAGELLQE
                     LRKARAQLKLNELLLKLDRYRVIVVDDLGYVKRDSAETGVLFELIAHRYERGSLVITS
                     NHPFSMWGSIFVDETMAVAAADRLIHHGYMFELKGESYRKKTAKAVTSAT"
     gene            complement(86559..86810)
                     /locus_tag="UM146_RS27680"
     CDS             complement(86559..86810)
                     /locus_tag="UM146_RS27680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001537590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001537590.1"
                     /db_xref="GI:486179890"
                     /translation="MPLLDKLRKLYGVGPVCSELHIAPSTIRRQLVLPTRANYTGRTL
                     QCDIKSRLLLPSLSFSCSFHLSVRTYIRDGSAGLPPPPP"
     gene            complement(<86885..87136)
                     /locus_tag="UM146_RS25250"
                     /old_locus_tag="UM146_24571"
                     /pseudo
     CDS             complement(<86885..87136)
                     /locus_tag="UM146_RS25250"
                     /old_locus_tag="UM146_24571"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052667.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            <87162..87467
                     /locus_tag="UM146_RS25255"
                     /old_locus_tag="UM146_24576"
                     /pseudo
     CDS             <87162..87467
                     /locus_tag="UM146_RS25255"
                     /old_locus_tag="UM146_24576"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_707688.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS91 family transposase"
     gene            complement(87990..89165)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
     CDS             complement(87990..89165)
                     /locus_tag="UM146_RS25260"
                     /old_locus_tag="UM146_24581"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001604471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001020413.1"
                     /db_xref="GI:446943157"
                     /translation="MNIFTLSKAPLYLLISLFLPTMAMAIDPPERELSRFALKTNYLQ
                     SPDEGVYELAFDNASKKVFAAVTDRVNREANKGYLYSFNSDSLKVENKYTMPYRAFSL
                     AINQDKHQLYIGHTQSASLRISMFDTPTGKLVRTSDRLSFKAANAADSRFEHFRHMVY
                     SQDSDTLFVSYSNMLKTAEGMKPLHKLLMLDGTTLALKGEVKDAYKGTAYGLTMDEKT
                     QKIYVGGRDYINEIDAKNQTLLRTIPLKDPRPQITSVQNLAVDSASDRAFVVVFDHDD
                     RSGTKDGLYIFDLRDGKQLGYVHTGAGANAVKYNPKYNELYVTNFTSGTISVVDATKY
                     SITREFNMPVYPNQMVLSDDMDTLYIGIKEGFNRDWDPDVFVEGAKERILSIDLKKS"
     gene            89095..89325
                     /locus_tag="UM146_RS27685"
     CDS             89095..89325
                     /locus_tag="UM146_RS27685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012000801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012000801.1"
                     /db_xref="GI:500819495"
                     /translation="MAIVGKNSEINRYSGALDKVKIFIFRSCNKIDIREKTYCLNLAE
                     IVIRNECPRQISMFCHARNWLGGSRHQDLASC"
     gene            complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
     CDS             complement(89234..91495)
                     /locus_tag="UM146_RS25265"
                     /old_locus_tag="UM146_24586"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016536327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin Js receptor"
                     /protein_id="WP_001100763.1"
                     /db_xref="GI:447023507"
                     /translation="MNVIKLAIGSGILLLSCGAYSQSISEKTNSDKKGAAEFSPLSVS
                     VGKTTSEQEALEKTGATSSRTTDKNLQSLDATVRSMPGTYTQIDPGQGAISVNIRGMS
                     GFGRVNTMVDGITQSFYGTSTSGTTTHGSTNNMAGVLIDPNLLVAVDVTRGDSSGSEG
                     INALAGSANMRTIGVDDVIFNGNTYGLRSRFSVGSNGLGRSGMIALGGKSDAFTDTGS
                     IGVMAAVSGSSVYSNFSNGSGINSKEFGYDKYMKQNPKSQLYKMDIRPDEFNSFELSA
                     RTYENKFTRRDITSDDYYIKYHYTPFSELIDFNVTASTSRGNQKYRDGSLYTFYKTSA
                     QNRSDALDINNTSRFTVADNDLEFMLGSKLMRTRYDRTIHSAAGDPKANQESIENNPF
                     APSGQQDISALYTGLKVTRGIWEADFNLNYTRNRITGYKPACDSRVICVPQGSYDIDD
                     KEGGFNPSVQLSAQVTPWLQPFIGYSKSMRAPNIQEMFFSNSGGASMNPFLKPERAET
                     WQAGFNIDTRDLLVEQDALRFKALAYRSRIQNYIYSESYLVCSGGRKCSLPEVIGNGW
                     EGISDEYSDNMYIYVNSASDVIAKGFELEMDYDAGFAFGRLSFSQQQTDQPTSIASTH
                     FGAGDITELPRKYMTLDTGVRFFDNALTLGTIIKYTGKARRLSPDFEQDEHTGAIIKQ
                     DLPQIPTIIDLYGTYEYNRNLTLKLSVQNLMNRDYSEALNKLNMMPGLGDETHPANSA
                     RGRTWIFGGDIRF"
     gene            complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
     CDS             complement(91664..92440)
                     /locus_tag="UM146_RS25270"
                     /old_locus_tag="UM146_24591"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004095468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biopolymer transporter TonB"
                     /protein_id="WP_000981091.1"
                     /db_xref="GI:446903835"
                     /translation="MMNILHFSQSVKWSSWFICSLLLHGLIFLAFIWRFSEVQPAMSP
                     APAIMLQWAEIIEAPSSPLSLPVGIAQQESAVTEEKQQTEDRQQRPVTEDSDATIEIT
                     RKKKSSDGEKKKTRPPRKIKAQTSDSNPTAVSSNAAPQALVESSRIAAPFNSDSTKRD
                     NSEASWESRVKGHLNRYKRYPGDARKRARTGTAVVTFTVNTEGTIVSSFLEISSGTFS
                     LDREAIAVLERAQPLPKPPPEILEGGLFKVKMPITFKLKE"
     gene            complement(92448..93323)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
     CDS             complement(92448..93323)
                     /locus_tag="UM146_RS25275"
                     /old_locus_tag="UM146_24596"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001224622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001224623.1"
                     /db_xref="GI:447147367"
                     /translation="MRKFILISMITLASVSLGACRQNVTIKQDAPGQKAFLTDGQIYD
                     LHSGKIISSSELLADLATAQHLIIGEKHDNAEHHQIELWLIQNLLIQRPQGSVLLEML
                     TSEQQPRVNQVKCWLKDNPVVRDSRVQELLNWQKGWSWEMYGDIVMQLLRGPYPLLNA
                     NIGREQILALYKKNEFPKGKKSTAPVVQEALRETIISMHEGNLESQQLTSMLSIQQQR
                     DRYMARQLLSAPVPSLLIAGGYHASKSMGVPLHMEDLATGTHPVVLMLAEKGMNITVD
                     HADYVWFVAPDTTKR"
     gene            complement(93655..>94341)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
                     /pseudo
     CDS             complement(93655..>94341)
                     /locus_tag="UM146_RS25280"
                     /old_locus_tag="UM146_24601"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001554952.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication protein"
     gene            94798..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
     CDS             94798..94980
                     /locus_tag="UM146_RS25285"
                     /old_locus_tag="UM146_24611"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000872630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000872630.1"
                     /db_xref="GI:446795374"
                     /translation="MKYDFINGSSILIIVWMTIAVIIRVTNWKFNKKTAPAISLFLAF
                     PASIVILLVYIFFFDK"
     gene            complement(95380..95562)
                     /locus_tag="UM146_RS27690"
     CDS             complement(95380..95562)
                     /locus_tag="UM146_RS27690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322410.1"
                     /db_xref="GI:485688271"
                     /translation="MFPIFILFIIYWLYVKSIISLMIKMVSGVRISENKGCNMLFFLC
                     KYLRILNHSTRMIMYM"
     gene            95566..95775
                     /locus_tag="UM146_RS27695"
     CDS             95566..95775
                     /locus_tag="UM146_RS27695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001322411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001322411.1"
                     /db_xref="GI:485688272"
                     /translation="MLYKIFTLNTKIKTTIITICALSYNLTAQASPSYRPRDRVNKTM
                     IELQTNGVERQLLDNSCGISSGVFK"
     gene            complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
     CDS             complement(95793..96128)
                     /locus_tag="UM146_RS25290"
                     /old_locus_tag="UM146_24616"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001080726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="colicin transporter"
                     /protein_id="WP_001080732.1"
                     /db_xref="GI:447003476"
                     /translation="MNRKYYFNNMWWGWVTGGYMLYMSWDYDFKYRLLFWCISLCGMV
                     LYPVAKWYIEDTALKFTRPDFWNSGFFTDTPGKMGLLAVYTGTVFILSLPLSMIYILS
                     VIIKRLSVR"
     gene            complement(96106..96288)
                     /locus_tag="UM146_RS27700"
     CDS             complement(96106..96288)
                     /locus_tag="UM146_RS27700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001367787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050006832.1"
                     /db_xref="GI:910130376"
                     /translation="MARAFFCSKVTGAPPFHDVNVTQLIVIDYYYHAVVMLSCISTLT
                     KVQKKGKLADEQKILF"
     gene            96257..96604
                     /locus_tag="UM146_RS25295"
     CDS             96257..96604
                     /locus_tag="UM146_RS25295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001563283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000142452.1"
                     /db_xref="GI:446064597"
                     /translation="MTFEQKKARAIALMDSKKMWRSNYAPPLLRILWRLGIRLPPLPF
                     MPFWQVTVLTGGLWGISWGCAMWFIYWGPSGMVAGEAIIISITGGFLSGLLMASFHWW
                     RRKVNRLPPWDDV"
     gene            complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
     CDS             complement(96624..97133)
                     /locus_tag="UM146_RS25300"
                     /old_locus_tag="UM146_24621"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000194542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000194542.1"
                     /db_xref="GI:446116687"
                     /translation="MTQSRRPSPLQRRVLIVLAALDEKRPGPVLTRDIERVLEQSGEA
                     PVYGPNLRASCRRLEDAGWLRTLRAPNLQLAVELTDAGRAVAQPLLPAGGTSATDLAV
                     ELNGITYQACRGDFVVRLDGSTCLQLWNKEGRVVRREGDPLEVAQWLQACHDAGMEVR
                     VQINESAAP"
     gene            complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
     CDS             complement(97130..97390)
                     /locus_tag="UM146_RS25305"
                     /old_locus_tag="UM146_24626"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001488293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000371882.1"
                     /db_xref="GI:446294027"
                     /translation="MDQEMTFSLSYEQLTRFAEKRIRECNLDSHGVTYLCESAKAGAV
                     LIFWHELAINGYTSMNAIKRQEIIDADHQRLRKLIWPEDDWK"
     gene            97492..>97743
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
                     /pseudo
     CDS             97492..>97743
                     /locus_tag="UM146_RS25310"
                     /old_locus_tag="UM146_24631"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052667.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            97818..98297
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
     CDS             97818..98297
                     /locus_tag="UM146_RS25315"
                     /old_locus_tag="UM146_24636"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001128921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001130166.1"
                     /db_xref="GI:447052910"
                     /translation="MPLLDKLRKLYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
                     QRDDWLKKEILRVYDGNHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGK
                     KVRTTVSRKAVAAGDRVNRQFVAERPDQLWVADFTYGVPGVQGGHGCLNEPRVCLEY"
     gene            complement(98224..98475)
                     /locus_tag="UM146_RS27705"
     CDS             complement(98224..98475)
                     /locus_tag="UM146_RS27705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_708751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011069507.1"
                     /db_xref="GI:499381936"
                     /translation="MFFSLSVLNLEDHLGLVISPQSPLSAGYITLRACRRSLPLRFST
                     VTPGGIVGFLIVSYRFNIPDRLAVHLSIHARPELRAHRK"
     gene            complement(98510..98935)
                     /locus_tag="UM146_RS27710"
     CDS             complement(98510..98935)
                     /locus_tag="UM146_RS27710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001323569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001323220.1"
                     /db_xref="GI:485689122"
                     /translation="MAAHVASLRCISLIIKGLHLVRSVNSRRKHIQTASLRHVMGFPH
                     RGLLRKLRQPARHRSHAPLTSVADLPRFTCLDSGILRRLPVALFILACRKLAEVSNAS
                     VIDAAAPVFRIHVKTPSTGSAYVSLPVPPARPVRSRRPW"
     gene            98889..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
     CDS             98889..99392
                     /locus_tag="UM146_RS25320"
                     /old_locus_tag="UM146_24641"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001388610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_000587098.1"
                     /db_xref="GI:446509570"
                     /translation="MIISEMQRKLATWAATDPSLRIQRLLRLITQPEWLAEAARITLS
                     SKGAHTPGVDGVNKTMLQARLAVELQILRDELLSGHYQPLPARRVYIPKSNGKLRPLG
                     IPALRDRISIRAKVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRVDQMI
                     RQWERSQ"
     gene            complement(99431..100175)
                     /locus_tag="UM146_RS27715"
                     /pseudo
     CDS             complement(99431..100175)
                     /locus_tag="UM146_RS27715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001554950.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="histidine acid phosphatase"
     gene            complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
     CDS             complement(100297..100782)
                     /locus_tag="UM146_RS25335"
                     /old_locus_tag="UM146_24656"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_005122128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000874189.1"
                     /db_xref="GI:446796933"
                     /translation="MAFIWNDESLAILRENAGILTTEQIAQLLHTNITAVRNMAYRLK
                     LSLRVTAYNHRRIAQVQALYASETLSLKEIAAKTGLTASTVQYIVYVKSKNKPYATTE
                     YVSFETENAVHYRVQKEFVDTERSLLDNISDNTRFRELYLTDGTFYCARNIKYEVFIS
                     E"
     gene            complement(100807..101292)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
     CDS             complement(100807..101292)
                     /locus_tag="UM146_RS25340"
                     /old_locus_tag="UM146_24661"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015839663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_001267176.1"
                     /db_xref="GI:447189920"
                     /translation="MRWHNVLLLAAAILISGCKEEKLAVGAPAPALAAFDLQGQESGL
                     ERWQGKAVYLNFWSAGCGGCLAEMDTLEALSKKWGDKVVVVAVNTDPETVRINDLLAK
                     HQITYPVVRDQLNITQERYQVIGTPTSVLIDSEGRVLELHQGMRKPSELEATFARLAA
                     R"
     gene            complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
     CDS             complement(101279..101974)
                     /locus_tag="UM146_RS25345"
                     /old_locus_tag="UM146_24666"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004863043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000117262.1"
                     /db_xref="GI:446039407"
                     /translation="MSVTHIPQVAIETRHLYKRFGDVTALDDINLRIAQGEFVAIMGA
                     SGSGKTTLMNILTCLDTATEGQVFLDGTDAAALDEEGRRRFRAEKIGLVFQQFHLIPF
                     LTALENIMLAQHYHSVVDEAAARKVLEQVGLGHRVTHLPSQLSGGEQQRVCIARALVN
                     EPPVIFADEPTGNLDEENEQRVLDLLTDLHRQGRTIVMVTHNPALGQFADRILRLQHG
                     KYLGEEANQHALA"
     gene            complement(101979..103108)
                     /locus_tag="UM146_RS25350"
                     /old_locus_tag="UM146_24671"
                     /pseudo
     CDS             complement(101979..103108)
                     /locus_tag="UM146_RS25350"
                     /old_locus_tag="UM146_24671"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000729219.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
     gene            complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
     CDS             complement(103098..104381)
                     /locus_tag="UM146_RS25355"
                     /old_locus_tag="UM146_24676"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015839660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000964653.1"
                     /db_xref="GI:446887397"
                     /translation="MLWRMLRQSWGRNLRRKVLAIITVFLASSLISALLAVSIDIGDK
                     MSRELKSYGANILIEPAGQAALPALFSESSNPLSGQDFLDEAELPNIKDIFWRNNIVG
                     FAPMLGGEASVEGEPVRILGTFFSQPVDIPDEEGYETGQKTVSPYWQVTGDWPQEPAG
                     AEPQTLVGHALARQMGWKPGDKLTLRTEGEAVQVTVSGILSSGGDEDNQLVMPLSTVQ
                     HLLGLPGKVQAIRVSALTVPENELSRRARENLDALNAEEYDLWYCTAYVSSIAHQLEE
                     AISGAEVRPVWQVAASEGVVIDKIQLLMAVVTVAALVASAMGIASLMTSTIMERAKEI
                     GLMKALGARQWQIMLLFYLEAASSGLAGGALGCIAGWGLAKAIGVMLFDAPLNFAWIV
                     VPCVLVIAVLIALIGTWFPARRIARLYPVEVLYGR"
     gene            complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
     CDS             complement(104384..105763)
                     /locus_tag="UM146_RS25360"
                     /old_locus_tag="UM146_24681"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003836820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000119836.1"
                     /db_xref="GI:446041981"
                     /translation="MSYFFVTTLQVFFCIALLSGVLWSRNDPPSLRPLTWTLLTGLIA
                     GVLAGLFIHGSQPVQLLLVGAEVMVSLLFVLSFWWASTRIRYLWQGILIFGAARHWAL
                     DPNLGGLTSTHVLNTDLLLNLTAVVLAFAILCLAGVLCAMLLRRIRGLYWPLTLILLV
                     MIWLPLSGNLLLLLMKLQVVPLGKSLLSFVAKVTNNTALYNWAGAALLLALALCWLPA
                     LLRAFRQTRETEEPIAHRLALAQRRNALRLWLVTIGCAVVVIAGQLWWDKVASQPPQL
                     SEAVPVTLGSDGMVRLPVEQLRDGKLHRFVWVADDGKAVRFFVINRYPDKLRFGVVFD
                     ACLLCGDQGYVMEGNQVICVACGVHIFIPSIGKAGGCNPVPIENWHNDEKELVIPGKE
                     LATGVNYFSTVMTIKVTDPVDGSTLTNTSADYKYSYGGKTWFFSSEANYERFRETPEQ
                     FVPADMREE"
     gene            complement(<105876..>106322)
                     /locus_tag="UM146_RS27720"
                     /old_locus_tag="UM146_24686"
                     /pseudo
     CDS             complement(<105876..>106322)
                     /locus_tag="UM146_RS27720"
                     /old_locus_tag="UM146_24686"
                     /inference="COORDINATES: protein motif:HMM:PF10634.7"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
     gene            complement(<106446..108374)
                     /locus_tag="UM146_RS25365"
                     /pseudo
     CDS             complement(<106446..108374)
                     /locus_tag="UM146_RS25365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003836821.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="iron permease"
     gene            complement(108323..108508)
                     /locus_tag="UM146_RS27725"
     CDS             complement(108323..108508)
                     /locus_tag="UM146_RS27725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001332814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001332814.1"
                     /db_xref="GI:485699452"
                     /translation="MCSSRFDEINLHNLSSADIFMIQVMYNATKRYDNNYHLYSLAVC
                     TCVTSVTLCWLLSLACL"
     gene            complement(108667..109482)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
     CDS             complement(108667..109482)
                     /locus_tag="UM146_RS25370"
                     /old_locus_tag="UM146_24691"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014640325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:ubiquinone reductase (Na(+)-transporting)
                     subunit C"
                     /protein_id="WP_012372823.1"
                     /db_xref="GI:501341188"
                     /translation="MIRSGDFFDFHFDRDNNSMRKGKIIVASMMVLCVLIFVAAAAWF
                     MLFQGEMTEPTEEEKQAAILHAAGLMKSETQDKKSVETLYHRYIIQRHVNLDSGELVA
                     GSSADTARQKCEKLAPERDPAQVRQRCTVADVFFVKDKNNEIQQVIIPVTGKGAKSMM
                     HAFLALGLDGRTVRNLYYYQQRETPFLGARVEDANWRKQWPGKRLLDNSGHPALKIVQ
                     DKPEHADEYTVDGISGATLTSTGVEKSINYWMGPQGYGQFLQRLASDRNNLNL"
     gene            complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
     CDS             complement(109665..110171)
                     /locus_tag="UM146_RS25375"
                     /old_locus_tag="UM146_24696"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_003035978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein disulfide oxidoreductase"
                     /protein_id="WP_000949451.1"
                     /db_xref="GI:446872195"
                     /translation="MLSKLRRWLREGAILLVLLAGVIILLDVWRSPQMPAMFDSTPLH
                     TLDGETVTLASISEERPVLLYFWASWCGICRFTTPDVARLQSEGESVMTIALRSGNDG
                     EVSRWLSRKRVTFPVVNDSGGEISRNWEISVTPTLVVVSKGQVVTTTSGWTSYWGMKL
                     RLWRAAMF"
     gene            complement(110161..110319)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
     CDS             complement(110161..110319)
                     /locus_tag="UM146_RS25380"
                     /old_locus_tag="UM146_24701"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000449408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-sensitivity suppressor C"
                     /protein_id="WP_000449408.1"
                     /db_xref="GI:446371553"
                     /translation="METLSTNLQLARLVGVQGTPATIIGDEMIPGAVSWETLEAVVKE
                     KLAVAHAQ"
     gene            110269..110527
                     /locus_tag="UM146_RS27730"
                     /pseudo
     CDS             110269..110527
                     /locus_tag="UM146_RS27730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001347455.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
     CDS             complement(110418..111122)
                     /locus_tag="UM146_RS25385"
                     /old_locus_tag="UM146_24706"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_006162230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS6 family transposase"
                     /protein_id="WP_001067837.1"
                     /db_xref="GI:446990581"
                     /translation="MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDH
                     STIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTV
                     DFYLSSRRNSKAAYLFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDV
                     EHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMGALRKGQASAFYY
                     GDPLGEMRLVSRVFEM"
     gene            complement(111265..111441)
                     /locus_tag="UM146_RS25390"
                     /pseudo
     CDS             complement(111265..111441)
                     /locus_tag="UM146_RS25390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001303311.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            111475..111606
                     /locus_tag="UM146_RS27735"
     CDS             111475..111606
                     /locus_tag="UM146_RS27735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001330800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA4"
                     /protein_id="WP_071531798.1"
                     /db_xref="GI:1101981840"
                     /translation="MRELLCAVGVVPTRVYPKSGRISALAGRQGRLRACTEDFQPEH"
     gene            complement(111568..111815)
                     /locus_tag="UM146_RS27740"
                     /pseudo
     CDS             complement(111568..111815)
                     /locus_tag="UM146_RS27740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011321719.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
     gene            complement(112178..113035)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
     CDS             complement(112178..113035)
                     /locus_tag="UM146_RS25395"
                     /old_locus_tag="UM146_24711"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_052675.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein"
                     /protein_id="WP_000131004.1"
                     /db_xref="GI:446053149"
                     /translation="MTDLQQTYYRQVKNPNPVFTPRKGAGTLKFCEKLMEKAVGFTSR
                     FDFAIHVAHARSRGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESGAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
                     SEDAVAAARRSRVEWENKQRKKQGLDTLGMDELIAKAWRFVRERFCSYQTELKSRGIK
                     RARARRDANRERQDIVTLVKRQLTREISEGRFSASREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     gene            complement(113028..113102)
                     /locus_tag="UM146_RS25400"
     CDS             complement(113028..113102)
                     /locus_tag="UM146_RS25400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="positive regulator of RepFIC repA1 expression"
                     /protein_id="WP_001365705.1"
                     /db_xref="GI:485738474"
                     /translation="MPGKVQDFFLCSLLLRIVSAGWCD"
     gene            113148..113294
                     /locus_tag="UM146_RS27745"
     CDS             113148..113294
                     /locus_tag="UM146_RS27745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001584988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein RepA"
                     /protein_id="WP_071527739.1"
                     /db_xref="GI:1101977779"
                     /translation="MLAPVIFFVAKHRKIIGVFAFLAPVNPHQNQFPATLRRGQPQNS
                     LNDQ"
     gene            complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
     CDS             complement(113335..113595)
                     /locus_tag="UM146_RS25405"
                     /old_locus_tag="UM146_24716"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_406220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_000078109.1"
                     /db_xref="GI:446000254"
                     /translation="MSQIENAVTSSPKRIYRKGNPLTGAEKQRISVSRKKGTHKAINV
                     FIQSELKDDLTQLCKDSGLTQKEMIEHWILKEKAAMTDANRK"
     gene            complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
     CDS             complement(113835..114425)
                     /locus_tag="UM146_RS25410"
                     /old_locus_tag="UM146_24721"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_858390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000766808.1"
                     /db_xref="GI:446689462"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERILSGGEYWQRQKTLLTEREVSFMKGLFRIVDMKRWYLCPQVRVADIVQLNGNIRP
                     RSRQWWQLFRMVSQWHVDVVIVERRSFSIVAAVELDDASHLRPERRRRDILLEEVLRQ
                     AGIPLLRSHDARKLLQMTGEWLNTTGAVQQSPEHRS"
CONTIG      join(CP002168.1:1..114550)
//
DBGET integrated database retrieval system