GenomeNet

Database: RefSeq
Entry: NC_017741
LinkDB: NC_017741
Original site: NC_017741 
LOCUS       NC_017741            1663456 bp    DNA     circular CON 23-MAR-2017
DEFINITION  Helicobacter pylori Shi112, complete genome.
ACCESSION   NC_017741
VERSION     NC_017741.1
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603194
            Assembly: GCF_000277405.1
KEYWORDS    RefSeq.
SOURCE      Helicobacter pylori Shi112
  ORGANISM  Helicobacter pylori Shi112
            Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
            Helicobacteraceae; Helicobacter.
REFERENCE   1  (bases 1 to 1663456)
  AUTHORS   Kersulyte,D., Cabrera,L., Pacheco,R., Herrera,P., Rodriguez,C.,
            Gilman,R.H. and Berg,D.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) Molecular Microbiology, Washington
            University Medical School, 4940 Parkview Place, Saint Louis, MO
            63110, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP003474.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 03/23/2017 00:11:04
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.1
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 1,635
            CDS (total)                       :: 1,590
            Genes (coding)                    :: 1,493
            CDS (coding)                      :: 1,493
            Genes (RNA)                       :: 45
            rRNAs                             :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                    :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                             :: 36
            ncRNAs                            :: 3
            Pseudo Genes (total)              :: 97
            Pseudo Genes (ambiguous residues) :: 0 of 97
            Pseudo Genes (frameshifted)       :: 72 of 97
            Pseudo Genes (incomplete)         :: 17 of 97
            Pseudo Genes (internal stop)      :: 22 of 97
            Pseudo Genes (multiple problems)  :: 12 of 97
            CRISPR Arrays                     :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1663456
                     /organism="Helicobacter pylori Shi112"
                     /mol_type="genomic DNA"
                     /strain="Shi112"
                     /isolation_source="gastric antrum of Amerindian resident"
                     /host="Homo sapiens"
                     /db_xref="taxon:1163740"
                     /country="Peru: Amazonian viillage of Shimaa"
     gene            complement(11..427)
                     /locus_tag="HPSH112_RS00005"
                     /old_locus_tag="HPSH112_00005"
     CDS             complement(11..427)
                     /locus_tag="HPSH112_RS00005"
                     /old_locus_tag="HPSH112_00005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N utilization substance protein B"
                     /protein_id="WP_000235739.1"
                     /translation="MATRTQARGAVVELLYAFESGNEEIKKIASSMLEEKKIKNNQLA
                     FALSLFNGVLEKINEIDALIEPHLKDWDFKRLGSMEKAILRLGAYEIGFTPTQNPIII
                     NECIELGKLYAEPNTPKFLNAILDSLSKKLAQKPLN"
     gene            complement(429..899)
                     /locus_tag="HPSH112_RS00010"
                     /old_locus_tag="HPSH112_00010"
     CDS             complement(429..899)
                     /locus_tag="HPSH112_RS00010"
                     /old_locus_tag="HPSH112_00010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="WP_001165591.1"
                     /translation="MQIIEGKLHLQGNEKVAILTSRFNHIITDRLQEGAIDCFKRHGG
                     DENLLDIVLVPGAYELPFILERLLGSEKYDGVCVLGAIIRGGTPHFDYVSAEATKGIA
                     NAMLKYSMPVSFGVLTTDNVEQAIERAGSKAGNKGFEAMSTLIELLSLCQTLKG"
     gene            complement(909..1739)
                     /locus_tag="HPSH112_RS00015"
                     /old_locus_tag="HPSH112_00015"
     CDS             complement(909..1739)
                     /locus_tag="HPSH112_RS00015"
                     /old_locus_tag="HPSH112_00015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-8-phosphooctulonate synthase"
                     /protein_id="WP_000858167.1"
                     /translation="MKTSKTKTPKSVLIAGPCVIESLENLRSIATKLQPLANNERLDF
                     YFKASFDKANRTSLESYRGPGLEKGLEMLQTIKDEFGYKILTDVHESYQASAAAKVAD
                     ILQIPAFLCRQTDLIVEVSQTNAIINIKKGQFMNPKDMQYSVLKALKTRDSSIQNPTY
                     ETALKNGVWLCERGSSFGYGNLVVDMRSLKIMREFAPVIFDATHSVQMPGGANGKSSG
                     DSSFAPILARAAAAVGIDGLFAETHVDPKNALSDGANMLKPDELEHLVADMLKIQNLF
                     "
     gene            complement(1726..2391)
                     /locus_tag="HPSH112_RS00020"
                     /old_locus_tag="HPSH112_00020"
     CDS             complement(1726..2391)
                     /locus_tag="HPSH112_RS00020"
                     /old_locus_tag="HPSH112_00020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="WP_000642966.1"
                     /translation="MKAFLGALEFQENEYEELKEFYESLKTKQKPHTLFISCVDSRVV
                     PNLITGTKPGELYAIRNMGNVIPPKTSYKESLSTMASIEYAIVHVGIQNLIICGHSDC
                     GACGSIHLINDETTKAKTPYIADWIQFLEPIKEELKNHPQFSSHFAKRSWLTERLNVR
                     LQLNNLLSYDFIQERVMNNELKIFGWHYIIETGRIYNYNFESHFFEPIEETIKQRKSH
                     ENF"
     gene            2513..3196
                     /locus_tag="HPSH112_RS00025"
                     /old_locus_tag="HPSH112_00025"
     CDS             2513..3196
                     /locus_tag="HPSH112_RS00025"
                     /old_locus_tag="HPSH112_00025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206807.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine-5'-phosphate decarboxylase"
                     /protein_id="WP_001175360.1"
                     /translation="MQLCVALDLEKKEDNLSLLQELKGLDLWAKVGLRSFIRDGAVFL
                     DEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLEVDMLTVHLSSAKSALTILMQRL
                     NALKKRPLIMGVSTLTSFSEEEFLSVYNAPLKTQAIKLSVMGKESGIDGVVCSVFESL
                     AVKEALGKGFLTLTPGIRLDKNDKEDQERVANAKEAKQNLSDFIVVGRPIYQAKEPRE
                     VVLELLKDC"
     gene            3197..4027
                     /locus_tag="HPSH112_RS00030"
                     /old_locus_tag="HPSH112_00030"
     CDS             3197..4027
                     /locus_tag="HPSH112_RS00030"
                     /old_locus_tag="HPSH112_00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="WP_001201978.1"
                     /translation="MRALETITALREYRKSLKESVGFVPTMGALHKGHQSLIERSLKE
                     NSHTIVSVFVNPTQFGANEDFSAYPRPLEKDLALCEGLGVNAVFVPKTSEMYPYEIEQ
                     RLKLYAPTFLSHSLEGAMREGHFDGVVQVVLKLFHLVNPTRAYFGKKDAQQLLIIQHL
                     VQDLLLDIEIVPCEIVRDSDNLALSSRNVYLNATQRKQALAIPKALENIKQAIDKGEK
                     ACEKLKKLGLGILETLEVDYLEFCNHKLEPLKTIEPTNTLVLVAARVGKTRLLDNLWV
                     "
     gene            complement(4041..4116)
                     /locus_tag="HPSH112_RS00035"
                     /old_locus_tag="HPSH112_t08182"
     tRNA            complement(4041..4116)
                     /locus_tag="HPSH112_RS00035"
                     /old_locus_tag="HPSH112_t08182"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(4080..4082),aa:Glu,seq:ttc)
     gene            complement(4180..4256)
                     /locus_tag="HPSH112_RS00040"
                     /old_locus_tag="HPSH112_t08184"
     tRNA            complement(4180..4256)
                     /locus_tag="HPSH112_RS00040"
                     /old_locus_tag="HPSH112_t08184"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(4220..4222),aa:Asp,seq:gtc)
     gene            complement(4297..4372)
                     /locus_tag="HPSH112_RS00045"
                     /old_locus_tag="HPSH112_t08186"
     tRNA            complement(4297..4372)
                     /locus_tag="HPSH112_RS00045"
                     /old_locus_tag="HPSH112_t08186"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(4337..4339),aa:Val,seq:tac)
     gene            complement(4414..4488)
                     /locus_tag="HPSH112_RS00050"
                     /old_locus_tag="HPSH112_t08188"
     tRNA            complement(4414..4488)
                     /locus_tag="HPSH112_RS00050"
                     /old_locus_tag="HPSH112_t08188"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(4453..4455),aa:Glu,seq:ttc)
     gene            complement(4499..4574)
                     /locus_tag="HPSH112_RS00055"
                     /old_locus_tag="HPSH112_t08190"
     tRNA            complement(4499..4574)
                     /locus_tag="HPSH112_RS00055"
                     /old_locus_tag="HPSH112_t08190"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(4539..4541),aa:Lys,seq:ttt)
     gene            complement(5073..6942)
                     /locus_tag="HPSH112_RS00065"
                     /pseudo
     CDS             complement(5073..6942)
                     /locus_tag="HPSH112_RS00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206811.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(7342..8982)
                     /locus_tag="HPSH112_RS00070"
                     /old_locus_tag="HPSH112_00045"
     CDS             complement(7342..8982)
                     /locus_tag="HPSH112_RS00070"
                     /old_locus_tag="HPSH112_00045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_001040316.1"
                     /translation="MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYG
                     APSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEG
                     LRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKL
                     IADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAY
                     ILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVK
                     APGFGDRRKEMLKDIAVLTGGQVISEELGLTLENAEVEFLGKAGRIVIDKDNTTIVDG
                     KGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKK
                     DRVDDALSATKAAVEEGIVIGGGAALIRAAQKVHLNLHDDEKVGYEIIMRAIKAPLAQ
                     IAINAGYDGGVVVNEVQKHEGHFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVS
                     SLLLTTEATVHEIKEEKATPAMPDMGGMGGMGGMGGMM"
     gene            complement(9005..9361)
                     /locus_tag="HPSH112_RS00075"
                     /old_locus_tag="HPSH112_00050"
     CDS             complement(9005..9361)
                     /locus_tag="HPSH112_RS00075"
                     /old_locus_tag="HPSH112_00050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GroES"
                     /protein_id="WP_000671959.1"
                     /translation="MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVS
                     HKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIVSSGSCCHTNSHDH
                     KHAKEHESCCHDHKKH"
     gene            complement(9452..9655)
                     /locus_tag="HPSH112_RS08115"
                     /pseudo
     CDS             complement(9452..9655)
                     /locus_tag="HPSH112_RS08115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000421997.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            9636..11315
                     /locus_tag="HPSH112_RS00080"
                     /old_locus_tag="HPSH112_00055"
     CDS             9636..11315
                     /locus_tag="HPSH112_RS00080"
                     /old_locus_tag="HPSH112_00055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_000601511.1"
                     /translation="MILKSSIDRLLQTIDIVEIISSYVDLRKSGSNYMACCPFHEERS
                     ASFSVNQVKGFYHCFGCGASGDSIKFVMEFEKLSFVEALEKLAHRFNVALEYDKGVYY
                     DHKEDYHLLEMVSSLYQEELFNAPFFLNYLQKRGLSIESIRAFKLGLCTNRIDYGIEN
                     KGLNKDKLIELGVLGKSDKKDRTYLRFLDRIMFPIYSPSAQVVGFGGRTLKEKAAKYI
                     NSPQNKLFDKSSLLYGYHLAKEHIYKQKQVIVTEGYLDVILLHQAGFKNAIATLGTAL
                     TPSHLPLLKKGEPEILLSYDGDKAGRNAAYKASLMLAKEQRRGGVILFENNLDPADMI
                     ANGQIETLKNWLSRPMAFIEFVLRHMAGSYLLDDPLEKDKALKEMLGFLKNFSLLLQS
                     EYKPLIASLLQAPLHVLGIRERVSFQPFYPKTEKPNHAQKLVNAPSTLSLEFLEKLVI
                     RYLLEDRSLLDLAVGYIHSGVFLHKKQEFDALCQEKLDDPKLVALLLDANLPLKKGGF
                     EKELRLLILRYFERQLKEIPKSSLPFSEKMIFLKKARQAIMKLKQGELVAI"
     gene            11312..12364
                     /locus_tag="HPSH112_RS00085"
                     /old_locus_tag="HPSH112_00060"
     CDS             11312..12364
                     /locus_tag="HPSH112_RS00085"
                     /old_locus_tag="HPSH112_00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_000802571.1"
                     /translation="MKPIKALALFSGGLDSLLSMKLLIDQGIEVSALHFNIGFGGNKD
                     KREYFENATAQIGAKLLVCDIREQFFNDVLFKPKYGYGKYFNPCIDCHANMFRNAFYK
                     MLELNADFVLSGEVLGQRPKSQRKEALNQVRKLVREVGEEARFDPILDRTQASGEKPQ
                     FLDELLLRPMSAKLLEPTFMEKKGWVDREKLLDVSGRGRSRQLQMIKDYGLKYYEKPG
                     GGCLLTDIQVSNKIKNLKEYREMVFEDSVIVKNGRYFILPNNARLVVARNEEENHKLD
                     IQHPLMDKIELLSCKGPLSLVDKNASKEDKELAGRIALGYAKTLKNQAYLIQIGDEKR
                     ELYPLDKESAREYLFA"
     gene            12456..13283
                     /locus_tag="HPSH112_RS00090"
                     /old_locus_tag="HPSH112_00065"
     CDS             12456..13283
                     /locus_tag="HPSH112_RS00090"
                     /old_locus_tag="HPSH112_00065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001154896.1"
                     /translation="MQEFLGFGVVGNFAGHLEQAGESHSFINMKSEEKDAPKGLFPFY
                     IPYENCYLGRCCIDNHKIILPNDPNLRVQAEPEIALECDVKYDEKHFVTKLVPNFFMA
                     FNDTSVRNLDATKLSQKKNFSPASKGMGKKLPIDRFVYGGVCNNFSIASFLKYNNVWR
                     IYGENSKLIKYEFFYQKLLDWIKDRLNYQQDGDSLEALRPFLEHHNFPTKMIFAIGAT
                     PYMPFAQEHFLQKGDEVAIVAYNHLQYSFEKIQNLLEENALQTKEHANLSYVYQIVE"
     gene            13431..13712
                     /locus_tag="HPSH112_RS00095"
                     /old_locus_tag="HPSH112_00070"
     CDS             13431..13712
                     /locus_tag="HPSH112_RS00095"
                     /old_locus_tag="HPSH112_00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001272686.1"
                     /translation="MSAHFLKIIFLVGMCVSSLFAEGLEGFFNALEAQLKSPIAKGIL
                     MVIFIGIAIYVWRNLDRWKEILFTILGVVFGIFLFFKAPSLANWFMGIF"
     gene            13712..13975
                     /locus_tag="HPSH112_RS00100"
                     /old_locus_tag="HPSH112_00075"
     CDS             13712..13975
                     /locus_tag="HPSH112_RS00100"
                     /old_locus_tag="HPSH112_00075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000584955.1"
                     /translation="MIILSASVKNLREISVKEKFLWLNAKSYLISVFAPFILLPWIDL
                     LSAFLLYLGFLALFSVLEFFDEDIADIIIARSKIKTKTKCYRA"
     gene            13977..16340
                     /locus_tag="HPSH112_RS00105"
                     /old_locus_tag="HPSH112_00080"
     CDS             13977..16340
                     /locus_tag="HPSH112_RS00105"
                     /old_locus_tag="HPSH112_00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VirB4 family type IV secretion/conjugal transfer
                     ATPase"
                     /protein_id="WP_000890504.1"
                     /translation="MLEKLLSAIKQKVSNYFLGVLPKSYSMSEENNILGLYDEHFLLT
                     KNENLVGILRLEGVSYTHLSTEQLQDLFTERQMALDSLEKVVARLVVKRRKIDHQQNI
                     QSDSKYLQAILNQFENKEVYENQYFLVLESAHSLQGVLEHKKKSLMHANRENFKDILS
                     YKAHFLQETLKSLEIQLKNYAPKLLSSKEVLNFYAEYINGFDLPLKPLVGGYLSDSYI
                     ASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIAIGALLYQETPLDIIFSIEP
                     MSVNKTLSFLKERAKFSMSNLVKNELLEYQELVKTKRLSMQKFALNILIKAPSLEDLD
                     AQTSLVLGLLFKENLVGVIETFGLKGGYFSFFPERIHLNHRLRFLTSKALACLMVFER
                     QNLGFKANSWGNSPLSVFKNLDYSPFLFNFHNQEVSHNNAKEIARVNGHTLIIGATGS
                     GKSTLISFLMMSALKYQNMRLLAFDRMQGLYSFTKFFKGHYHDGKSFSINPFCLEPNL
                     QNLEFLQSFFLSMFDLAPSRDKEALEDMNAISGAIKSLYETLYPKDFSLLDFKETLKR
                     TSSNQLGLSLEPYLNNPLFNALNDAFNSNAFLNVINLDTITQNPKDLGLLAYYLFYKI
                     LEESRKNDSGFLVFLDEFKSYVENDLLNAKINALITQARKANGVVVLALQDIYQLSGV
                     KNAHSFLSNMGTLILYPQKNARELKHHFNVPLSETEISFLENTPLYARQVLVKNLGNR
                     SSNMIDVSLESLGRYLKIFNSDSSHVNKVKALQKDYPTEWREKLLKS"
     gene            complement(16390..16487)
                     /gene="ffs"
                     /locus_tag="HPSH112_RS08120"
     ncRNA           complement(16390..16487)
                     /ncRNA_class="SRP_RNA"
                     /gene="ffs"
                     /locus_tag="HPSH112_RS08120"
                     /product="signal recognition particle sRNA small type"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00169"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00169"
     gene            16592..18001
                     /locus_tag="HPSH112_RS00110"
                     /old_locus_tag="HPSH112_00085"
     CDS             16592..18001
                     /locus_tag="HPSH112_RS00110"
                     /old_locus_tag="HPSH112_00085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000689517.1"
                     /translation="MKIFVLLMSVILGVSLTGCIGYRMDLEHFNTLYYEESPKKAYEY
                     SKQFTKKKKNALLWDLQNGLSALYARDYKTSLGVLDQAEQRFDKTQSAFTRGAGYVGA
                     TMINDNVRAYGGNIYEGVLINYYKAIDYMLLNDSANARVQFNRANERQRRAKEFYYEE
                     VQKAIKEIDSSKKHNINMERSRAEVSEILNNTYSNLDKYEAYQGLLNPAVSYLSGLFY
                     ALNGDKNKGLGYLNEAYGISQSPFVAKDLVFFKNPNRSYFTWIIIEDGKEPQKSEFKI
                     DVPIYAIDSIYNVSVALPKLEKGEAFYQNFTLKDGEKVTPFDTLASIDAVVSSEFRKQ
                     LPYIITRAILSATFKVGMQAVANYYLGFVGGLVTSLYSGVSTFADTRNTSIFAHKIYL
                     MRIKNKAFENYEVQADSIDAFSFSLKPCKRSLENPKVIDARELLSGFVTAPQIFCSNR
                     HNILYVRSFKNGFVLNRLK"
     gene            18097..19062
                     /locus_tag="HPSH112_RS00115"
                     /old_locus_tag="HPSH112_00090"
     CDS             18097..19062
                     /locus_tag="HPSH112_RS00115"
                     /old_locus_tag="HPSH112_00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheV"
                     /protein_id="WP_000132343.1"
                     /translation="MTDSLAGIDQVTSLHKNNELQLLCFRLGKNKGLYAVNVFKIREV
                     VKYHGNLTVISHENNSLVEGLIIIRELTIPLIDMKKWFYYDSQNKNKDLRPYRIEKEK
                     GEDDIVMICEFSRWTIGVRIYEADRILSKKWTEMEQSAGLGGSAGNNKLVSRTRYFDG
                     RLVQVVDIEKMLIDVFPWIEDEKHSDLETLSKIHSNQCVLLADDSPSVLKTMQMILDK
                     LGVKHIDFINGKTLLEHLFNPTTDVSSIGLIITDLEMPEASGFEVIKQVKNNPLTSKI
                     PIVVNSSMSGSSNEDMARSLKADDFISKSNPKDIQRVVKQFLESA"
     gene            19059..20276
                     /locus_tag="HPSH112_RS00120"
                     /old_locus_tag="HPSH112_00095"
     CDS             19059..20276
                     /locus_tag="HPSH112_RS00120"
                     /old_locus_tag="HPSH112_00095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxynorspermidine decarboxylase"
                     /protein_id="WP_000760883.1"
                     /translation="MKKYSAIPTPCYVLESERLEKNAKILEIVRQQSGAKVLLALKGY
                     AFWREFGILRQKLNGCCASGLYEAKLAFEEFGGRESRKEICVYSPAFKEAEMSAILPL
                     ATSIIFNSFYQYATYKDRILDKNKQLENLGLSPIKMGLRINPLYSEVTPAIYNPCSKV
                     SRLGVTPSEFEKGVKEHGLEGVSGLHFHTHCEQNADALCRTLEHVERHFKPYLENMEW
                     VNFGGGHHITRSDYDVNLLIQTIKDFKERYHDIEVVLEPGEAIGWQCGFLIASVIDIV
                     KNDQEIAILDASFSAHMPDCLEMPYRPSILKVSVENDEELVEVEKGENQGAFSYFLGG
                     PTCLAGDFMGSFSFETPLKRGDKIVFQDMLHYTIVKNNSFNGVPLPSLARLDQQGFKI
                     LKNFSYEDYKNRN"
     gene            complement(20286..20858)
                     /locus_tag="HPSH112_RS00125"
                     /old_locus_tag="HPSH112_00100"
     CDS             complement(20286..20858)
                     /locus_tag="HPSH112_RS00125"
                     /old_locus_tag="HPSH112_00100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206823.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A 1-phosphatase LpxE"
                     /protein_id="WP_000819544.1"
                     /translation="MKRFLFKQKFCESLPKSFSKTLLALSLGLILLGIFAPFPKVPKH
                     KSVPLVFHFTEHYARFIPTILSVAIPLIQRDAIGLFQVANASIATTLLTHTTKRALNN
                     ATINDQRLGERPYGGNFNMPSGHSSMVGLAVAFLMRRYSFKKYWWLLPLVPLTMLARI
                     YLDAHTTGAVLAGLGIGMLCVSLFTSPKKP"
     gene            complement(20869..22440)
                     /locus_tag="HPSH112_RS00130"
                     /old_locus_tag="HPSH112_00105"
     CDS             complement(20869..22440)
                     /locus_tag="HPSH112_RS00130"
                     /old_locus_tag="HPSH112_00105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000202333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoethanolamine--lipid A transferase EptA"
                     /protein_id="WP_000188062.1"
                     /translation="MTPLFHLKFLKPLSCLQAGLLYSLIFGVLYHFPLFAYVYKESNQ
                     VSFIAMIVVVLFCVNGTLFLTLGLISIHLMRLSAIVFSLLNSIAFYFISAYGVFLNKS
                     MMGNVLNTNTHELLGFLSVKLFIVIVVFGVLPGYVIYKIPLKNSSKKAPFLAILALVF
                     IFIASALMNAKNWLWFDKHAKFIGGLILPFAYSVNAFRVSALKFFAPTIKPLPLFSPN
                     RSHSFVVLVIGESARKHNYALYGYKKPTTPKLSKRLADNELTLFDAISCATYTTASLE
                     CILDSSFKNSLNAYENLPTYLTKAGIKVFWYSANDGEKNVKVTSYLKNYELIQKCPNC
                     EAIAPYDESLLYNLPDLLKEHSNENVLLILHLAGSHGPNYDNKVPLNFRVFKPYCSSA
                     DLSSCSKESLINAYDNTIFYNDYLLDKIISMLKNAKQPALMIYLSDHGESLGEGAYYL
                     HGIPKSIAPKEQYEIPFIVYANEPFKEKHSIIQTQTPINQNVVFHSILGVFEDFKNPS
                     AVYRPSLDLLKHKKE"
     gene            complement(22806..24869)
                     /locus_tag="HPSH112_RS00140"
                     /old_locus_tag="HPSH112_00115"
     CDS             complement(22806..24869)
                     /locus_tag="HPSH112_RS00140"
                     /old_locus_tag="HPSH112_00115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000726391.1"
                     /translation="MKKKFLSLTLGSLLVSTLSAEDNGFFVSAGYQIGESSQMVKNTK
                     GIQDLSDSYERLNHLLTSYSALNTLIRQSTDSNAINNARTNLDASAKNLISDKASSPA
                     YQAVLLALNAAAGLWQVMSYAISPCGPGKDSNKNGGVQTFENTPTNQWGGTTITCNTT
                     GYEPGPYSIISTENYAKINKAYQIIQKAFGASGKDIPALSDTNTELKFTINGSNNSNN
                     NKEEIITKNNAQILLEQASTIITTLNSACPWINNGGKGGASSGSLWEGIHLKGDGSAC
                     GIFKNEISAIQDMIKNAQIAVEQSKIVATNAQNQDNLDTGKAFNPYKDADFSQSMFAN
                     ARAQVEILNRVQAVVKDFERIPAAFVKDSLGVCHEVQNGHLRGTPSGTVTSNTWGAGC
                     AYVGETVTNLKNSIAHFGDQAQQIHNAQDLAYTLANFSSQYKKLGEHYDSITAAISSL
                     PDAQSLQNVVSKKTNPNSPQGIQDNYYIDSNIHSQVQSRTQELGSNPFRRAGLIAAST
                     TNNGAMNGIGFQVGYKQFFGKNKRWGARYYGFVDYNHTYNKSQFFNASSDVWTYGVGS
                     DLLVNFINDKATKHNKISFGAFGGIQLAGTSWLNSQFVNLANVNNYYKAKINTSNFQF
                     LFNLGLRTNLARNKRRGADHSAQHGMELGVKIPTINTNYYSLLGTTLQYRRLYSVYLN
                     YVFAY"
     gene            complement(24866..25055)
                     /locus_tag="HPSH112_RS08125"
                     /pseudo
     CDS             complement(24866..25055)
                     /locus_tag="HPSH112_RS08125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014534524.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            25098..25316
                     /locus_tag="HPSH112_RS00145"
                     /old_locus_tag="HPSH112_00120"
     CDS             25098..25316
                     /locus_tag="HPSH112_RS00145"
                     /old_locus_tag="HPSH112_00120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001013135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001013135.1"
                     /translation="MNGGSYKKGVFNFDGFGFAVIYCKNDFLNFLKRGVLQPFFPKTQ
                     GFACKSGVKFWLHAVKLPLAWWRDASLL"
     gene            25267..25427
                     /locus_tag="HPSH112_RS08130"
                     /pseudo
     CDS             25267..25427
                     /locus_tag="HPSH112_RS08130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002205316.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
     gene            complement(25393..26673)
                     /locus_tag="HPSH112_RS00150"
                     /old_locus_tag="HPSH112_00125"
     CDS             complement(25393..26673)
                     /locus_tag="HPSH112_RS00150"
                     /old_locus_tag="HPSH112_00125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="citrate (Si)-synthase"
                     /protein_id="WP_000117393.1"
                     /translation="MSVTLINNENNERYEFETIECTRGPKAVDFSKLFETTGFFSYDP
                     GYSSTAGCQSKISYINGKKGELYYRGHRIEDLVAKYKYVDVCKLLLTGELPKNQEESL
                     EFELELRHRSFVHESLLNMFSAFPTNAHPMAKLSSGVSILSTLYSTHQNMHTEEDYQT
                     MARRIVAKIPTLAAICYRNEVGAPIIYPDIARSYVENILFMLRGYPYSRLKHTTQGEV
                     EITPLEVEAFDKILTLHADHSQNASSTTVRNVASTGVHPYAAISAGISALWGHLHGGA
                     NEKVLLQLEEIGDVKNVDKYIARVKDKNDNFKLMGFGHRVYKSYDPRAKILKGLKDEL
                     HQKGVKMDERLSEIAAKVEEIALKDEYFIERNLYPNVDFYSGTILRALKIPVRFFTPV
                     FVIGRTVGWCAQLLEHVKSPQARITRPRQVYVGD"
     gene            26871..28148
                     /locus_tag="HPSH112_RS00155"
                     /old_locus_tag="HPSH112_00130"
     CDS             26871..28148
                     /locus_tag="HPSH112_RS00155"
                     /old_locus_tag="HPSH112_00130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase (NADP(+))"
                     /protein_id="WP_000323965.1"
                     /translation="MAYNPKILQKPKEGEEITIKDNKLHVPNHPIIPFIEGDGIGSDI
                     TPAMIKVVDSAVQKAYKGEKKIAWYEVFVGEKCYQKFKDHKELSPEEQWLLPDTIEAI
                     NHYKVSIKGPLTTPIGEGFRSLNVALRQKMDLYVCLRPVRWYGSPSPVKEPQKVDMVI
                     FRENSEDIYAGIEWQEGSAEAKKLIHFLQNELKVKKIRFPESSGIGVKPISKEGTERL
                     VRKAIEYAIDNDKPSVTFVHKGNIMKYTEGAFMKWGYALAQKEFNAQVIDKGPWCSLK
                     NPKTGKEIIIKDMIADAFLQQILLRPSEYSVIATMNLNGDYISDALAAMVGGIGIAPG
                     ANLNDTVGMFEATHGTAPKYAGLDKVNPGSIILSAEMMLRHMGWVEAADLIVSAMEKA
                     IKGKKVTYDFARLMDGAKEVKCSEFASVMIENM"
     gene            28214..28747
                     /locus_tag="HPSH112_RS00160"
                     /old_locus_tag="HPSH112_00135"
     CDS             28214..28747
                     /locus_tag="HPSH112_RS00160"
                     /old_locus_tag="HPSH112_00135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000766920.1"
                     /translation="MKLIKFVRNVVLFILTAIFLALMLLVSYCMPHYSAAVISGVEVK
                     RMNENENTPNNKEVKTLARDVYFVQTYDPKDKKSVTVYRNEDTRFSFPFYFKFNSADI
                     SALAQSLVNQQVEVKYYGWRINLFNMFPNVIFLKPLKESADISKPIFSWILYALLLMG
                     FFISVSSVCTLFKSKAH"
     gene            complement(28724..29380)
                     /locus_tag="HPSH112_RS00165"
                     /old_locus_tag="HPSH112_00140"
     CDS             complement(28724..29380)
                     /locus_tag="HPSH112_RS00165"
                     /old_locus_tag="HPSH112_00140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="WP_000897556.1"
                     /translation="MLFISATNTNAGKTTCARLLAQYCNACGVRTILLKPIETGVNDT
                     TNHFSDAHLFLQDNRLLDRSLTLKDISFYRYAKASAPLIAQQEENQNAPIDTNDLIQR
                     LQNFTKTYDLVIVEGAGGLCVPITLEENMLDLALKLKAKILVISHDNLGLINDCLLND
                     FLLKSHQLDYKIAINLRENNAAFHSVSLPYIKLFNERSNNPIVIFQQSLKELMSFALK
                     "
     gene            complement(29384..29677)
                     /locus_tag="HPSH112_RS00170"
                     /old_locus_tag="HPSH112_00145"
     CDS             complement(29384..29677)
                     /locus_tag="HPSH112_RS00170"
                     /old_locus_tag="HPSH112_00145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000034946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041199809.1"
                     /translation="MSKTLLAKVLANTTDTDASYCFISDLAVQLDNISPRVSKSIITA
                     QAESVRLTYALIDKVLYNSLHNILSFIFDNVKLPQTKNALTAQIFDGAYQFKG"
     gene            29883..30296
                     /locus_tag="HPSH112_RS00175"
                     /old_locus_tag="HPSH112_00150"
     CDS             29883..30296
                     /locus_tag="HPSH112_RS00175"
                     /old_locus_tag="HPSH112_00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein"
                     /protein_id="WP_001023005.1"
                     /translation="MNILFGISDTQECYNAIKFAVKLAHSLKEVRFTLLHVSMEVFIY
                     SESGMMDYGQTEALEEEKAKALLKQFEDAFKKENIECESVLKSGDLIDVVLDMAKDYD
                     LLLIGASESNLLYRLFISHQNSLVEQSSIPVVIAK"
     gene            30311..30586
                     /locus_tag="HPSH112_RS00180"
                     /old_locus_tag="HPSH112_00155"
     CDS             30311..30586
                     /locus_tag="HPSH112_RS00180"
                     /old_locus_tag="HPSH112_00155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206834.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease adaptor ClpS"
                     /protein_id="WP_000784856.1"
                     /translation="MKMYDIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQA
                     LTSSIHRDGEGVCGVYPYDIARHRAAWVRDKARELDLPLKLLVEEIR"
     gene            30586..32808
                     /locus_tag="HPSH112_RS00185"
                     /old_locus_tag="HPSH112_00160"
     CDS             30586..32808
                     /locus_tag="HPSH112_RS00185"
                     /old_locus_tag="HPSH112_00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_001051544.1"
                     /translation="MAKFNQDLNEVLNRALNLALDLNHALCTTEHVLLVILEHESGAK
                     MIGALERDDYDRLKQILKDYLLQYVPLKSDPAKMPARSFVLLRMLKRMYASGFESVGV
                     EELLILMLDHPDCYASKLMDSFGIARLYSNPALLDLDNHGIPNDTNNEEAPKNTPLKK
                     YAKNLSALAQDNALDPVIGREEEILRVIEILGRRKKNNPLLIGEAGVGKTSIAEALAL
                     KIVQKEVPEFLQEYEVYSLDLALMVAGAKYRGDFEKRLKKTLKEIQENGRIILFIDEI
                     HTLLGAGNTNAGSLDAANILKPVLTDGSLKCLGATTFEEYRSVFEKDKAFNRRFSVIK
                     VEEPSKEACYLILKKIAPLYEEHHQVRYDESVFKACVDLTSYYMHDRFLPDKAIELLD
                     EVGSRKKISPKKGKKISVDDVKEALAIKLKIPKMRLSSDKKALLRNLEKSLKNKIFAQ
                     AEAINLVSNAIKIQHCGLSAKNKPVGSFLFVGPSGVGKTELAKELALNLNLHFERFDM
                     SEYKEAHSVAKLIGSPSGYVGFEQGGLLVNAIKKHPHCLLLLDEIEKAHSNVYDLLLQ
                     VMDNATLSDNLGNQASFKHVILIMTSNVGSKDKDALGFFSAKNTKYDKAVRELLTPEL
                     RSRIDAIVPFNTLGLEDFERIVSVELDKLKALALEQDIALKFHKEVLKFIAQKSYQTT
                     LGAREIKKIIHNEIKTPLSNLLLLQSFKKPCKIACLLEKNQLVLKEIKRAQKVKENDF
                     "
     gene            32798..33148
                     /locus_tag="HPSH112_RS00190"
                     /old_locus_tag="HPSH112_00165"
     CDS             32798..33148
                     /locus_tag="HPSH112_RS00190"
                     /old_locus_tag="HPSH112_00165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="WP_000142269.1"
                     /translation="MTFEMLYSKIHRATITDANLNYVGSITIDEDLAKFAKLREGMKV
                     EIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKP
                     CIVLVDEKNEILEK"
     gene            33159..33452
                     /locus_tag="HPSH112_RS00195"
                     /old_locus_tag="HPSH112_00170"
     CDS             33159..33452
                     /locus_tag="HPSH112_RS00195"
                     /old_locus_tag="HPSH112_00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206837.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoid-associated protein, YbaB/EbfC family"
                     /protein_id="WP_000347917.1"
                     /translation="MDFSQLGGLLDGMKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNG
                     VGELVDLQIDDSLLEDKEAMQIYLMSALNDGYKAVEENRKNLAFNMLGNFAKL"
     gene            33452..34447
                     /locus_tag="HPSH112_RS00200"
                     /old_locus_tag="HPSH112_00175"
     CDS             33452..34447
                     /locus_tag="HPSH112_RS00200"
                     /old_locus_tag="HPSH112_00175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PDZ domain-containing protein"
                     /protein_id="WP_000468441.1"
                     /translation="MFHKALIILLVFLNGLGAYDFKHCQAFFKKASLQNGGVALKELP
                     KGVYLYYSKTYPKHAKVIKSDPFVGLYLLQSAPSEYFYTLRDLDKDALIRPMASIGDK
                     EAIEARLLSKQQGYDRYAQISQEIQKNGVISNICYQMLGLGVGGNGFIETKFIKHFLN
                     QKEPYYGDIGVRLEEDNKRLVVAQFDPFFPKNPFLKNDEILAINHQKIHSLAEFEWVV
                     SNLKYQSLVKVSIKRNHKIKEVTLKVNKRYGGFLLKDTFLERYGIALDKRFTITKIGS
                     HLPKGLDFLKLGDRILWVNRKNVASNPKALREALSVPKIELLVWREGFEFYIKVR"
     gene            34453..35508
                     /locus_tag="HPSH112_RS00205"
                     /old_locus_tag="HPSH112_00180"
     CDS             34453..35508
                     /locus_tag="HPSH112_RS00205"
                     /old_locus_tag="HPSH112_00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbL"
                     /protein_id="WP_000786694.1"
                     /translation="MKNDAYEIILSWFITPLTAILGRFAEFFLYTLHAQLVFNSVVAL
                     AFMLFAYRSLKEQNFFSTSALTEALLFVGFFALFNYALKNPMRFYEFFQNAIFIAPNM
                     IAQSLSQSLSNFSNHALSLDFIFNHGFYALSFISDLSHNEMSVWLFLSILQGLFLSVL
                     FAIIILVYLEVHVWCSLGVLFLAFGFFKTWRSVVVACLKKCFALGFYKPFLLLVGFLN
                     VSVTKALIDAHVQEKQDLSLLLVVALFLCCVFIIGVPFFINALFRVQNSFKETYKLAT
                     NLSANLSQNALNSLQYITTPPASSSVSASMSGGVSKEKETHSPTFKVETTQLDVKIPN
                     FKQKKVKKDTINTKNEI"
     gene            35524..35637
                     /locus_tag="HPSH112_RS00210"
     CDS             35524..35637
                     /locus_tag="HPSH112_RS00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001217870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001217864.1"
                     /translation="MRIFFVIIGIMLFGCTSKVHEMKKSPCTLYENRLNLA"
     gene            35634..36377
                     /locus_tag="HPSH112_RS00215"
                     /old_locus_tag="HPSH112_00185"
     CDS             35634..36377
                     /locus_tag="HPSH112_RS00215"
                     /old_locus_tag="HPSH112_00185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virB8 family protein"
                     /protein_id="WP_000660502.1"
                     /translation="MKEKPFNSEQLAFLEELLSHQEKHLENKLSGFSVSDLDMQSVFR
                     LERNRLKIAYKLLGLMSFIALILAIVLISVLPLQKTEHHFVDFLNQDKHYAIIQRADK
                     SISSNEALARSLIGAYVLNRESINRIDDKSRYELVRLQSSSKVWQRFEDLIKTQNSIY
                     AQSHLEREVHIVNIAIYQQDNNPIASVSIAAKLMNENKLVYEKRYKIALSYLFDTPDF
                     DYASMPKNPTGFKITRYSITEIAPTNRGD"
     gene            36377..37333
                     /locus_tag="HPSH112_RS00220"
                     /old_locus_tag="HPSH112_00190"
     CDS             36377..37333
                     /locus_tag="HPSH112_RS00220"
                     /old_locus_tag="HPSH112_00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014537031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein"
                     /protein_id="WP_014662053.1"
                     /translation="MRKVLYALVGFLLAFSALKADDFLEEANETAPANLNHPMQDLNA
                     IQGSFFDKNRSKMSNTLNIDYFQGQTYKIRLRYAMATLLFFSKPISDFVLGDKVGFDA
                     KILESNDRILLIKPLQIGVDSNVSVIDNEGKIFSFYVFSTTFTSSKHPNLQVFIEDKN
                     YYSNAFMKPQNKENTLENTPTNNSKPLKEETKEEETITIGDSTNAMKIVKKDIQKGYR
                     ALKSSQRKWYCLGICSKKSKLSLMPEEIFNDKQFTYFKFDKKLALSKFPVIYKVVDGY
                     DNPVNTRIVGDYIIAEDVSAKWTLRLGKDYLCIRFIKKGKDE"
     gene            37326..38462
                     /locus_tag="HPSH112_RS00225"
                     /old_locus_tag="HPSH112_00195"
     CDS             37326..38462
                     /locus_tag="HPSH112_RS00225"
                     /old_locus_tag="HPSH112_00195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001045855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001045868.1"
                     /translation="MNKWLKGALVFVGGFATIITISLIYHQKPKAPLNNQPNLLNDDE
                     VKYPLQDYTFTQNPQPTNTESSKDATIKALQEQLKAALKALNSKEMNSSKEETFNSPP
                     IDLKTNTTPPKKDFSLKQLDLLASRITPFKQSPKNYEENLIFPMDNPKGIDGFTNLKE
                     KDIATNENKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGS
                     KVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAKGADIKGYNGLVGELIERNFQ
                     RYGVPLLLSTLTNGLLIGITSALNNRGNKEYATNFFGDYLLLQLMRQSGMGINQVVNQ
                     ILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPKENEVIAEFLK"
     gene            38534..39946
                     /locus_tag="HPSH112_RS00230"
                     /old_locus_tag="HPSH112_00200"
     CDS             38534..39946
                     /locus_tag="HPSH112_RS00230"
                     /old_locus_tag="HPSH112_00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000694850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase"
                     /protein_id="WP_000694836.1"
                     /translation="MKIKNILLSGGSGKRLWPLSRSLYPKQFLKLFGNESLFELSFKR
                     NASLVDETLIVCNEKHYFLALEEIESEIKNKSVGFLLESLSKNTANAIALSALMSERE
                     DSLIVTPSDHLIKDIQAYGNAIKKAIDLAQKGFLVTFGINIEKPNTEFGYIESPNGLD
                     VKHFIEKPSLEKAIEFQKSGGFYFNSGMFVFQAGVFLDELKKHAPTILKGCERAFESL
                     ERASFFEKKIARLSEKSMQDLEDVSVDIALMQQSHKIKMVGLNAKWSDLGNFNALFEE
                     VANDPKENVSLNQTPVFAKESQNNLVFSHKVSALLGVENLAIIDTKDALLIAHKDKAK
                     DLKALVSEVEANNQELLQTHTKVYRPWGSYEVLHESGCYKVKILEVKPNARLSLQKHF
                     HRSEHWVVISGMASVELDRQSFELQANESTYIPKNTLHRLANYGKIPLTIIEVQVGEY
                     VGEDDIVRVDDDFNRQNQGK"
     gene            39961..41106
                     /locus_tag="HPSH112_RS00235"
                     /old_locus_tag="HPSH112_00205"
     CDS             39961..41106
                     /locus_tag="HPSH112_RS00235"
                     /old_locus_tag="HPSH112_00205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="WP_000659844.1"
                     /translation="MKEKIALITGVTGQDGSYLAEYLLNLGYEVHGLKRRSSSINTSR
                     IDHLYEDLHSEHKRRFFLHYGDMTDSSNLIHLIATTKPTEIYNLAAQSHVKVSFETPE
                     YTANADGIGTLRILEAMRILGLEKKTRFYQASTSELYGEVLETPQNENTPFNPRSPYA
                     VAKMYAFYITKNYREAYNLFAVNGILFNHESKVRGETFVTRKITRAASAIAYNLTDCL
                     YLGNLDAKRDWGHAKDYVKMMHLMLQAPIPQDYVIATGKTTSVRDFVKMSFEFIGISL
                     EFQNTGVKEIGLIKSVDEKRANALKLNLSHLKTGQIVVRIDERYFRPTEVDLLLGDPT
                     KAEKELGWVREYDLKELVKDMLEYDLKECQKNLYLQDGGYILRNFYE"
     gene            41099..42031
                     /locus_tag="HPSH112_RS00240"
                     /old_locus_tag="HPSH112_00210"
     CDS             41099..42031
                     /locus_tag="HPSH112_RS00240"
                     /old_locus_tag="HPSH112_00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-fucose synthetase"
                     /protein_id="WP_001002520.1"
                     /translation="MNEIILITGAYGMVGQNTALYLKKNKPDVTLLTPKKSELYLLDK
                     DNVQAYLKEYKPTGIIHCAGRVGGIVANMNDLSAYMVENLLMGLYLFSSALDLGVKKA
                     INLASSCAYPKFAPNPLKESDLLNGSLEPTNEGYALAKLSVMKYCEYVSAEKGVFYKT
                     LVPCNLYGEFDKFEEKIAHMIPGLIARMHTAKLKNEKEFAMWGDGTARREYLNAKDLA
                     RFISLAYENIASIPSVMNVGSGVDYSIEEYYKMVAQVLDYKGAFVKDLSKPVGMQQKL
                     MDISKQKALKWELEIPLEQGIKEAYEYYLKLLEV"
     gene            complement(42309..43307)
                     /locus_tag="HPSH112_RS00245"
                     /old_locus_tag="HPSH112_00220"
     CDS             complement(42309..43307)
                     /locus_tag="HPSH112_RS00245"
                     /old_locus_tag="HPSH112_00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein HypE"
                     /protein_id="WP_000378782.1"
                     /translation="MDSVTLACGNGGKETNALIERVFMPYLKEFIVAFDEDAPKFEAS
                     GEYCVSTDSFVITPLIFNGGDIGKLCVCGSANDVSVQGGEPLYLNMGFILEEGLEIPL
                     LKQILQSIQKELLKANLKLLSLDTKVVPKGSVDKLFINTTCIGKTIKPGISSRHLKQD
                     QAIIISDTIANHGASLFAMRHEIKLKTNLESDCQLLYPLLKPLFLSDLKIHALRDATR
                     GGLASVLNEWANSSKVKIVIEEEKIPLKEETKGICEILGLEPYALANEGVFVLAINQK
                     DAPKALEILKSNEKAKNACVIGGVFENPYPSVVLKNAWGFERILEMPEGELLPRIC"
     gene            complement(43310..45619)
                     /locus_tag="HPSH112_RS00250"
                     /old_locus_tag="HPSH112_00225"
     CDS             complement(43310..45619)
                     /locus_tag="HPSH112_RS00250"
                     /old_locus_tag="HPSH112_00225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206849.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbamoyltransferase HypF"
                     /protein_id="WP_001199225.1"
                     /translation="MQYFNQTAWKLALCNDATLLNKITLFGVVQGVGMRPFIYTLAQK
                     LELVGFVRNTQAALEIVLPAHKTESFLNALKKGLPPLALVEKIIISPYDKTLKSNGFR
                     ILESKNHPLNLLSQIPKDLGVCEDCLREIRDKNSPYFHYAFNSCAKCGARYSLLNALP
                     YDRENSALKPFKLCEFCAFVYKDANNKRFHIQGISCKKCGITLSYKRFKNDDALLECA
                     KDIQKGKIIALKGLGGFALLCDARNFQTIERLRLLKNRPLKPFALMFKDLNTAKQHAF
                     LSVLECESLNSTSAPILLARKKPDTQLAPNIAKNSPFYGVILPYTPLHALLLDLLDFP
                     IIFTSANFSSLPLASDEAEIDSLSFIFDFKLTHNRAIIHRIDDSIAQHVDNAIRPMRL
                     ARGFAPLYLTLPKRSNDSQKKILALGAEQKGHFSLLDSETSILLLSPFCGDLSVLENE
                     KHFKETLNFFLKTYDFKPTILVCDKHQNYTTTQMACGFNTPLLQVQHHHAHFLASILD
                     ALLQDPHLNHPFIGIVWDGSGAYENKIYGAECFVGDFERIEETARFEEFLLLGGEKAI
                     KEPKRLVLEIALKHQLNKLLKRVQKHFKEDELEIFQQMHDRGIQSIATNSIGRLFDIV
                     AFSLDLVGTISFEAESGQVLENLALQSDEIAFYPFKIKNSVVCLKDFYQAFEKDLGVL
                     EPERIAKKFFNSLVEIITALIAPFKEHVVVCSGGVFCNQLLCEQLAKRLRGLKRQYFF
                     HKHFPPNDSSIPIGQALMAYFNPTIIKKG"
     gene            complement(45559..46551)
                     /locus_tag="HPSH112_RS00255"
                     /old_locus_tag="HPSH112_00230"
     CDS             complement(45559..46551)
                     /locus_tag="HPSH112_RS00255"
                     /old_locus_tag="HPSH112_00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206850.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="agmatine deiminase"
                     /protein_id="WP_000827214.1"
                     /translation="MKRMLAEFEKIQAILMAFPHEFGDWAYCIKEARESFLNIIQTIA
                     KHAKVLVCVHTNDTIGYETLKNLPGVEIARIDTNDTWARDFGAISIENHGVLECLDFG
                     FNGWGLKYPSNLDNRVNFKLKNLGFLKHPLKTMPYILEGGSIESDGAGSILTNTQCLL
                     EKNRNPHLNQHEIENMLKKELGAKQVLWYSYGYLKGDDTNSHTDTLARFLDKDTIVYS
                     ACEDKNDEHYTALKKMQEELKTFKKPDKTPYKLIPLEIPKAIFDENQQRLPATYVNFL
                     LCNDALIVPTYNDPKDALILETLKQHTPLEVIGVDCNTLIKQHGSLHCVTMQLY"
     gene            complement(46603..47301)
                     /locus_tag="HPSH112_RS00260"
                     /old_locus_tag="HPSH112_00235"
     CDS             complement(46603..47301)
                     /locus_tag="HPSH112_RS00260"
                     /old_locus_tag="HPSH112_00235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_000614655.1"
                     /translation="MIQIHHANAFEIIKDFYQQNLKVDAIITDPPYNISVKNNFSTLK
                     SAKRQGIDFGEWDKNFRLLEWIKRYAPLVNPNGCMVIFCSYRFISYIVDFLEENGFVV
                     KDFIQWVKNNPMPRNINRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVV
                     GGLERVKHPTQKSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKHLKRNFIGIESE
                     REYFQIAKKRLNLF"
     gene            complement(47298..>48194)
                     /locus_tag="HPSH112_RS00265"
                     /old_locus_tag="HPSH112_00240"
                     /pseudo
     CDS             complement(47298..>48194)
                     /locus_tag="HPSH112_RS00265"
                     /old_locus_tag="HPSH112_00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206852.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
     gene            complement(48218..49717)
                     /locus_tag="HPSH112_RS00270"
                     /old_locus_tag="HPSH112_00245"
     CDS             complement(48218..49717)
                     /locus_tag="HPSH112_RS00270"
                     /old_locus_tag="HPSH112_00245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium/proline symporter"
                     /protein_id="WP_000510289.1"
                     /translation="MGHVVLSTPIVTMFVAYSLLMLYIGFYFYRQNETTADYFLGDRS
                     MGPIISALSAGASDMSGWLLMGLPGALYVGGLINSHIAIGLSLGALINWVFVAKRLRI
                     YTSVIANSITISDYFETRFSDDKHILRLISAFVILIFFIFYISSGLVSGAKLFEATFG
                     IQYTYALSIGTLIIVSYTFLGGYKAVCWTDLIQGLLMMSALIVVPIVMIIHLGGIGEG
                     IKIIREIKPENLSFLQGSSMVAIISSLAWGLGYFGQPHILVRFMSIRSIKDVPKATTI
                     GISWMVISLIGACVMGLLGVAYAHKFDLSLEDPEKIFIVMSQLLFNPWITGILLSAIL
                     AAVMSTASSQLLVSSSTIAEDFYATIFNKDAPQKLVMVISRLSVLGVACIAFFISTDR
                     NASILSIVSYAWAGFGASFGSVILFSLFWSRMTRIGAIAGMLSGASTVILYDKFGKSF
                     LDIYEIVPGFIVASIAIVVFSLFSSVRAGTKEAFETMLKEIKEIESLKY"
     gene            complement(49744..53301)
                     /locus_tag="HPSH112_RS00275"
                     /old_locus_tag="HPSH112_00250"
     CDS             complement(49744..53301)
                     /locus_tag="HPSH112_RS00275"
                     /old_locus_tag="HPSH112_00250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="WP_001169360.1"
                     /translation="MQKIIDDSLELAKKLQDSISNHLSEQEKAFHSKMQKLLNNPENK
                     VMLIELMDRSFRCLDNKARFEMIEHVLDKYKSREIFSSFEKLLLMGFLSFGKMLPDMS
                     VPFFVNKIRSDTKAMVLDQEESQLKERILKRKNEKIILNVNFIGEEVLGEEEASARFE
                     KYSQALKSNYIQYISIKITTIFSQINILDFEYSKKEIVKRLDALYALALEEEKKQGMP
                     KFINLDMEEFRDLELTVESFMESIAKFDLNAGIVLQAYIPDSYEYLKKLHAFSKERVL
                     KGLKPIKIRFVKGANMESEETIASVKDWALPTFSNKQDTDSNYNKMLDFVLEGDNYKY
                     IHIGAASHNIFEIAYVYTRIHALNDPVVLEHFSFEMLEGMSLQASQELKEMHKLILYA
                     PVCDEAHFNNAIAYLVRRLDENTSSDNFMKAFFNLKVGTSEWEDQEQRFLNSLKGIAT
                     LDNATHRTQDRNAKQSGHTTYPNHSFKNESDTDFILKANREWAKKVREKMHNAPILEL
                     YPEMDGRFEDPNLTPLEVFDKIHHKKIASVHLADREAILKALEVAKSDKNRFSQKSFT
                     EIHALMSQTAQIFRERRGDLIGISALEVGKTFAETDAEVSEAIDFLEFYPYSLRVLQE
                     QNKKTKFTPKGVGVVIAPWNFPVGISVGTIAAPLAAGNRVIYKPSSLSSVTGYKLCEC
                     FWDAGVPRDALIYLPSKGSDISEHLLKDESIKFAILTGGEDTAYKMLEANPTLALSAE
                     TGGKNATIVSKMADRDQAIKNVIHSAFSNSGQKCSATSLLVLEKEVYEDENFKKTLID
                     ATLSLSVGDPFDFKNKIGTLADKPNEKVIKAIDELKSYENYEIPVSFVNDNPYLMKPS
                     IKYGTKKGDFTHQTELFTPILSVMKAQDLDEAIDIVNSTGYGLTSALESLDEREWEYY
                     LKRIEAGNIYINKPTTGAIVLRQPFGGVKKSAVGFGRKVGIFNYITQFVNIHQEEEDE
                     NALKNPLSEALEGLTQKGYDEHTHELRRAIFMAKSYAYHYKHEFSQAKDYVKIRGEDN
                     LFSYTKVKSVGYRITEKDTLSDMLGVALACLISQIPLTLSIENERANKDLSFFLECLK
                     ALRANAPIVYESLQKFSEKLNAFNRVRYLKSDLDLLHEQASALGIVLATAKPCLNGRF
                     ELLYYHLERSVSISYHRYGNLGSRVLRQPTCHKSCCAEK"
     gene            53629..53838
                     /locus_tag="HPSH112_RS00280"
                     /old_locus_tag="HPSH112_00255"
     CDS             53629..53838
                     /locus_tag="HPSH112_RS00280"
                     /old_locus_tag="HPSH112_00255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000848994.1"
                     /translation="MKTIKNGIMIGTLGALLLSGCSSFDAQRFACLPKDHSLKDASTK
                     KEVQYTPKGFFDPYSSNLNHWDSTF"
     gene            54378..55205
                     /locus_tag="HPSH112_RS00285"
     CDS             54378..55205
                     /locus_tag="HPSH112_RS00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000992785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000992785.1"
                     /translation="MNALKNSQQVLENEKAELKTEKDNLTKANAELKTEKERLTKEKT
                     ELTEKNKELDDQVGLLKGQIKSLEQSQQVLKNENTDLDNKITDLSKENQNLTKEKTEL
                     TEKNQKLTTEKDNLTTDLSNAKIQAIQANQEKDKLEQKHAPYKKLEKLYEVFLEVKGC
                     LNFNFVEKTHSAMDLIASVLSDSKYYLESLYNKASQELSDRKSDKGEKLAELFDLLFE
                     YVKDNKFERLKEPSAYDPTCKKLYPEQNTSGKMQRVVLIGYTYDKKTTHYTIVDMGS"
     gene            55207..56031
                     /locus_tag="HPSH112_RS00290"
                     /old_locus_tag="HPSH112_00270"
     CDS             55207..56031
                     /locus_tag="HPSH112_RS00290"
                     /old_locus_tag="HPSH112_00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000536430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000536429.1"
                     /translation="MGTFIEKCFGFYQVREELEARISELEDENENLINENTRLLASKE
                     QLTKENTELLREKDNLIKENTELKTDKDNLNNQLNASQMQVNELKNAHQVLEKEKDEL
                     LKDKDNLTKEKAELTEKNQKLTTEKDNLTKANAELKKENDKLNHQVIALTKEQDSLKY
                     EKELCANLEKDNQQLTDKLKKLESAQKNLENSKNQLLQAREKIAKENTELEREMARLK
                     SLEATDKSELDLQNRRFKSAIEDLKRQNRKLEEENIALKERVDGLKEQLSKQPKPQ"
     gene            56043..58480
                     /locus_tag="HPSH112_RS00295"
                     /pseudo
     CDS             56043..58480
                     /locus_tag="HPSH112_RS00295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206860.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            58477..59040
                     /locus_tag="HPSH112_RS00300"
                     /old_locus_tag="HPSH112_00285"
     CDS             58477..59040
                     /locus_tag="HPSH112_RS00300"
                     /old_locus_tag="HPSH112_00285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000628956.1"
                     /translation="MITKNAYAFVVIEEKVMAFKQDKGLIPIFEGFVPLKEGFLKHFK
                     ERCNLEFLESLDLLFLYDKPSAHEIFSLCKELKNSIWDRKLVVALVEALEGFKDWNLS
                     LKIEDKRSNSLGNGAKKLLTNADLESSHQKIVIDSMKTYHQSQQEKYKRERGQVKETP
                     AQTPPSYGGGSIRISGDKKPDSNEENF"
     gene            59056..59316
                     /locus_tag="HPSH112_RS00305"
                     /old_locus_tag="HPSH112_00290"
     CDS             59056..59316
                     /locus_tag="HPSH112_RS00305"
                     /old_locus_tag="HPSH112_00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206862.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000049126.1"
                     /translation="MSKVQMDTEEVREFVNHLERFKELLNDEVNGLSSHFNNLDSWQD
                     ARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDY"
     gene            59326..61120
                     /locus_tag="HPSH112_RS08135"
                     /pseudo
     CDS             59326..61120
                     /locus_tag="HPSH112_RS08135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000852796.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="5-methyltetrahydrofolate--homocysteine
                     methyltransferase"
     gene            61090..61515
                     /locus_tag="HPSH112_RS00320"
                     /old_locus_tag="HPSH112_00305"
     CDS             61090..61515
                     /locus_tag="HPSH112_RS00320"
                     /old_locus_tag="HPSH112_00305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein"
                     /protein_id="WP_000447915.1"
                     /translation="METIPTNSELNWEFVEPLNDNALSGLEDQLKMGLSDAFKDFVKR
                     SNYGFSQWRSFMVGNKSYTFKHVLNFNLEGKGLFIDFMKSLKEWLKPEEIIFANDGYG
                     GYYLLNTASGVALFLDTDDGSKHALLHLKMFLKKLESRG"
     gene            61517..61867
                     /locus_tag="HPSH112_RS00325"
                     /old_locus_tag="HPSH112_00310"
     CDS             61517..61867
                     /locus_tag="HPSH112_RS00325"
                     /old_locus_tag="HPSH112_00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015086736.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000491338.1"
                     /translation="MFSHKVYLEGCTLELRKICDDFAENAMQDDLGQKLRDEVLEDML
                     KIAHDLENLEQDTQYQRRRIDEQIEEAKSLMKKIDMNFHSQSEIDKLMREAKEHEKEA
                     NRRYDEYLKSKDKE"
     gene            61864..64290
                     /locus_tag="HPSH112_RS00330"
                     /pseudo
     CDS             61864..64290
                     /locus_tag="HPSH112_RS00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000570112.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
     gene            complement(64360..65157)
                     /locus_tag="HPSH112_RS00335"
                     /old_locus_tag="HPSH112_00325"
     CDS             complement(64360..65157)
                     /locus_tag="HPSH112_RS00335"
                     /old_locus_tag="HPSH112_00325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein"
                     /protein_id="WP_001099459.1"
                     /translation="MNTYAQESKLRLKTKIGADGRCVIEDNFFTPPFKLMAPFYPKDD
                     LAEIMLLAVSPGMMRGDAQDMQLNIGPNCKLRITSQSFEKIHNTEDGFASREMHIVVG
                     ENAFLDFAPFPLIPFENAHFKGNTTISLHSSSQLLYSEIIVAGRVARNELFQFNRLHT
                     KISILQDEKPIYYDNTILDPKTTNLNNMCMFDGYTHYLNLVLVNCPIELSGVRECIGE
                     NEGVDGAVSEIASSHLCVKALAKGSEPLLHLREKIARSITQTITQKI"
     gene            complement(65157..65756)
                     /locus_tag="HPSH112_RS00340"
                     /old_locus_tag="HPSH112_00330"
     CDS             complement(65157..65756)
                     /locus_tag="HPSH112_RS00340"
                     /old_locus_tag="HPSH112_00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000238757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreG"
                     /protein_id="WP_000238747.1"
                     /translation="MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDA
                     EFMCKNSVMPRDRIIGVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGD
                     NLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM
                     ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED"
     gene            complement(65785..66501)
                     /locus_tag="HPSH112_RS00345"
                     /old_locus_tag="HPSH112_00335"
     CDS             complement(65785..66501)
                     /locus_tag="HPSH112_RS00345"
                     /old_locus_tag="HPSH112_00335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015428540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreF"
                     /protein_id="WP_080024735.1"
                     /translation="MPPKTPKDNNAHVDNEFLILQVNDAVFPIGSYTHSFGLETYIQQ
                     KKVTNKESALEYLKANLSSQFLYTEMLSLKLTYESTLQQDLKKILGIEEIITLSTSPM
                     ELRLANQKLGNRFIKTLQAMNELDMGEFFNAYAQKTKDPTHATSYGVFAASLGIELKK
                     ALRHYLYAQTSNMVINCVKSVPLSQNDGQKILLSLQSPFNQLIEKTLELDESHLCVAS
                     VQNDIKAMQHESLYSRLYMS"
     gene            complement(66557..67069)
                     /locus_tag="HPSH112_RS00350"
                     /old_locus_tag="HPSH112_00340"
     CDS             complement(66557..67069)
                     /locus_tag="HPSH112_RS00350"
                     /old_locus_tag="HPSH112_00340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206870.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreE"
                     /protein_id="WP_000583051.1"
                     /translation="MIIERLIGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKD
                     MAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRH
                     AALYYGESQFEFKTPFEKPTLALLEKLGVQNHVLSSKLDSKDRLTVSMPHSEPNFKVS
                     LASDFKVVMK"
     gene            complement(67071..67658)
                     /locus_tag="HPSH112_RS00355"
                     /old_locus_tag="HPSH112_00345"
     CDS             complement(67071..67658)
                     /locus_tag="HPSH112_RS00355"
                     /old_locus_tag="HPSH112_00345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_013469647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acid-activated urea channel"
                     /protein_id="WP_000901278.1"
                     /translation="MLGLVLLYVGIVLISNGICGLTKVDPKSTAVMNFFVGGLSIVCN
                     VVVITYSALNPTAPVEGAEDIAQVSHHLTSFYGPATGLLFGFTYLYAAINHTFGLDWR
                     PYSWYSLFVAINTIPAAILSHYSDMLDDHKVLGITEGDWWAIIWLAWGVLWLTAFIEN
                     ILKIPLGKFTPWLAIIEGILTAWIPAWLLFIQHWA"
     gene            complement(67851..69560)
                     /locus_tag="HPSH112_RS00360"
                     /old_locus_tag="HPSH112_00350"
     CDS             complement(67851..69560)
                     /locus_tag="HPSH112_RS00360"
                     /old_locus_tag="HPSH112_00350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit beta"
                     /protein_id="WP_000724275.1"
                     /translation="MKKISRKEYASMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELK
                     FGGGKTLREGMSQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNK
                     DMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGG
                     TGPADGTNATTITPGRRNLKFILRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGL
                     KIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTYHTE
                     GAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQF
                     ADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKE
                     EKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMII
                     KGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELG
                     LERQVLPVKNCRNITKKDMQFNDTTAHIEVNSETYHVFVDGKEVTSKPANKVSLAQLF
                     SIF"
     gene            complement(69564..70280)
                     /locus_tag="HPSH112_RS00365"
                     /old_locus_tag="HPSH112_00355"
     CDS             complement(69564..70280)
                     /locus_tag="HPSH112_RS00365"
                     /old_locus_tag="HPSH112_00355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit alpha"
                     /protein_id="WP_000779238.1"
                     /translation="MKLTPKELDKLMLHYAGELARKRKEKGIKLNYVEAVALISAHIM
                     EEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEA
                     SGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREK
                     TFGKRLDIASGTAVRFEPGEEKSVELIDIGGSRRIFGFNALVDRQADNESKKIALHRA
                     KERGFHGAKSDDNYVKTIKE"
     gene            complement(70550..70625)
                     /locus_tag="HPSH112_RS00370"
                     /old_locus_tag="HPSH112_t08192"
     tRNA            complement(70550..70625)
                     /locus_tag="HPSH112_RS00370"
                     /old_locus_tag="HPSH112_t08192"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(70590..70592),aa:Val,seq:gac)
     gene            complement(70646..71119)
                     /locus_tag="HPSH112_RS00375"
                     /old_locus_tag="HPSH112_00360"
     CDS             complement(70646..71119)
                     /locus_tag="HPSH112_RS00375"
                     /old_locus_tag="HPSH112_00360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase II"
                     /protein_id="WP_000921401.1"
                     /translation="MLKTTQKSLLVFIGVFFLIFGADQAIKYAILEGFRYESLIIDIV
                     LVFNKGVAFSLLSFLEGGLKYLQILLILGLFIFLMRQKELFKNHAIEFGMVFGAGVSN
                     VLDRFVHGGVVDYVYYHYGFDFAIFNFADVMIDVGVGVLLLRQFFFKQKQNKIKA"
     gene            complement(71113..72450)
                     /locus_tag="HPSH112_RS00380"
                     /old_locus_tag="HPSH112_00365"
     CDS             complement(71113..72450)
                     /locus_tag="HPSH112_RS00380"
                     /old_locus_tag="HPSH112_00365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="WP_000688351.1"
                     /translation="MKIFGTDGVRGKAGVKLTPMFVMRLGIAAGLYFKKHSKTNKILI
                     GKDTRKSGYMVENALVSALTSIGYNVIQIGPMPTPAIAFLTEDMRCDAGIMISASHNP
                     FEDNGIKFFNSYGYKLKEEEEKAIEEIFHDEELLHSSYKVGESVGSAKRIDDVIGRYI
                     VHLKHSFPKHLNLQSLRIVLDAANGAAYKVAPVVFSELGADVLVINDEPNGCNINEQC
                     GALHPNQLSQEVKKYRADLGFAFDGDADRLVVVDNLGNIVHGDKLLGVLGVYQKSKNA
                     LSSQAIVATSMSNLALKEYLKSQDLELKHCAIGDKFVSECMQLNKANFGGEQSGHIIF
                     SDYAKTGDGLVCALQVSALVLESKQVSSVALNPFELYPQSLINLNIQKKPPLESLKGY
                     SALLKELDKLEIRHLIRYSGTENKLRILLEAKDEKLLESKMQELKEFFEGHLC"
     gene            72540..72809
                     /locus_tag="HPSH112_RS00385"
                     /old_locus_tag="HPSH112_00370"
     CDS             72540..72809
                     /locus_tag="HPSH112_RS00385"
                     /old_locus_tag="HPSH112_00370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_001273635.1"
                     /translation="MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAVNDV
                     TKAQERLKIANKELHKFVSKGILKKNTASRKVSRLNASVKKIALA"
     gene            72924..73982
                     /locus_tag="HPSH112_RS00390"
                     /old_locus_tag="HPSH112_00375"
     CDS             72924..73982
                     /locus_tag="HPSH112_RS00390"
                     /old_locus_tag="HPSH112_00375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="WP_000025140.1"
                     /translation="MSILAEKLSSILKRYDELTALLSSAEVVSDIKKLTELSKEQSSI
                     EEISVASKEYLSVLENIKENKELLEDKELSELAKEELKILEIKKSDLETAIKQLLIPK
                     DPNDDKNIYLELRAGTGGDEAGIFVGDLFKAYCRYADLKKWKVEIVSSSENSVGGYKE
                     IIALIKGKGVYSRLKFEAGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVEVSINPS
                     DLKIEVFRAGGHGGQCVNTTDSAVRITHLPTNISVSMQDEKSQHKNKDKALKILKARL
                     YEKQIEEQQLANAKDRKEQVGSGDRSERIRTYNYPQNRLSEHRINLTLYSLEEIMLSG
                     NLDEVINPLIAHAQSQFE"
     gene            complement(74078..74320)
                     /locus_tag="HPSH112_RS08140"
     CDS             complement(74078..74320)
                     /locus_tag="HPSH112_RS08140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001916812.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_079992018.1"
                     /translation="MHAWCKNYRELSKFESCPHAFASTEYNPLLQILIFGVMPQKSEF
                     FVKNGLNKTLFFKSSYIYNLKLYLIRFYGSSCAVLG"
     gene            74369..75112
                     /locus_tag="HPSH112_RS00400"
     CDS             74369..75112
                     /locus_tag="HPSH112_RS00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000755255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000755246.1"
                     /translation="MKKVFLGMALAISVSMAEKSGAFLGGGFQYSNLENQNTTRTPGA
                     NNNTPIDTSMFGNNQRVTNTNNYGQMYGVDAMAGHKWFFGKTKRFGFRTYGYYSYNHA
                     NLSFVGSKLGIMDGASQVNNFTYGVGFDALYNFYESKEGYNTAGLFLGFGLGGDSFIV
                     QGESYLKSQMQICNNTAGCSASMNTSYFQMPVEFGFRSNFSKHSGIEVGFKLPLFTNQ
                     FYKERGVDGSVDVFYKRNFSIYFNYMINF"
     gene            75354..77114
                     /locus_tag="HPSH112_RS00405"
                     /old_locus_tag="HPSH112_00385"
     CDS             75354..77114
                     /locus_tag="HPSH112_RS00405"
                     /old_locus_tag="HPSH112_00385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000644253.1"
                     /translation="MKAIKILFMMTLSLNAISMNRALFDLKDSQLKGELTPKIVNFGG
                     YKSSTTEWGATALNYINAANGDAKKFSMLVEKMRFGSGILGNLRAHAHLRQALKLQKN
                     LKYCLKIIARDSFYSYRTGIYIPLGISLKDQKTAQKMLADLSVVGAYLKKQQENEKAQ
                     SPYYRSNNYYNSYYSPYYGMYGMYGMGMYGMYGMGMYDFYDFYDGMYGFYPNMFFMMQ
                     VQDYLMLENYMYAIDQEEILDHDASLNQLDTPTDDDRDDKDDKSLQQANLMSFYRDPK
                     FSKGIQTNRLNSALVNLDNSRMLKDNSLFHTKAMPTKSVDAITSQAKELNHLVGQIKE
                     MKQDGASPSKIDSVVNKAMEVRDKLDNNLNQLDNDLKDQKGLSSEQQAQVDKALDSVQ
                     QLSHSSDVVGNYLDGSLKIDDGDDRDDLNDAMNNPMQQPTQQTPTNNMGNTHANDSKD
                     QGGNALINPNTNTDDTHTDDTHTDDTRTDTNTTNDTSATDTPTDDTDDKDTGGMNNTG
                     DMNNTDTGNTDTGNTDTGNTDDMSNMNNGNDMGDDMNNANDMNDDMGNSNDDMGDMGD
                     MNDDMGGDMGDMGDMGDMGN"
     gene            complement(77546..79567)
                     /locus_tag="HPSH112_RS00410"
                     /old_locus_tag="HPSH112_00395"
     CDS             complement(77546..79567)
                     /locus_tag="HPSH112_RS00410"
                     /old_locus_tag="HPSH112_00395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_001257991.1"
                     /translation="MRSTRIGSKIVMMVCAVVIAISAVMGVIISYKVESVLQSQATEL
                     LQKKAQLVSFKIQSIMKRIFIGANTLEKFLSDENSAINDTLKKHMLSEFLLANPHVLL
                     INAIYTDNNERIITAMNLDSKIAYPNTALNENMTNQIRSLKDITHSDPYYKEINGNKI
                     YGMDITLPLMGKNQKIIGALNLFLSIDAFYTDVVGKKKSNTFLMGKDGRLLINPNREI
                     QDKILSAINPDKRVAKAVEYYNQNEAGTLSYHSLSGNTETFLAIQPFDFFEEKGDNGN
                     QWRWAIGKYVNKSLVFKEATNTKYIIITTLILGVLVLALLVFIIVSSLITKRISRVNN
                     TLNDFFNLLNNPKNNHAISLTPPSAYDEIGQMQTSINENILKIQESIQADNQAIQNSI
                     EVTNHVENGDFTQEIACVPKNKDLQALRNTINSIIQYFRNQIGANIEALNNALEHYKN
                     LDFTHHIQNPKANMEKALNTLGQEISSMLKASLGFANALNHESKDLKTCVDDLTKTAH
                     KQERSLKNTTQSLEEITNIITTIDSKSQEMISQGEDIKSVVDMIRDIADQTNLLALNA
                     AIEAARAGEHGRGFAVVADEVRKLAERTQKSLSEIEANINILVQSIADNAESIKMQNK
                     GVENIHNSINALQQDVQDNLTIANHSLQVSAKIDGISQDILEDVSKKKF"
     gene            complement(79721..80110)
                     /locus_tag="HPSH112_RS00415"
                     /old_locus_tag="HPSH112_00400"
     CDS             complement(79721..80110)
                     /locus_tag="HPSH112_RS00415"
                     /old_locus_tag="HPSH112_00400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_001227270.1"
                     /translation="MRKIYATGKRKTAIAKVWLTPGKGELSINEQSLNQWLGGHEAIK
                     MKVMQPLLLTKQEQSVDIKAVVFGGGYSAQAEALRHGISKALNAYDIAFRAVLKPKGL
                     LTRDSRVVERKKYGKRKARRSPQFSKR"
     gene            complement(80107..80532)
                     /locus_tag="HPSH112_RS00420"
                     /old_locus_tag="HPSH112_00405"
     CDS             complement(80107..80532)
                     /locus_tag="HPSH112_RS00420"
                     /old_locus_tag="HPSH112_00405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206884.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_000167683.1"
                     /translation="MTKTAKVNEIVRDWVVLDAKDKVFGRLITEIAVLLRGKHRPFYT
                     PNVDCGDFVVVINANKVKFSGMKLEDKEYFTHSGYFGSTKSKTLQEMLEKTPEKLYHL
                     AVRGMLPKTKLGKAMIKKLKVYRDDKHPHTAQTSKKDAK"
     gene            complement(80723..80911)
                     /locus_tag="HPSH112_RS00425"
                     /old_locus_tag="HPSH112_00410"
     CDS             complement(80723..80911)
                     /locus_tag="HPSH112_RS00425"
                     /old_locus_tag="HPSH112_00410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206885.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001168417.1"
                     /translation="MQKEQEALEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASA
                     QMSHQIKKIEERLNQEQK"
     gene            complement(80918..82270)
                     /locus_tag="HPSH112_RS00430"
                     /old_locus_tag="HPSH112_00415"
     CDS             complement(80918..82270)
                     /locus_tag="HPSH112_RS00430"
                     /old_locus_tag="HPSH112_00415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone oxidoreductase"
                     /protein_id="WP_000061418.1"
                     /translation="MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQI
                     SSSAKANSQTIHDGSIETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIG
                     VGDEECEFMKKRYESFKEIFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQK
                     DWSTMNFAKLSENFVEEALKLKPNNQVFLNFKVKKIEKRNDTYAVISEDIEEVYAKFV
                     LVNAGSYALPLAQSMGYGLDLGCLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDP
                     DAVIKGKTRIGPTALTMPKLERNKCWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRN
                     YVFKNMVFELPIIGKRKFLKDAQKIIPSLSLEDLEYAHGFGEVRPQVLDKTKRKLELG
                     EKKICTHKGITFNMTPSPGATSCLQNALVDSQEIAAYLGESFELERFYKDLSPEELEN
                     "
     gene            complement(82324..83697)
                     /locus_tag="HPSH112_RS00435"
                     /old_locus_tag="HPSH112_00420"
     CDS             complement(82324..83697)
                     /locus_tag="HPSH112_RS00435"
                     /old_locus_tag="HPSH112_00420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001268633.1"
                     /translation="MRYFLVVFLFLFVGCMQKDFTLKDLSLPQEASSYLASPQNGSNN
                     NQSIDPQALRENLKESYLKAWYSPWLDMKVKSNKKEVFWILKEMDKSTGYGEDLKPNA
                     KAFNDELIKSMDIEHYPSVKIKAVVARDSDVRAVPTNKPFYLSQKGYPFDRYQNSLIF
                     QGTPVLITHFNTDKTYAHIQSSFVYGWIKVSDLAYMHDKDIELLIHLKDYVMPIKDKI
                     PLYTDYGDFYTNARVGELFALIPQSQKTPEKPPKKELKAYGFLRDAKGYATLQSVILE
                     EKDFFVFPKAFNSENMAYFIDTMLGQKYGWGGLLGNRDCSAFTRDSFANFGILLPRNS
                     YAQSRYANNYVDLSSMKAKEKEDYILKNATPFGTLLYLKGHIMLYLGAHNHQAIVAHS
                     IWSVQTQKHFKTLSHKIGGVVITSLWLAEEHNGAFSKKKLLIDRVLGMSDLKDFVNKT
                     SSPLNAN"
     gene            complement(83718..85736)
                     /locus_tag="HPSH112_RS00440"
                     /old_locus_tag="HPSH112_00425"
     CDS             complement(83718..85736)
                     /locus_tag="HPSH112_RS00440"
                     /old_locus_tag="HPSH112_00425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_000725812.1"
                     /translation="MKKKANEEKAPKKAKAEAAQENKTKENNKAKESKIKEAKTKESK
                     IKETKAKEPVPVKKLSFNEALEELFANSLSDCVSYESIIQISAKVPTLAQVKKIKELC
                     QKYQKKLVSSSEYAKKLNAIDKIKKTEEKKKVLDEELEDGYDFLKEKDFLEWSRSDSP
                     VRMYLREMGDIKLLSKDEEIELSKQIRLGEDIILDAICSVPYLIDFIYAYKDALINRE
                     RRVKELFRSFDDDDENSVSNSKKDDDSEEYEENEERKKVVSEKDRKRVEKVQESFKAL
                     DKAKKEWLKALEAPVDEKEDELVRLLTLAYKRQTLKDRLYDLEPTSKLINELVKTMET
                     TLKSGDGFEKELKRLEYKLPLFNDTLIANHKKILANITSMTKEDIIAQVPEATMVSVY
                     MDLKKLFLTKEASEEGFDLDPNKLKEILEQIKRGKLISDRAKNKMAKSNLRLVVSIAK
                     RFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTI
                     RIPIHMIDTINRINKVMRKHIQENGKEPDLEVVAEEVGLSLDKVKNVIKVTKEPISLE
                     TPVGNDDDGKFGDFVEDKNIVSSIDHIMREDLKVQIESVLDQLNEREKAVIRMRFGLL
                     DDESDRTLEEIGKELNVTRERVRQIESSAIKKLRSPQYGRILRNYLRI"
     gene            complement(85926..86621)
                     /locus_tag="HPSH112_RS00445"
                     /old_locus_tag="HPSH112_00430"
     CDS             complement(85926..86621)
                     /locus_tag="HPSH112_RS00445"
                     /old_locus_tag="HPSH112_00430"
                     /EC_number="3.2.2.9"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206889.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="WP_014534173.1"
                     /translation="MVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYRNK
                     EIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHD
                     VDLSAFNHPLGFIPESAIFIETSESLNALAKKVANEQHIALKEGVIASGDQFVHSKER
                     KEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKANMSFDAFLEKSAQ
                     TSAKFLKSMVDKL"
     gene            complement(86632..87561)
                     /locus_tag="HPSH112_RS00450"
                     /old_locus_tag="HPSH112_00435"
     CDS             complement(86632..87561)
                     /locus_tag="HPSH112_RS00450"
                     /old_locus_tag="HPSH112_00435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206890.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-acyl carrier protein transacylase"
                     /protein_id="WP_001199038.1"
                     /translation="MQYALLFPGQGSQCIGMGKSFYESHTLAKELFERASNALKVDMK
                     KTLFEENELLKESAYTQPAIYLVSYIAYQLLNKQVNGGLKPVFALGHSLGEVSAVSLS
                     GALDFEKALKLTHQRGKMMQEACANKDASMMVVLGVSEESLLSLCQRTKNVWCANFNG
                     GMQVVLAGIKDDLKALEPTLKEMGAKRVVFLEMSVASHCPFLEPMIFKFQELLEKSLK
                     DKFHFEIISNATNEAYHNKAKAVELLSLQLTQPVRYQDCVKSNNDRVDVFFELGCGSV
                     LKGLNKRLSNKPTISVGDNKGLDEAIEFLEEYV"
     gene            87692..87783
                     /locus_tag="HPSH112_RS00455"
                     /old_locus_tag="HPSH112_t08194"
     tRNA            87692..87783
                     /locus_tag="HPSH112_RS00455"
                     /old_locus_tag="HPSH112_t08194"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:87727..87729,aa:Ser,seq:gct)
     gene            87987..88820
                     /locus_tag="HPSH112_RS00460"
                     /old_locus_tag="HPSH112_00440"
     CDS             87987..88820
                     /locus_tag="HPSH112_RS00460"
                     /old_locus_tag="HPSH112_00440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206891.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction endonuclease MboI"
                     /protein_id="WP_000788574.1"
                     /translation="MKNHLPFNIFLQSLKISNRTLGFFTDWQKCLKNRNEISIALNHL
                     NFLLGKGAQELKSCIKSLFEEYPKAFNVLNILIAVRNKDEVVLDADGNFYPLHSYFEN
                     DEKVYQFICQTGLEQIFCNRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENYLSGLFF
                     QAQLNFKEQVDIREFENLYQAFGDDIKKFDFVVCGKDTTYFIEANFYTINGSKLNEVA
                     RSYQELALKFEAFLNYEFIWITDGIGWWDAKSKLQEAYKSVEIYNLSNVNDFISKVQK
                     W"
     gene            88814..89647
                     /locus_tag="HPSH112_RS00465"
                     /old_locus_tag="HPSH112_00445"
     CDS             88814..89647
                     /locus_tag="HPSH112_RS00465"
                     /old_locus_tag="HPSH112_00445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017279989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4"
                     /protein_id="WP_000233884.1"
                     /translation="MVIAHSNEIARPIFKSQDQLFTLYQGDCNEVLPQFENQFDLIFA
                     DPPYFLSNDGLSIQSGKIVSVNKGDWDKEESVNDIDGFNYQWINNAKKALKNTGSLLI
                     SGTYHNIFSLGRILQKLDFKILNLITWQKTNPPPNFSCRYLTHSAEQIIWARKSYKHK
                     HVFNYEVLKKINNDKQMRDVWSFPAIAPWEKVNGKHPTQKPLALLVRLLLMASDENSL
                     IGDPFSGSSTTGIAANLLKRQFIGIEKESEFVKISMDRKSELDARFKEIRSKIKDLNL
                     K"
     gene            complement(89665..90555)
                     /locus_tag="HPSH112_RS08145"
                     /old_locus_tag="HPSH112_00450"
     CDS             complement(89665..90555)
                     /locus_tag="HPSH112_RS08145"
                     /old_locus_tag="HPSH112_00450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000874809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-1,2-fucosyltransferase"
                     /protein_id="WP_000874773.1"
                     /translation="MAFKVVQICGGLGNQMFQYAFAKSLQKHLNTPVLLDITSFDGSN
                     RKMQLELFPIDLPYASAKEIAIAKMQHLPKLVRDALKCMGFDRVSQEIVFEYEPKLLK
                     PSRLTYFFGYFQDPRYFDAISPLIKQTFTLPPPENSKKKEEEYYRKLSLILAAKNSVF
                     VHIRRGDYVGIGCQLGINYQKKALEYMAKRVPNMELFVFCEDLKFTQNLDLGYPFIDM
                     TTRDKEEEAYWDMLLMQSCQHGIIANSTYSWWAAYLIKNPEKIIIGPKHWLFGHENIL
                     CEEWVKIESHFEVKSEKYNA"
     gene            complement(90653..91183)
                     /locus_tag="HPSH112_RS00480"
                     /old_locus_tag="HPSH112_00455"
     CDS             complement(90653..91183)
                     /locus_tag="HPSH112_RS00480"
                     /old_locus_tag="HPSH112_00455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001125775.1"
                     /translation="MPKPKKNTLPCSLSIKMSYFMRLLIKWRTRSLSHKMMTLIQILS
                     ILALASKTSEDLEEQLKKIKAYIYRTLNAKIASDVYNRVLILVNEYCTNEELFDKESV
                     KISDLLIQDIQLYALVDEMLKEDKYQVQHTILKGIIKRKYDEAYSLNSEDRILLEYQE
                     RLLEPSYASFSNKKFK"
     gene            91256..92200
                     /locus_tag="HPSH112_RS00485"
                     /old_locus_tag="HPSH112_00460"
     CDS             91256..92200
                     /locus_tag="HPSH112_RS00485"
                     /old_locus_tag="HPSH112_00460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206896.1"
                     /note="Involved in the metabolism of aromatic amino acids;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_000447292.1"
                     /translation="METFKKGVVLDAKSVGLKALEVLKEVADFDFYEITSPNQVVERC
                     KDAEIVVLNKVIITQEILSQLPKLKLICITATGTDNVDIKSAKALGIEVKNVSAYSTE
                     SVAQHTLAYTLSLLGRINDYDHYCKSGEYSQSDIFTHISGIKMGLIKGSQWGVIGLGT
                     IGKRVAKLAQAFGAKVVYYSPKDKKEEYERLSLKDLLTTSDIISIHAPLNESTRDLIA
                     LKELQSLKDGAILINVGRGGIVNEKDLAGILETKDLYYASDVFVKEPFEKDHAFLNPK
                     IQNKLLLTPHIAWAYSDSLKTLVEKTKENIQDFLASQK"
     gene            complement(92544..93257)
                     /locus_tag="HPSH112_RS00490"
                     /old_locus_tag="HPSH112_00465"
     CDS             complement(92544..93257)
                     /locus_tag="HPSH112_RS00490"
                     /old_locus_tag="HPSH112_00465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206897.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000725117.1"
                     /translation="MKKIVLVAIALLMSACASYKITPEHVTSYNNGIQVMTSTQAKSK
                     VQLEIAQSKLKGLSESPLVLYVAAQVLEGNPVVFSRKAISVSINQTILPVLSLRQVMK
                     SSFDFEGILQSFNIAVPTTPIDNVNMITPPMFYYGQGGFLAYNGLMYGGMGMYGPGFG
                     MMMMDDVEEQEVMQESRQALKILAINYLKNNTLNVENKAKGGFVVVDTKNLKTPGVVV
                     VKVFLEDEIHTFKIDISKM"
     gene            complement(93364..94824)
                     /locus_tag="HPSH112_RS00495"
                     /old_locus_tag="HPSH112_00470"
     CDS             complement(93364..94824)
                     /locus_tag="HPSH112_RS00495"
                     /old_locus_tag="HPSH112_00470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="WP_001117285.1"
                     /translation="MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDC
                     LNLSYNELVECVFERLGLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYH
                     GPSLAFKDMALQPLASLFSNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCL
                     YPKDGTSLVQKLQMVTQSASNLKVFGISGDFDDAQNALKNLLKDDDFNGALKTRQLKL
                     SVANSVNFGRIAFQIVYHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKM
                     GLNIDKIKVVTNSNDVLREFIETGRYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFG
                     FERTLELMQALEEEKFYALKPKELALLQEHFSCASCSDEACLKTIQEVYAEHQYLIDP
                     HTATALNASLKTHEKTLVSATASYEKFPRTTLLALNEQKKNDNDKTALETLKNSYNTP
                     DSQRLDDLFERGIKHQEVLKLNEIKSSILLWLENTH"
     gene            95027..97063
                     /locus_tag="HPSH112_RS00500"
                     /old_locus_tag="HPSH112_00475"
     CDS             95027..97063
                     /locus_tag="HPSH112_RS00500"
                     /old_locus_tag="HPSH112_00475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_000033501.1"
                     /translation="MSKGLSIGNKIILCVALIVIVCVSILGVSLNSRVKEILKENALH
                     SMQDSLHFKVKEVQGILENTYTSVGIVKAMLPKDTKREIKIHLLKNFILANSHVAGVS
                     MFFKDREDLRFTLLRDNDTIKLVENPSLGNNPLVQKTMKNKEISKSLPYYRKMPNGAE
                     VYGVNILLPLLNENTQEAVGALMIFFSIDSFSNEITKNRSDLFLIGVKGKVLLSANKS
                     LQDKSIAEIYKSVPKATNEVMAILENGSNGSKATLEYLDPFSHKENFLAVETFKMLGK
                     TESRDNLNWMIASIIEKDKVYEQVGSVRFMVIVASAIMVLALIIAITLLMRAIVSNRL
                     EAVSSTLSHFFKLLNNQANSSGIKLVEAKSNDELGRMQTAINKNILQTQKIMQEDRQA
                     VQDTIKVVSDVKTGNFAVRITAEPASPDLKELRDALNGIMDYLQESVGTHMPSIFKIF
                     ESYSGLDFRGRIQNASGRVELVTNALGQEIQKMLETSSNFAKDLANDSANLKECVQNL
                     EKASNSQHKSLMETSKTIENITTSIQGVSSQSEAMIEQGQDIKSIVEIIRDIADQTNL
                     LALNAAIEAARAGEHGRGFAVVADEVRKLAERTQKSLSEIEANINILVQSISDTSESI
                     KNQVKEVEEINASIEALRSVTEGNLKIASDSLEISQEIDKVSNDILEDVNKKQF"
     gene            97063..98169
                     /locus_tag="HPSH112_RS00505"
                     /old_locus_tag="HPSH112_00480"
     CDS             97063..98169
                     /locus_tag="HPSH112_RS00505"
                     /old_locus_tag="HPSH112_00480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000905225.1"
                     /translation="MLIHICCSVDNLYFLKKAKEAFAGEKMIGFFYNPNIHPYSEYLL
                     RLEDVKRACEMLEIELLEGDYELEKFLDKAKGKELLGEKSERCFECFDLRLEASALKA
                     FELGEEKFTTTLLTSPKKDPNQLIAKGQHIAQRHNLEFVVFRNDNFEHFKSELDLNLQ
                     ALARENELYRQNYCGCQFALKIQKESQNRSPFELYSPLKRQILPASVEERTQVFRALN
                     AAKKDANKPFLAQKTIATYRLLNGGVWLSKNSNPLNCYILARSKSKAKVRINDLRWVF
                     SQRLNALVGYSQRDETLFLTLESLNALMAKNYESLKELSLNPLNYEEELSLRALVSGS
                     ESVNPIIVLEERMEKTLFVEIKSIFQEEKVFYLL"
     gene            98285..99046
                     /locus_tag="HPSH112_RS00510"
                     /old_locus_tag="HPSH112_00485"
     CDS             98285..99046
                     /locus_tag="HPSH112_RS00510"
                     /old_locus_tag="HPSH112_00485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206901.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000853719.1"
                     /translation="MKTLFSVYLFLSLNPLFLEAKEITWSQFLENFKNKNEDDKPKPL
                     TLDKNNEKQKILDKNQQILKRALEKSLKFFFIFGYNYSQAAYSTTNQNLTLMANSIGF
                     NTATGLEHFLRNHPKVGFRIFSVYNYSHSVSLSQPQILMVQNYGGALDFSWIFVDKKT
                     YRFRSYLGIALEQGVLLVDTIKSGAITTIIPRSKKTFFQAPFRFGFIVDFIGYLSLQF
                     GIEMPLVRNVFYTYNNHQERFKPRFNANLSLIVSF"
     gene            complement(99029..99811)
                     /locus_tag="HPSH112_RS00515"
                     /old_locus_tag="HPSH112_00490"
     CDS             complement(99029..99811)
                     /locus_tag="HPSH112_RS00515"
                     /old_locus_tag="HPSH112_00490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_000922052.1"
                     /translation="MLKVSVITACFNSEKTIEDTILSVLNQTYKNIEYIIIDGASTDG
                     TLEIIQKYRDKIACAISEKDEGIYDAMNKGIKRSSGDIIALLNSDDFYKDEFVVEKVV
                     HEFENKNCDSVYADLVFVKPDCLEKVVRYYESGEFDPKTLLYGVVPAHPTLFVKKAIY
                     ERYGLYKTDYKISADFEMIIRLFVVQKISFSYLKEVLVVMRTGGVSARGFKSLLLRNK
                     ENLRACQENGIQANVFSMLLKYPRKIMGLFKRESKGSLKRND"
     gene            complement(99842..101539)
                     /locus_tag="HPSH112_RS00520"
                     /old_locus_tag="HPSH112_00495"
     CDS             complement(99842..101539)
                     /locus_tag="HPSH112_RS00520"
                     /old_locus_tag="HPSH112_00495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_000232116.1"
                     /translation="MVFSSMFASLGTRIVLVVLAALISLGGLFIGFVKVMQKDALAQL
                     KEHLETEQYKKREKTLAYMTKLLEQGIHEYYKNFDNTTARKMALDYFKRINDDKGMIY
                     MVVVDKNGIVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYD
                     GGVPEKKFAYSHYDEVSSMVIATTSYYTDINTENKAITEGVDKVFNESATKLFLWILT
                     ATIALVVLTLIYAKLRIVKRIDELVLKINAFSHGDKDLRAKIDVDDRNDEISQVGRGV
                     NLFVENARLIIEEIKGTSTLNKTSMDKLVQIAQETQKSMKNSSTTLDSVKNKATGIAS
                     MMSASIEQSQGLRKRLIETQALVKESKDAIGDLFSQITESAHTEEELSSKVEQLSRNA
                     DDVKSILDIINDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRNLAGRTQKSLAE
                     INSTIMVIVQEIDAVSSQMNLNSQKMERLSDMSKSVQETYDKMSSNLSSVVSDSNQSM
                     DDYAKSGHQIEAMVSDFVEVEKVSSKTLTDSSDILNIAMHVSETTMNLDKQVNLFKT"
     gene            complement(101746..103491)
                     /locus_tag="HPSH112_RS00525"
                     /old_locus_tag="HPSH112_00500"
     CDS             complement(101746..103491)
                     /locus_tag="HPSH112_RS00525"
                     /old_locus_tag="HPSH112_00500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206904.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
                     /protein_id="WP_000737607.1"
                     /translation="MKKLVLIVFLTLTLSISAKEVKIVFLETSDIHGRLFSYDYATGE
                     QKPNNGLTRIAALIKKQRAENKNVVLIDSGDLLQGNSAELFNDEPIHPLVLAENDLKF
                     DIRVLGNHEFNFSKDFLEKNIKGFNGDVVNANIIKTADNQPFVKPYAIKKIDGVRVAI
                     VGYVVPHIPTWEASTPEHFAGLEFLDAEEALKKTLKELKGKYDVLIGAFHLGREDEKG
                     GDGVPDLAKKFPQFDIIFAGHEHAVYNTKIGKVHTIEPGAYGAYLAKGVVMFDTKTKK
                     KIVTTENLPTKGVPEDEELAKKYEYVDKKSKEYANEVVGEVTKTFIDRPDFITGEEKI
                     TTMPTAALQETPVIELINNVQKYYAKADVSAAALFNFGTNLKKGPFKRKDVAYIYKFA
                     NTLIGVKITGENLLKYMEWSYQFYNQLQPGDLTISFNENIRGYNFDMFSGVKYQVDVT
                     KPAGSRIINPTINNKPIDPKAVYKLAINNYRFGTLSKTLNLVTDANRYYNSYDELQDN
                     GQIRDLIIKYITEEKGGKVTPELEHNWEIINYNFKNPLLEKLREKLKEGSIKIPTSKD
                     GRTLNVKSIKESEVK"
     gene            complement(103626..104078)
                     /locus_tag="HPSH112_RS00530"
                     /old_locus_tag="HPSH112_00505"
     CDS             complement(103626..104078)
                     /locus_tag="HPSH112_RS00530"
                     /old_locus_tag="HPSH112_00505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206905.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteine lyase"
                     /protein_id="WP_080024656.1"
                     /translation="MNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRFKQPNK
                     DHMDMPSLHSLEHLVAEIIRNHASYVIDWSPMGCQTGFYLTVLNHDNYTEILEVLEKT
                     MQDVLKATEVPASNEKQCGWAANHTLEGAQNLARAFLDKRTEWSEVGV"
     gene            complement(104107..105249)
                     /locus_tag="HPSH112_RS00535"
                     /old_locus_tag="HPSH112_00510"
     CDS             complement(104107..105249)
                     /locus_tag="HPSH112_RS00535"
                     /old_locus_tag="HPSH112_00510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015086786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="WP_001242840.1"
                     /translation="MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGRHKGYEY
                     SRSGNPTRFALEELIADLEGGVKGFAFASGLSGIHAVFSLLQSGDHVLLGDDVYGGTF
                     RLFNKVLVKNGLSCTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLVQCASVA
                     KDHGLLTIVDNTFATPYCQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTSNEALAQE
                     IAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPG
                     LSAHPNHELAKKQMRGFSGMLSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPA
                     FMTHACIPKVQREAAGIKDGLVRLSVGIEHEQDLLEDLKQAFAKIK"
     gene            complement(105270..106190)
                     /locus_tag="HPSH112_RS00540"
                     /old_locus_tag="HPSH112_00515"
     CDS             complement(105270..106190)
                     /locus_tag="HPSH112_RS00540"
                     /old_locus_tag="HPSH112_00515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206907.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase"
                     /protein_id="WP_000972767.1"
                     /translation="MMIITTMQDAIGRTPVFKFTSKDYPIPTNSAIYAKLEHLNPGGS
                     IKDRLGQYLIEEGFRTGKITSKTTIIEPTAGNTGIALALVALKHHLKTIFVVPEKFSA
                     EKQQIMRALGAKVINTPTSEGISGAIKKSKELAESIPDSYLPLQFENPNNPAAYYHTL
                     APEIVQELGVGLTSFVAGIGSGGTFAGTARYLKERIPTIRLIGVEPEGSILNGGEPGP
                     HEIEGIGVEFIPPFFANLDIDGFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAAL
                     KEAQRLPEGSQVLTIFPDVADRYLSKGIYL"
     gene            106295..106606
                     /locus_tag="HPSH112_RS08150"
     CDS             106295..106606
                     /locus_tag="HPSH112_RS08150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000717886.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024681.1"
                     /translation="MKETEWNEEQRKAFQDLLREFVALIDAKAQEKKQTGRAPKIPKY
                     GSCQKGLNKFLTPWGYACKISLGSGNLSNEPSIAFCRQDILGEEFVNGEIPTPKKDFY
                     L"
     gene            106687..106875
                     /locus_tag="HPSH112_RS08155"
     CDS             106687..106875
                     /locus_tag="HPSH112_RS08155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000649882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024682.1"
                     /translation="MSQKCLAYDKIIDPNKDTYYQEIYDDLEAHLEKITNDFLRFANE
                     FNQIPTAYFELEPSSASH"
     gene            complement(107014..108876)
                     /locus_tag="HPSH112_RS00550"
                     /old_locus_tag="HPSH112_00530"
     CDS             complement(107014..108876)
                     /locus_tag="HPSH112_RS00550"
                     /old_locus_tag="HPSH112_00530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_000521034.1"
                     /translation="MGKVIGIDLGTTNSAMAVYEGNEAKIIANKEGKNTTPSIVAFTD
                     KGEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDKAKEAEKRLPYKIVDRNGACAI
                     EISGKVYTPQEISAKILMKLKEDAESYLGESVTEAVITVPAYFNDSQRKATKEAGTIA
                     GLNVLRIINEPTSAALAYGLDKKESEKIMVYDLGGGTFDVTVLETGDNVVEVLATGGD
                     AFLGGDDFDNRVIDFLASEFKSETGIEIKNDVMALQRLKEAAENAKKELSSAMETEIN
                     LPFITADATGPKHLVKKLTRAKFESLTEDLVEETISKIESVIKDAGLTKNEISEVVMV
                     GGSTRIPKVQERVKAFINKDLNKSVNPDEVVAVGASIQGGVLKGDVKDVLLLDVTPLS
                     LGIETLGGVMTKVIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGK
                     FDLQGIPPAPRGVPQIEVTFDIDANGILTVSAQDKNTGKSQEIKISGSSGLSDSEIEK
                     MVKDAELHKEEDARKKEVIEARNHADSLAHQTQKSLDEHKTNLNENDANEIQNAINAL
                     KECVKNDNATKAELEDKTKALAQAAQKLGEAMANKNNAEQPKKKDDDVIDAEVE"
     gene            complement(108907..109482)
                     /locus_tag="HPSH112_RS00555"
                     /old_locus_tag="HPSH112_00535"
     CDS             complement(108907..109482)
                     /locus_tag="HPSH112_RS00555"
                     /old_locus_tag="HPSH112_00535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206910.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide exchange factor GrpE"
                     /protein_id="WP_000653242.1"
                     /translation="MKDKHNQEHDHLSQEEPESCEKACACKEQQGEEMQEASEKECEI
                     KEDFELKYQEMHEKYLRVHADFENVKKRLERDKSMALEYAYEKIALDLLPVIDALLGA
                     HRSAAEEDKESALTKGLELTMEKLHEVLARHGIEGIECLEEFDPNFHNAIMQVKSEEK
                     ENGKIVQVFQQGYKYKGRVLRPAMVSIAKND"
     gene            complement(109482..110312)
                     /locus_tag="HPSH112_RS00560"
                     /old_locus_tag="HPSH112_00540"
     CDS             complement(109482..110312)
                     /locus_tag="HPSH112_RS00560"
                     /old_locus_tag="HPSH112_00540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206911.1"
                     /note="Acts as a negative regulator of the grpE-dnaK-dnaJ
                     and groELS class I heat shock operons by preventing
                     heat-shock induction; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HrcA family transcriptional regulator"
                     /protein_id="WP_000233952.1"
                     /translation="MVIDEIFQIMMLKRIKVGSDLNKKESLLDAFVKTYLQILEPISS
                     KRLKELANLKISCATIRNYFQTLSKEGMLYQAHSSGARLPTFKALENYWQKSLRFEIL
                     KVNEKRLKSASENFGLFTLLKKPSLERLERVIECEKRFLILDFLAFSCAMSYSVKMEK
                     FLLELVGRSVKEVRSIAASVNALSLARQLERLEYSNTQITRFNLMGLKTLLNSPLFFD
                     ILGGKVLERLKKGLHFIEPDCMLVTRPIEFQNKRMQLLCVGKLECDYEGFFQTISKEE
                     "
     gene            110532..111170
                     /locus_tag="HPSH112_RS00565"
                     /old_locus_tag="HPSH112_00545"
     CDS             110532..111170
                     /locus_tag="HPSH112_RS00565"
                     /old_locus_tag="HPSH112_00545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000609312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662181.1"
                     /translation="MLNMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIG
                     TNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYA
                     RPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKK
                     HFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV"
     gene            111191..111487
                     /locus_tag="HPSH112_RS00570"
                     /old_locus_tag="HPSH112_00550"
     CDS             111191..111487
                     /locus_tag="HPSH112_RS00570"
                     /old_locus_tag="HPSH112_00550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206913.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000154709.1"
                     /translation="MTINTHYTPNFTQFQTLNNINNDATIKDRNQVEQDLQQSNIQDG
                     FSQDNTQNAPDFDRLQALNAINNDGEIKDKSQVEKSLADGENIPEIYSSLDTYA"
     gene            complement(111497..113383)
                     /locus_tag="HPSH112_RS00575"
                     /old_locus_tag="HPSH112_00555"
     CDS             complement(111497..113383)
                     /locus_tag="HPSH112_RS00575"
                     /old_locus_tag="HPSH112_00555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000968817.1"
                     /translation="MMDIYQKNLQALFKKDPLLFAQLKAIKENKKYEVFLGNDSANFN
                     LLDKETNTPLFEKSPLDSSLELYKNSEIYMLYPYLYYFGLGNGVFYRLLLGNGNLKRL
                     VVIEPEIEVIFIVLNLLDFSTEILENRLILLHAAFCHYNMIASLFDMDKKSRLYARMY
                     DLKLFNAYYERYSHQMIEINQHFTRALEHGAISVGNDAKDALIGIKQHAANLPEVIKS
                     PSLVDFVSTLKNRDTAIIVSTGPSLNKQLPLLKEIAPYATLFCIDASFPILAKAGIKP
                     DIVLSLERVDLTAKFYEETPLDFQEGVIFALTSIVHKRLIQAIKKGVKQFSFRPFGYT
                     NLFGLHQYGYVGIGMSAANMAYELVVHSRFKRCVFIGQDLSFSQSGNSHASGAIYGDR
                     EIKPKKDKDKIFTEKYGGNGEVETTLVWKLFLEFFEKDIFNTPYKLEVINATEGGARI
                     KGTKEMPFKEVCEKIDKSKPKPPINLIYPTKSEQAKNLRIAKQKCEEIIKYANEKKTQ
                     VEEVFLKVAPFLEEVEKLHEEKKLEELDFKALENLSAEIDNIKELFDDKQFNSYFMDA
                     IQSYIFHQELHIAEIVCKKTNNEDELRAKQLEYIYAHKYWLFSLAGGIDCVIEAIKMA
                     LKEW"
     gene            complement(113443..114987)
                     /locus_tag="HPSH112_RS00580"
                     /old_locus_tag="HPSH112_00560"
     CDS             complement(113443..114987)
                     /locus_tag="HPSH112_RS00580"
                     /old_locus_tag="HPSH112_00560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206915.1"
                     /note="FlaB; structural flagella protein; in Helicobacter
                     flagella are composed of flagellin A and flagellin B; the
                     amounts of each seem to be controlled by environmental
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin B"
                     /protein_id="WP_000010002.1"
                     /translation="MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADD
                     SSGMAIADSLRSQSANLGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQD
                     GQTLESRRALQSDIQRLLEELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTIKAS
                     IGSTSSDKIGHVRMETSSFSGEGMLASAAAQNLTEVGLNFKQVNGVNDYKIESVRIST
                     SAGTGIGALSEIINRFSNTLGVRASYNVMATGGTPVQSGTVRDLTINGVEIGTVNDVH
                     KNDADGRLTNAINSVKDRTGVEASLDIQGRINLHSIDGRAISVHATSASGQVFGGGNF
                     AGISGTQHAVIGRLTLTRTDARDIIVSGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDA
                     NVASAAGANANGAQAETNSQGIGAGVTSLKGAMIVMDMADSARTQLDKIRSDMGSVQM
                     ELVTTINNISVTQVNVKAAESQIRDVDFAEESANFSKYNILAQSGSFAMAQANAVQQN
                     VLRLLQ"
     gene            115153..117363
                     /locus_tag="HPSH112_RS00585"
                     /old_locus_tag="HPSH112_00565"
     CDS             115153..117363
                     /locus_tag="HPSH112_RS00585"
                     /old_locus_tag="HPSH112_00565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206916.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_000681459.1"
                     /translation="MKHLIIVESPAKAKTIKNFLDKNYEVIASKGHVRDLSKFALGIK
                     IDETGFTPNYVVDKDHKELVKQIIELSKKASTTYIATDEDREGEAIGYHVACLIGGKL
                     ESYPRIVFHEITQNAILNALKTPRKIDMSKVNAQQARRFLDRIVGFKLSSLIASKITK
                     GLSAGRVQSAALKLVIDREREIKAFKPLTYFTLDAYFEPHLEAQLISYKGNKLKAQEL
                     IDKKEAQEIKNELEKESYTISSIIKKSKKSPTPPPFMTSTLQQSASSLLGFSPTKTMS
                     IAQKLYEGVATPQGVMGVITYMRTDSLNIAKEALEEARNKILKDYGKDYLPPKAKVYS
                     SKNKNAQEAHEAIRPTSIVLEPNALKDYLKPEELKLYTLIYKRFLASQMQDALFESQS
                     VVVACEKGEFKASGRKLLFDGYYKILGNDDKDKLLPNLKENDPIKLEKLESNAHVTEP
                     PARYSEASLIKVLESLGIGRPSTYAPTISLLQNRDYIKVEKKQISALGSAFKVIEILE
                     KHFEEIVDSKFSASLEEELDNIAQNKADYQQVLKDFYYPFMDKIEAGKKNIISQKVHE
                     KTGQSCPKCGGELVKKNSRYGEFVACNNYPKCKYVKQTENTNDGAKQESCEKCGGEMV
                     QKFGRNGAFLACNNYPECKNTKSLKNTPNANEIIEGVKCPECGGDIALKRSKKGSFYG
                     CNNYPKCNFLSNHKPINKRCEKCHYLMSERTYRKKKAHECIQCKERVFLEENDG"
     gene            117356..118282
                     /locus_tag="HPSH112_RS00590"
                     /old_locus_tag="HPSH112_00570"
     CDS             117356..118282
                     /locus_tag="HPSH112_RS00590"
                     /old_locus_tag="HPSH112_00570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="radical SAM protein"
                     /protein_id="WP_001040770.1"
                     /translation="MAKENLPIVFGPVLSRRFGKSLGVDLSPSKKQCNYNCIYCELGK
                     AKPIERMEEVIKVKTLINAIQNALNNLTTPIDVLTITANGEPTLYPHLLELIQSVKPF
                     LKGVKTLILSNGSLFYEPKVQQALKEFDIVKFSLDAIDLKAFERVDKPYSKDIDKILE
                     GILSFSQIYQGQLVAEVLLIKGVNDSANNLKLIADFLKKINTARVDLSTIDRPSSFKA
                     PKLSEDELLKCSLFFEGLCVSLPKRSIAQAKKLISCGIDELLALISRRPLSAEEAPLI
                     LDPNAFKHLETLLNHQKITIKKVGSLEFYCAF"
     gene            complement(118432..119571)
                     /locus_tag="HPSH112_RS00595"
                     /old_locus_tag="HPSH112_00575"
     CDS             complement(118432..119571)
                     /locus_tag="HPSH112_RS00595"
                     /old_locus_tag="HPSH112_00575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000843725.1"
                     /translation="MKSVKIGKTNKVGKNTEMANTKTNKETYFKGSDQIGGIFTKIAK
                     KVREFVKKHPKKSNAALVVLTHVACKKAKELDDKVQDKSKQAEKENKINWWKYSGLTI
                     ATSFLLAACSVDTDKQIELEQEKQKANKSGIELEQEKQKTEQERQKTNKSGIELEQER
                     QKAEQEKQKTNKSGIELEQERQKTEQEKQKTIKAQKDFIKDLEQNCEEKHGQFFIKKA
                     RIKDSISIEVEAECKTPKPTKTNQTPIQPKHLPNSKQPHSQRGSKAQELIAYLQKELE
                     SLPYSQKTIAKQVNFYRPSSIAYLELDPRDFNVTEEWQNENLKIRSKAQAKMLEMRNP
                     QANLSPFQSFSIIQNIVADINKEIEVAASTEKKAEKVGYGYSKRM"
     gene            complement(119671..122109)
                     /locus_tag="HPSH112_RS00600"
                     /old_locus_tag="HPSH112_00580"
     CDS             complement(119671..122109)
                     /locus_tag="HPSH112_RS00600"
                     /old_locus_tag="HPSH112_00580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206921.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="WP_001269183.1"
                     /translation="MRYIKFFKELNNKNVNLVGGKNASIGEMFQELVPIGIKVPDGFA
                     ITSEAYWYLLEQGGAKQKIIELLENVDATEIDVLKIRSKQIRELIFGTPFPSDLRDEI
                     FQAYETLSQQYHMKEADVAVRSSATAEDLPDASFAGQQDTYLNIKGKTELIHYIKSCL
                     ASLFTDRAISYRASRGFDHLKVALSVGVQKMVRADKGSAGVMFSIDTETGFKDAVFIT
                     SAWGLGENVVGGTINPDEFYVFKPTLEQNKRPIIKRQLGNKTQKMVYAPRGSEHPTRN
                     IKTTKKEWQSFSLSDEDVLILAKYAIEIEKHYSKEAKQYRPMDIEWAKDGDSGEIFIV
                     QARPETVQSQKTKEESQVFEKFKFKNPNEKKEIILQGRAIGSKIGSGKVRIINDLEHM
                     NSFKEGEILVTDNTDPDWEPCMKKASAVITNRGGRTCHAAIVAREIGVPAIVGVSGAT
                     DSLYTGMEITVSCAEGEEGYVYAGIYEHEIERVELSNMQETQTKIYINIGNPEKAFSF
                     SQLPNHGVGLARMEMIILNQIKAHPLALVDLHHKKSVKEKNEIENLMAGYANPKDFFV
                     KKIAEGIGMISAAFYPKPVIVRTSDFKSNEYMRMLGGSSYEPNEENPMLGYRGASRYY
                     SESYNEAFSWECEALALVREEMGLTNMKVMIPFLRTIEEGKKVLEILRKNNLESGKNG
                     LEIYIMCELPVNVILADDFLSLFDGFSIGSNDLTQLTLGVDRDSELVSHVFDERNEAM
                     LKMFKKAIEACKRHNKYCGICGQAPSDYPEVTEFLVKEGITSISLNPDSVIPTWNAVA
                     KLEKELKDHGLTAH"
     gene            122297..122428
                     /locus_tag="HPSH112_RS00605"
                     /old_locus_tag="HPSH112_00585"
     CDS             122297..122428
                     /locus_tag="HPSH112_RS00605"
                     /old_locus_tag="HPSH112_00585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206922.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001871589.1"
                     /translation="MYRRLLLNLFCMVFLQACLKPMSDPKAEKVDSQVQCGFGSKDC"
     gene            122470..124308
                     /locus_tag="HPSH112_RS00610"
                     /old_locus_tag="HPSH112_00590"
     CDS             122470..124308
                     /locus_tag="HPSH112_RS00610"
                     /old_locus_tag="HPSH112_00590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine--tRNA ligase"
                     /protein_id="WP_001271870.1"
                     /translation="MSAELIAVYKDEQIIDLESAKVLGLSDGVKALNGTEPIYFDDSP
                     LALEVIRHSCAHLLAQSLKALYPDAKFFVGPVVEEGFYYDFKTASKISEEDLPKIEAK
                     MKEFAKLKLTITKEVLTREQALERFKGDELKHAVMSKISGDVFGVYQQGEFEDLCKGP
                     HLPNTRFLNHFKLTKLAGAYLGGDENNEMLIRIYGIAFATKEGLKDYLFQMEEAKKRD
                     HRKLGVELGLFSFDDEIGAGLPLWLPKGARLRKRIEDLLSKALLLRGYEPVKGPEILK
                     SDVWKISGHYDNYKENMYFTTIDEQEYGIKPMNCVGHIKVYQSALHSYRDLPLRFYEY
                     GVVHRHEKSGVLHGLLRVREFTQDDAHIFCSFEQIQSEVSAILDFTHKIMQAFDFSYE
                     MELSTRPAKSIGDDKVWEKATNALKEALKEHRIDYKIDEGGGAFYGPKIDIKITDALK
                     RKWQCGTIQVDMNLPERFKLAFTNEHNHAEQPVMIHRAILGSFERFIAILSEHFGGNF
                     PFFVAPTQIALIPINEEHRAFALKLKEELKKRDIFVEVLDKNDSLNKKVRLAEKQKIP
                     MILVLGNEEVGTEILSIRDREKQAQYKMPLKEFLNMVESKMQEVSF"
     gene            124305..124916
                     /locus_tag="HPSH112_RS00615"
                     /old_locus_tag="HPSH112_00595"
     CDS             124305..124916
                     /locus_tag="HPSH112_RS00615"
                     /old_locus_tag="HPSH112_00595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206924.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_000089221.1"
                     /translation="MSRNEVLLNGDINFKEVRCVGDNGEVYGIISSKEALNIAQNLGL
                     DLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQKQIEIKEIKLSTQIAQNDINY
                     KVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQDLANPEKEPKTEGR
                     FVSWMFVPKAKETPKNEKKTKENNPPFNRINLMKGENHAKNED"
     gene            124897..125091
                     /locus_tag="HPSH112_RS00620"
                     /old_locus_tag="HPSH112_00600"
     CDS             124897..125091
                     /locus_tag="HPSH112_RS00620"
                     /old_locus_tag="HPSH112_00600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206925.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_001125542.1"
                     /translation="MPKMKTNRGASKRFKVKKNLIKRGSAFKSHILTKKSPKRKANLN
                     APKHVHHTNAHSVMSLLCRA"
     gene            125186..125536
                     /locus_tag="HPSH112_RS00625"
                     /old_locus_tag="HPSH112_00605"
     CDS             125186..125536
                     /locus_tag="HPSH112_RS00625"
                     /old_locus_tag="HPSH112_00605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206926.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_001264172.1"
                     /translation="MRVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYY
                     AFRDRKQKKREFRSLWVVRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDM
                     QAFESVLESVKEHL"
     gene            125737..126597
                     /locus_tag="HPSH112_RS00630"
                     /old_locus_tag="HPSH112_00610"
     CDS             125737..126597
                     /locus_tag="HPSH112_RS00630"
                     /old_locus_tag="HPSH112_00610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206927.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000750206.1"
                     /translation="MKKSVIVGAISLAMTSLLSAETPKQEKAIKTSPTKKGERNAAFI
                     GIDYQLGMLSTTAQNCSHGNCNGNQSGAYGSNTPNMPTASNPTGGLTHGVLGTRGYKG
                     LSNQQYAINGFGFVVGYKHFFKKSPQFGMRYYGFFDFASSYYKYYTYNDYGMRDARKG
                     SQSFMFGYGAGTDVLFNPAIFNRENLHFGFFVGVAIGGTSWGPTNYYFKDLADEYRGS
                     FHPSNFQVLVNGGIRLGTKHQGFEIGLKIQTIRNNYYTASADNVPEGVTYKFTFHRPY
                     AFYWRYIVSF"
     gene            126649..126774
                     /locus_tag="HPSH112_RS00635"
                     /old_locus_tag="HPSH112_00615"
     CDS             126649..126774
                     /locus_tag="HPSH112_RS00635"
                     /old_locus_tag="HPSH112_00615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206928.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000896436.1"
                     /translation="MAFYGFLASKALKNQYGYLAKIKAQSLQAIELTNNSTQTSL"
     gene            126950..127381
                     /locus_tag="HPSH112_RS00640"
                     /old_locus_tag="HPSH112_00620"
     CDS             126950..127381
                     /locus_tag="HPSH112_RS00640"
                     /old_locus_tag="HPSH112_00620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000731667.1"
                     /translation="MKKLAFSLLFTGTFLGLFLNASDFKSMDDKQLLEQAGKVAPSEV
                     PEFRAEINKRLAVMKEEERKSYKADFKKAMDKNLASLSQEDRNKRKKEILEAIANKKK
                     TMTMKEYRQEGLDLHDCACEGPFHDHEKKGRKGKQSSHHKH"
     gene            complement(127626..127864)
                     /locus_tag="HPSH112_RS08160"
                     /pseudo
     CDS             complement(127626..127864)
                     /locus_tag="HPSH112_RS08160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001894565.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            127788..128657
                     /locus_tag="HPSH112_RS00645"
                     /old_locus_tag="HPSH112_00625"
     CDS             127788..128657
                     /locus_tag="HPSH112_RS00645"
                     /old_locus_tag="HPSH112_00625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017279999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000821527.1"
                     /translation="MKRILFFLVATAFLLRAETDSATINTTIDPNVMFSESSTGNVKK
                     DRKRVLKSMVNLEKERVKNFNQYSETKMSKGDLSAFGAFFKGSLESCVDQKICYYEHK
                     NGKVSFVVNDREKFYKHVLKDLGTELSLPLFNWLYKGSDFGALHEQFGDMYDGYIKYL
                     ISMVRVSQKEKTRKLDAVTLKKMEDQAEKDTKAAFQKRSNGELESHTDSPEFISSSKK
                     TQNASNPDLDSTTNANALKEIASKEPEISSKKEEKSKKKRRLSKKERQQQALQQEFER
                     QISDSSKSENIAK"
     gene            complement(128832..129020)
                     /locus_tag="HPSH112_RS08165"
     CDS             complement(128832..129020)
                     /locus_tag="HPSH112_RS08165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001247063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024683.1"
                     /translation="MLRKLVGAGSFILIVKTLKRHQFDYRYSIKNFYKLYKMRWNVLS
                     LTLSIAIFQRFLRNKTLS"
     gene            complement(129267..130634)
                     /locus_tag="HPSH112_RS00650"
                     /old_locus_tag="HPSH112_00630"
     CDS             complement(129267..130634)
                     /locus_tag="HPSH112_RS00650"
                     /old_locus_tag="HPSH112_00630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206932.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine ammonia-lyase"
                     /protein_id="WP_000146057.1"
                     /translation="MASFSILSIFKIGVGPSSSHTIGPMEAGARFCGLLKGVLEQVMR
                     VQITLHGSLALTGKGHLSDEAVLIGLHGIYANELEVTTKKALLHEALENKVLKLANQH
                     CIHFDYSKDLIFDNKPLARHQNALILKAFNSKNEVLKEETYYSVGGGFVYTEKELDNL
                     SEEGENESVAYDFSSAKELLELCQKHQKNIAEIVRLREDALKNRPDAMMAKIYHAMFE
                     CYDNGANSKEKYLPGSLRVTRLAPSIKTRLEKHPTSGKDPLALIDYISLYARAIAEEN
                     ASGGKVVTAPTNGACAVVPSVLLYAKNHLFENLSQKAINDFLLTSAAIGYLYKKNASL
                     SGAEAGCQAEIGVASSMAAGGLACLCQATTQQVLIASEIAMEHHLGLTCDPVGGLVQI
                     PCIERNVLGAIKAISASKLALEDEYKPKVSLDEVIATMYATGKDMNEKYKETSLGGLA
                     KTLKC"
     gene            complement(130634..131875)
                     /locus_tag="HPSH112_RS00655"
                     /old_locus_tag="HPSH112_00635"
     CDS             complement(130634..131875)
                     /locus_tag="HPSH112_RS00655"
                     /old_locus_tag="HPSH112_00635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HAAAP family serine/threonine permease"
                     /protein_id="WP_000046343.1"
                     /translation="MAQEKALIRDPKKLNAFDLRWMASLFGTAVGAGILFLPIRAGGH
                     GIWAIVVMSAIIFPLTYLGHRALAYFIGSKDKEDITMVVRSHFGAQWGFLITLLYFFA
                     IYPICLAYGVGITNVFDHFFTNQLHLAPFHRGLLAVALVSLMMLVMVFNATIVTRICN
                     ALVYPLCLILLLFSLYLIPYWQGANLFVVPSFKEFVLAIWLTLPVLVFSFNHSPIIST
                     FTQNVEKEYGAFKEYKLNQIELGTSLMLLGFVMFFVFSCVMCLNADDFVKAREQNIPI
                     LSYFANTLNNPLINYAGPVVAFLAIFSSFFGHYYGAKEGLEGIIIQSLKLKKTSKTLS
                     VSVTIFLWLTITLVAYINPNILDFIENLGGPIIALILFVMPMIAFYSISSLKRFRNLK
                     VDIFVFVFGSLTALSVFLGLF"
     gene            132057..133406
                     /locus_tag="HPSH112_RS00660"
                     /old_locus_tag="HPSH112_00645"
     CDS             132057..133406
                     /locus_tag="HPSH112_RS00660"
                     /old_locus_tag="HPSH112_00645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-7-phosphoheptulonate synthase class II"
                     /protein_id="WP_000072722.1"
                     /translation="MSNTTWSPASWHSFKIEQHPTYKDKQELERVKKELRSYPPLVFA
                     GEARNLQERLAQVIDNKAFLLQGGDCAESFSQFSANRIKDMFKVMMQMAIVLTFAGSI
                     PIVKVGRIAGQFAKPRSNATEILDNEEVLSYRGDIINGISKKEREPNPERMLKAYHQS
                     VATLNLIRAFAQGGLANLEQVHRFNLDFVKNNDFGKKYQQIADRITQALGFMQACGVE
                     IEKTPILREVEFYTSHEALLLHYEEPLVRKDSLTDQFYDCSAHMLWIGERTRDPKGAH
                     VEFLRGVCNPIGVKIGPNASVSEVLELCDVLNPCNIKGRLNLIVRMGSKMIKERLPKL
                     LQGVLKEKRHILWSIDPMHGNTVKTSLGVKTRAFDSVLDEVKSFFEIHRAEGSLASGV
                     HLEMTGENVTECIGGSQAITEEGLSCHYYTQCDPRLNATQALELAFLIADMLKKQRA"
     gene            133485..133619
                     /locus_tag="HPSH112_RS00665"
                     /old_locus_tag="HPSH112_00650"
     CDS             133485..133619
                     /locus_tag="HPSH112_RS00665"
                     /old_locus_tag="HPSH112_00650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001222904.1"
                     /translation="MRISLLAVILALLFVACRETKQQILQNEADSTPSEKTIWQPEQK
                     "
     gene            complement(133849..134307)
                     /locus_tag="HPSH112_RS00670"
                     /old_locus_tag="HPSH112_00660"
     CDS             complement(133849..134307)
                     /locus_tag="HPSH112_RS00670"
                     /old_locus_tag="HPSH112_00660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peroxiredoxin"
                     /protein_id="WP_000412973.1"
                     /translation="MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTP
                     GCTLEAKDFSDLFSEFEKKNAVVVGVSPDNAQSHQKFISQCSLNVILLCDEDKKAANL
                     YKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL"
     gene            complement(134317..134952)
                     /locus_tag="HPSH112_RS00675"
                     /old_locus_tag="HPSH112_00665"
     CDS             complement(134317..134952)
                     /locus_tag="HPSH112_RS00675"
                     /old_locus_tag="HPSH112_00665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate utilization protein C"
                     /protein_id="WP_000032027.1"
                     /translation="MSKELILKRIKEARAKHAIQGANPAYRNIIKVEFEDLVEEYKHF
                     QVLNKAEVIESAKENLEQAILKALENFKSKKVLHSTDLNLNFEAFKDFTLQPYDKEIE
                     AMREELFEIDTALLHGVCGISSLGMIGAVSSHASPRLLSLITLNCIILLKKESIVRNL
                     SEGMQALKNQSKNGVLPTNMLLIGGPSRTADIELKTVFGVHGPQKVAIILY"
     gene            complement(134945..136390)
                     /locus_tag="HPSH112_RS00680"
                     /old_locus_tag="HPSH112_00670"
     CDS             complement(134945..136390)
                     /locus_tag="HPSH112_RS00680"
                     /old_locus_tag="HPSH112_00670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206938.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster-binding protein"
                     /protein_id="WP_000417266.1"
                     /translation="MEKYHSDQEYEEIITDQLGDMQLRENLRSAMDTLRANRKNLIKN
                     RYSEWENLRELGKEVKLKILSRLDEYLELFEKNATQNGFKIHYAKDGDEANEIIYNLA
                     KEKNIKRILKQKSMASEEIGLNHYLKEKGIQAQETDLGELIIQLINEHPVHIVVPAIH
                     KNRKQIGKIFEEKLNAAYEEEPEKLNAIARKHMRKEFESFKMGISGVNFAIANEGAIW
                     LVENEGNGRMSTTACDVHVAICGIEKLVESFDDAAILNNLLAPSAVGVPITCYQNIIT
                     GPRKEGDLDGPKEAHIILLDNNRSNILADEKYYRALSCIRCGTCLNHCPVYDKIGGHA
                     YLSTYPGPIGVVVSPQLFGLNNYGHIPNLCSLCGRCTEVCPVEIPLAELIRDLRSDKV
                     GEGRGVVKGAKSTQHGGMEKFSMKMFAKMASDGAKWRFQLKMAQFFSPLGKLLAPILP
                     LVKEWASVRTLPNMDTSLHAKVQHLEGVIYE"
     gene            complement(136419..137147)
                     /locus_tag="HPSH112_RS00685"
                     /old_locus_tag="HPSH112_00675"
     CDS             complement(136419..137147)
                     /locus_tag="HPSH112_RS00685"
                     /old_locus_tag="HPSH112_00675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_000867260.1"
                     /translation="MKVNFFATCLGAAIYSNASLNAIKLLRKENLEVVFKKDQTCCGQ
                     PSYNSGYYEETKKVVLYNIKLYSNNDYPIILPSGSCTGMMRHDYLELFEGHAEFNMVK
                     DFCSRVYELSEFLDKKLQVKYEDKGEPLKITWHSNCHALRVAKVIDSAKNLIRQLKNV
                     ELIELEKEEECCGFGGTFSVKEPEISAVMVKEKIKDIESRQVDVIVSADAGCLMNIST
                     AMQKMGSPTKPMHFYDFLASRLGL"
     gene            137368..139017
                     /locus_tag="HPSH112_RS00690"
                     /old_locus_tag="HPSH112_00680"
     CDS             137368..139017
                     /locus_tag="HPSH112_RS00690"
                     /old_locus_tag="HPSH112_00680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017280007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate permease"
                     /protein_id="WP_000398112.1"
                     /translation="MEFYQVYDPLGNIWLSALVALSPIVLFFISLIVFKLKGYSAGFL
                     SLVLSIIIALFVYKMPAQMVSASFFYGFLYGLWPIAWIVIAAIFLYNLSVKSGYFEIL
                     KESILTLTPDHRILVILIGFCFGSFLEGAIGFGGPVAITAAILVGLGLNPLYAAGLCL
                     IANTAPVAFGAVGIPITAMASVVGIPELEISQMVGRVLPIFSIGIPFFIVFLMDGFKG
                     IRETFPAVAVTGFSFAIAQFLSSNYLGPQLPDIISALVSLIATTLFLKFWQPKRIFTS
                     NGKEPAISTEKHHICKVVVAWMPFVLLTITIIIWTQPWFKALFKEGGALAFSSFAFEF
                     NSISQKIFKTVPIVTEATNFPVVFKFPLILTTGTSIFLAALLSVFLLRVKISDAIGVF
                     GATLKEMRLPILTIGVVLAFAYVANYSGMSATLALALADTGHVFTFFSPVVGWLGVFL
                     TGSDTSSNLLFGSLQMLIATQLGLPEVLFLAANTSGGVVGKMISPQSIAIACAAVGLV
                     GKESELFRFTVKYSIALAIIMGIVFTLIAYVFPFIIPVTPT"
     gene            139066..140721
                     /locus_tag="HPSH112_RS00695"
                     /old_locus_tag="HPSH112_00685"
     CDS             139066..140721
                     /locus_tag="HPSH112_RS00695"
                     /old_locus_tag="HPSH112_00685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate permease"
                     /protein_id="WP_001288505.1"
                     /translation="MSEFHQVYDPLGNIWLSALVALLPILLFFLSLMVFKLKGYAAAF
                     LSVVLSAIIAVLVYKMPVSMVGSSFLYGFLYGLWPIAWIIIAAIFLYKLSVKSGYFEI
                     LKESVQSITLDHRILVILIGFCFGSFLEGAIGFGGPIAITAAILVGLGLSPLYAAGLC
                     LIANTAPVAFGAVGIPISAMASAVGVPAILISAMTGKILFFVSLFVPFFIVFLMDGFK
                     GIKETFPAVFIAAFSFAIAQFLSSNYLGPELPGIISALVSLVATALFLKFWQPKVIFR
                     SDGKAASFTKSNHHICKIYVAWSPFVILVLVIVLWIQPFFKALFEKDGLLAFSNFYFE
                     FNNISNHIFKSPPFVESDQSASFPVVFKFSLINTVGTSIFLAALISILVLRVRVSDAL
                     SVFGETLKEMRYPILTIGLVLSFAYVSNYSGISSTLALALTHTGLAFTFFSPLIGWVG
                     VFLTGSDTSSNLLFGSLQQLTAQRLHLPEILTLTANTVGGTLGKMISPQSIAIACAAV
                     GLAGKESNLFKFTVKYSLIFVAIMGVVISAIAYLIPEVVPAIK"
     gene            complement(140745..141731)
                     /locus_tag="HPSH112_RS00700"
                     /old_locus_tag="HPSH112_00690"
     CDS             complement(140745..141731)
                     /locus_tag="HPSH112_RS00700"
                     /old_locus_tag="HPSH112_00690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206942.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine-specific DNA glycosylase"
                     /protein_id="WP_080024684.1"
                     /translation="METLHNALLKWYEEFGRKDLPFRNLKGINAPYEVYISEVMSQQT
                     QISTVVKRFYSPFLEAFPTLKDLASAQLEEVLLLWRGLGYYSRAKNLKKSAEICVKEH
                     NSQLPNDYQSLLKLPGIGTYTANAILCFGFREKSACVDANIKRVLLRLFGLDPNITAK
                     DLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAICPLNPYCLGKNHPEKHTLKK
                     KQEIIQEEHYLGVVIQNNQIALEKIEQKLYFGMHHFPNLKENLEYKLPFLGAIKHSHT
                     KFKLNLNLYLAAIKDLKNPIRFYSLKDLETLPISSMTLKILNFLKQKNLFGG"
     gene            complement(141732..143180)
                     /locus_tag="HPSH112_RS00705"
                     /old_locus_tag="HPSH112_00695"
     CDS             complement(141732..143180)
                     /locus_tag="HPSH112_RS00705"
                     /old_locus_tag="HPSH112_00695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000742931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000595282.1"
                     /translation="MIKQILSILAPFFIATLLYFLGAPDGLNPNAWLYFCIFMGMIIG
                     LVLEPVPPGLVALSALVLCVALKIGASDEVASANKAISWGLSGYANKTVWLVFVAFIL
                     GLGYEKSLLGKRIALLLIRFLGQTPLGLGYAIGLSELCLAPFIPSNSARSGGILYPIV
                     SSIPPLMGSAPNDNPDKIGAYLMWVALASTCITSSMFLTALAPNPLAMEIATKMGVNE
                     ISWFSWFLAFLPCGVVLILLAPLLAYKTCKPTLKGSKEVSLWAKKELEGMGRFSLKEI
                     LMLSLTLLALLGWIFSKPLGLAASATALIVMVLMAFCKIVSYEDIIKNKSAFNIFLLL
                     GSLLTMAGGLKNVGFLNFIGNAAKNFLEHANLDPLIAVLFIIAFFYLSHYFFASITAH
                     VSALFALFVGIGSHIQGVNLQELSLFLMLSLGIMGILTPYGTGPSTIYYGSGYISSKD
                     FWKWGFIFGMVYLIVFLSVCVPWVKFIAYRWL"
     gene            143350..144816
                     /locus_tag="HPSH112_RS00710"
                     /old_locus_tag="HPSH112_00700"
     CDS             143350..144816
                     /locus_tag="HPSH112_RS00710"
                     /old_locus_tag="HPSH112_00700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit I"
                     /protein_id="WP_001157669.1"
                     /translation="MQENVPLSYDYSISKLFLYAMVGFGIIGMLIGIVLAFELSFPNL
                     NYIAGEYGVFGRLRPLHTNAVIYGFTLGGIWASWYYIGQRVLKITYHQHPFLKIVGLL
                     HFWLWITLLILGVISLFAGLTQSKEYAELMWPLDIVVVVAWVLWGVNMFGSMSVRREN
                     TIYVSLWYYIATYVGIAVMYIFNNLSIPTYFVADMGSVWHSISMYSGSNDALIQWWWG
                     HNAVAFVFTSGVIGTIYYFLPKESGQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTV
                     PDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQLKESPLIKFLVLASTFYMLSTL
                     EGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTTRLFKREIYSGRLV
                     DFQFWIMTLGIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKVLIPYYNIRGV
                     GGLMYFTGFIIFAYNIFMTITAGKKLEREPNYATPMSR"
     gene            144829..145527
                     /locus_tag="HPSH112_RS00715"
                     /old_locus_tag="HPSH112_00705"
     CDS             144829..145527
                     /locus_tag="HPSH112_RS00715"
                     /old_locus_tag="HPSH112_00705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206944.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit II"
                     /protein_id="WP_000490767.1"
                     /translation="MFSFLEKNPFFFTLAFIFVFAIAGLVEILPNFFKSARPIEGLRP
                     YTVLETAGRQIYIKEGCYHCHSQLIRPFQAEVDRYGAYSLSGEYAYDRPFLWGSKRIG
                     PDLHRVGDYRTTDWHEKHMFDPKSVVPHSIMPAYKHLFAKKSDFDTAYAEALTQKKVF
                     GVPYDTENGVKLGSVEEAKKAYLEEAKKITADMKDKRVLEAIERGEVLEIVALIAYLN
                     SLGNSRINANQNAK"
     gene            145535..145756
                     /locus_tag="HPSH112_RS00720"
                     /old_locus_tag="HPSH112_00710"
     CDS             145535..145756
                     /locus_tag="HPSH112_RS00720"
                     /old_locus_tag="HPSH112_00710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CcoQ/FixQ family Cbb3-type cytochrome c oxidase
                     assembly chaperone"
                     /protein_id="WP_000968958.1"
                     /translation="MMDLESVRGFAYAFFTILFTLFLYAYIFSMYRKQKKGIMDYERY
                     GRLALNDALEDELIEPRHKNAHDNGIKES"
     gene            145758..146636
                     /locus_tag="HPSH112_RS00725"
                     /old_locus_tag="HPSH112_00715"
     CDS             145758..146636
                     /locus_tag="HPSH112_RS00725"
                     /old_locus_tag="HPSH112_00715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000346857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit III"
                     /protein_id="WP_000346814.1"
                     /translation="MDFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELM
                     DNGHLIDGIGEFANNVPVGWIASYMCTIVWAFWYFFFGYPLNSFSQIGQYNEEVKAHN
                     QKFEAKWKNLGQKELVDMGQGIFLVHCSQCHGISAEGLHGSAQNLVHWGKEEGIMDTI
                     KHGSKGMDYLAGEMPAMELDEKDAKAIASYVMAEISSVKKTKNPQLIDKGKELFESMG
                     CTGCHGNDGKGLQENQVFAADLTTYGTENFLRNILTHGKKGNIGHMPSFKYKNFSDLQ
                     VKALAEFIQSLKPLED"
     gene            146647..146853
                     /locus_tag="HPSH112_RS00730"
                     /old_locus_tag="HPSH112_00720"
     CDS             146647..146853
                     /locus_tag="HPSH112_RS00730"
                     /old_locus_tag="HPSH112_00720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000670499.1"
                     /translation="MKFLNGLAGNLLIVVILLCVAVFFTFKAIHIQKEQATNYYRYKD
                     INALETKNTQNRANYELVNQGSKK"
     gene            146954..147538
                     /locus_tag="HPSH112_RS00735"
                     /old_locus_tag="HPSH112_00730"
     CDS             146954..147538
                     /locus_tag="HPSH112_RS00735"
                     /old_locus_tag="HPSH112_00730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001222054.1"
                     /translation="MRILWLVIAFVCCLGASDYVFNNSKGRLVEKSVAFVEGVSKELY
                     LKTGVRFVIDMTDFEKNPIVLALKNERQNYQEGFLKQLKPPFVVFFFYHDAQKIELVA
                     NPKDLLDTDKIFFEKIAPLLPTNPKEYTPQRISAMLINGYSVAVDALAQKYRVNITQN
                     FNAPKGATFVKVVIYILLLTLLGAFLGLYFFKKS"
     gene            147550..148131
                     /locus_tag="HPSH112_RS00740"
                     /old_locus_tag="HPSH112_00735"
     CDS             147550..148131
                     /locus_tag="HPSH112_RS00740"
                     /old_locus_tag="HPSH112_00735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000660354.1"
                     /translation="MKEKNFWPLGIMSVLILGLGIVVFLVVFALKNSPKNDLVYFKGH
                     NEVDLNFNAMFKTYENFKSNYRFLVGLKPLTEGSKTPILPYFSKGTHGDKKLQENLLK
                     NALILEKSNTLHAQLQPLKPALDSPNIQVYLAFYPSPSQPRLLGTLDCEIACEPLKFD
                     LLESDKRGRYKILFKFVFKNKEELILEQLAFFK"
     gene            148219..148986
                     /locus_tag="HPSH112_RS00745"
                     /old_locus_tag="HPSH112_00740"
     CDS             148219..148986
                     /locus_tag="HPSH112_RS00745"
                     /old_locus_tag="HPSH112_00740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000506304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000506354.1"
                     /translation="MGFLKVFKHDALGQVGNVVVGNFLITLTILAVCFYSQSAEETTM
                     LTLSYTLFFVLGAFLLIAISVGAIKNLNALFSKRGVLSFSLPISLESLLLPKILLPMV
                     FFIFSLFWFVASVRLGYYLFNAQSSVLFILHTALKTFVLKPTKTLGIALFLGLVLMKF
                     LFVLSVLNATRIKKARFLLGGLLFILVGVVLELAFNSLLPLMSSSLSINEGFYYFLQQ
                     QELQENKYYLLWGVDFLKILLLYAMSRYLLTHKLELD"
     gene            complement(148983..149846)
                     /locus_tag="HPSH112_RS00750"
                     /old_locus_tag="HPSH112_00745"
     CDS             complement(148983..149846)
                     /locus_tag="HPSH112_RS00750"
                     /old_locus_tag="HPSH112_00745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206951.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000626269.1"
                     /translation="MISVAHSPDADDIFMYYAIKFGWIDCPIKNKTFHNIALDIETLN
                     QEALKNTYDVSAISFGLYPKIANDYALLPTATSFGNGYGPKLVKKKGVKLKKDFRVAL
                     SGDHTTNALLFKIYYKHARITYMNFLDIEKAVLEGSVHAGVLIHENILDFHNGLEVEK
                     ELWDVWKELIKVDLPLPLGGMAIRRSIPLYRAILIKKALIKAVEVALKHQNLLSNMLL
                     ERSLIRVNMERLQTYLSLYANETSTRLSEIQILAIDKLFELGYQHGFYANLLKAKDCL
                     LTDEYLQYRFS"
     gene            149945..150988
                     /locus_tag="HPSH112_RS00755"
                     /old_locus_tag="HPSH112_00750"
     CDS             149945..150988
                     /locus_tag="HPSH112_RS00755"
                     /old_locus_tag="HPSH112_00750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206952.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination/repair protein RecA"
                     /protein_id="WP_000952101.1"
                     /translation="MAIDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVEKIDAISTG
                     SLGLDLALGIGGVPKGRIIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDV
                     HYAKRLGVDTENLLVSQPDTGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDM
                     GDQHVGLQARLMSHALRKITGVLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALK
                     FYASVRIDIRRIATLKQNEQHIGNRAKAKVVKNKVAPPFREAEFDIMFGEGISKEGEI
                     IDYGVKLDIVDKSGAWLSYQDKKLGQGRENAKALLKEDKALANEITLKIKESIGSNEE
                     IMPLPDEPLEEME"
     gene            151000..152280
                     /locus_tag="HPSH112_RS00760"
                     /old_locus_tag="HPSH112_00755"
     CDS             151000..152280
                     /locus_tag="HPSH112_RS00760"
                     /old_locus_tag="HPSH112_00755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="WP_000955633.1"
                     /translation="MLTIKDIHALEVMDSRGNPTIQASVILSDNTKASAIVPSGASTG
                     KREALELRDNDKTRFLGKGVLRACENVNSVIKHHLIGLEAINQAFVDERLRALDGTPN
                     YANLGANAVLGVSMALARASAKALNLPLYRYLGGANALTLPVPMLNIINGGTHANNSI
                     DFQEYMIMPLGFESFREALRASAEVYHTLKELLDGKNQLTSVGDEGGFAPNFNNNVEP
                     LEVISQAIEKAGYKLGEEIALALDVASSELVDENFNYHLKGENKILDSHELVAYYKKL
                     VAKYPIVSIEDGLSEDDWEGWAFLSKELGRQIQLVGDDLFVTNASLLQKGIEKNIANA
                     ILIKPNQIGTISETLETIRLAKHHAYQCVMSHRSGESEDSFIADFAVALNTGEIKTGS
                     TARSERIAKYNRLLEIEHELKGGIYIGKELFKHG"
     gene            152273..152548
                     /locus_tag="HPSH112_RS00765"
                     /old_locus_tag="HPSH112_00760"
     CDS             152273..152548
                     /locus_tag="HPSH112_RS00765"
                     /old_locus_tag="HPSH112_00760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000146217.1"
                     /translation="MASGLFENDEIKDNKVRDFFYSHSSLIVFFLLLLGFGYYLGKLL
                     FGGSSLEVYLDLRDKHERLQQEITELQSKNVRLQKRLFELRELRPRD"
     gene            152558..153160
                     /locus_tag="HPSH112_RS00770"
                     /old_locus_tag="HPSH112_00765"
     CDS             152558..153160
                     /locus_tag="HPSH112_RS00770"
                     /old_locus_tag="HPSH112_00765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMIN domain-containing protein"
                     /protein_id="WP_000636399.1"
                     /translation="MIVLKKMVGLVVVLSVLLARDNPFEPEINSKNLQGGFNGIYDSY
                     FKEIHVDLPTSARILKQITLTYQDIDGSIHSKVVGIDKNIDWHYPLKLSQHPLDPAAF
                     EKRYQIQDFDFSMANNTMILRSPYKILRSFVLVNPYRIVLDTQKGPLDIYQNRDLNQK
                     FFSQIKVGTHKDYYRITLILDGKYRYLLEEKNGAYELKLK"
     gene            153165..153653
                     /locus_tag="HPSH112_RS00775"
                     /old_locus_tag="HPSH112_00770"
     CDS             153165..153653
                     /locus_tag="HPSH112_RS00775"
                     /old_locus_tag="HPSH112_00770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="WP_001216267.1"
                     /translation="MRHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSV
                     RGIFEELGEDNFRMFEKNLIDELKTLKTPHIISTGGGIVMHDNLKGLGTTFYLKMDFE
                     TLIKRLNQKEREKRPLLNDLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQF
                     IA"
     gene            153675..154631
                     /locus_tag="HPSH112_RS00780"
                     /old_locus_tag="HPSH112_00775"
     CDS             153675..154631
                     /locus_tag="HPSH112_RS00780"
                     /old_locus_tag="HPSH112_00775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000952256.1"
                     /translation="MLSRDIVQYSKIRTELYAYLTYLFSHNIRNHLPEITLDYLNKQI
                     KKMHAEIKMAKNFFVLDAKGMLILKPSQLKEQGHKEGILEHDLTEGIELESHASFSDK
                     YYFYQAVSEKRCILTDPYPSKKGNHLVVSASYPVYDQNNDLAFVVCLQIPLRVAIEIS
                     SPSKYFRTFSEGSMVMYFMISIMLTLVSLLLFVKCISSFWTAIVNFSSFDIKEVFHPI
                     VLLTLALATFDLVKAIFEEEVLGKNSGDNHHAIHRTMIRFLGSIIIALAIEALMLVFK
                     FSVSEPDKITYAVYLAIGVAVLLISLAIYVKFAYSVLPKRER"
     gene            complement(154628..155749)
                     /locus_tag="HPSH112_RS00785"
                     /old_locus_tag="HPSH112_00780"
     CDS             complement(154628..155749)
                     /locus_tag="HPSH112_RS00785"
                     /old_locus_tag="HPSH112_00780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS 1,2-glucosyltransferase"
                     /protein_id="WP_000022434.1"
                     /translation="MSIIIPIVIAFDNNYVIPAGVSLYSMLACAKVENPQSQNDSKKL
                     FYKIHCLVDNLSLENQRKLKETLAPFSAFMSLEFLDISTPNLHTTSIEELSAIDKINE
                     AFLQLNIYAKTRFSKMVMCRLFLASLFLQYDKIIMFDADTLFLNDVSESFFIPLDGYY
                     FGAAKDFSSPKSPKHFQMERERAPRQAFSLYEHYLKEKDIKILYENHYNVGFLIVNLK
                     LWRADRLEERLLNLTRQKGQCVFCPEQDLLTLACYQKVLILPYIYNTHPFMANQKRFI
                     PNRQEIVMLHFYFVGKPWISPTALYSKEWHETLLKTSFYAKYSVKFLKQMTEFLSLKD
                     KQKTFEFLAPLLNPKTLLEYVFFRLNRIFKRLKEKFFNS"
     gene            155900..156817
                     /locus_tag="HPSH112_RS00790"
                     /old_locus_tag="HPSH112_00785"
     CDS             155900..156817
                     /locus_tag="HPSH112_RS00790"
                     /old_locus_tag="HPSH112_00785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 repeat protein HcpD"
                     /protein_id="WP_000597861.1"
                     /translation="MIKSWTKKWVFIWLVVAGCFSHLMATTGEAYFKMATQAFKRGDY
                     HKAVAFYKRSCNLRVGVSCTSLGSMYEDGDGVDQNIPKAVFYYRRGCNLMNHLACASL
                     GSMYEDGDGVQKNLPKAIYYYRRGCHLKGGVSCGSLGFMYFNGTGVKQNYAKALSLSK
                     YACSLNYGISCNFTGYMYRNAKGAEKDLKKALTNFKRGCHLKDGASCVSLGYMYEAGL
                     YVRQSEGQALNLYKKGCSLKEGSGCHNVAVMYYTGKGAPKDLDKATSYYKKGCTLGFS
                     GSCKVLEMVGKNSDNLQDDAQNDTQDDTQ"
     gene            complement(157571..158293)
                     /locus_tag="HPSH112_RS00795"
                     /old_locus_tag="HPSH112_00795"
     CDS             complement(157571..158293)
                     /locus_tag="HPSH112_RS00795"
                     /old_locus_tag="HPSH112_00795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YebC/PmpR family DNA-binding transcriptional
                     regulator"
                     /protein_id="WP_000532140.1"
                     /translation="MGRAFEYRRAAKEKRWDKMSKVFPKLAKAITLAAKEGGSEPDTN
                     AKLRTAILNAKVQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNP
                     TRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALID
                     YGLEELEEVEDKIIIRGDYNSFKLLNEGFESLRLPILKASLQRIATTPIELNDEQMEL
                     TEKLLDRIEDDDDVVALYTNIE"
     gene            complement(158294..159265)
                     /locus_tag="HPSH112_RS00800"
                     /old_locus_tag="HPSH112_00800"
     CDS             complement(158294..159265)
                     /locus_tag="HPSH112_RS00800"
                     /old_locus_tag="HPSH112_00800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="WP_000476543.1"
                     /translation="MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNE
                     INSMPGVYQMSVEPLLKECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKAAR
                     EVKKRFKDLIVIVDLCFCEYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDIL
                     APSNMMDGNVLSLRKTLDNAGYTHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSY
                     QMDYANKKEALLESLEDEKQGADILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYA
                     MLKLAQKHNLINYESVLLETMTCFKRAGADMIISYHAKEMANLLQRN"
     gene            complement(159288..160619)
                     /locus_tag="HPSH112_RS00805"
                     /old_locus_tag="HPSH112_00805"
     CDS             complement(159288..160619)
                     /locus_tag="HPSH112_RS00805"
                     /old_locus_tag="HPSH112_00805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001212428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_001212428.1"
                     /translation="MRFSIFFKVVALFMITLFSFGAFAYYFVSSQINHENYQNEMRHY
                     QFVTTINEILNNYSDYRAIEDYLYKIGFKETTMENLEKVLAKRRHQLHHRNIGYAEVF
                     KFSDMVFILLKKDEHFVLYKDLHSVSYKNYFLAITVGLLLILFLFLFVLQSLLPLREL
                     RSQVKRFAQGDKSVSCKSKQKDEIGDLANEFDNCIQKINAMNESRILFLRSIMHELRT
                     PITKGKILSSMLKEELSYKRLSSIFDHLNMLIEQFARIEQFASKNYGSNKEKFLMSDL
                     IDKIEKMLLIDEDKKSPIHVPSSNYIIEADFELFSIALKNMVDNAIKYSDDKQVFLDF
                     IGNNLVVSNKSEPLKEDFEKYLQPYFKSSNPSQAHGFGLGMYIIKNALEAMGLNLSYH
                     YSNGRICFTIHDCVFNHFYDLEEDDEEPTPPPRKFERGERNEGDRKSQLWG"
     gene            complement(160645..161322)
                     /locus_tag="HPSH112_RS00810"
                     /old_locus_tag="HPSH112_00810"
     CDS             complement(160645..161322)
                     /locus_tag="HPSH112_RS00810"
                     /old_locus_tag="HPSH112_00810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_000573717.1"
                     /translation="MIEVLMIEDDIELAEFLSEFLLQHGIHVTNYDEPYTGISAANTQ
                     NYDLLLLDLTLPNLDGLEVCRRISKQKHIPIIISSARSDVEDKIKALDYGADDYLPKP
                     YDPKELLARIQSLLRRSHKKEEVSEPSDANIFRVDKDSREVYMHEKKLDLTRAEYEIL
                     SLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRG
                     IGYKLEY"
     gene            complement(161557..162030)
                     /locus_tag="HPSH112_RS00815"
                     /old_locus_tag="HPSH112_00815"
     CDS             complement(161557..162030)
                     /locus_tag="HPSH112_RS00815"
                     /old_locus_tag="HPSH112_00815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000919002.1"
                     /translation="MAGRMELKNIISETLNEIEKMAKTIGDGFDTAQKTPSFFKTPQD
                     LQNTPSSQNANAPLEPKNAAKIETQEKITEEKEETPEIITEEIAQENPMQALIPNERV
                     FLKGLLERTLVLFKGMQALEEKEALKRLDLVARFLQYQLSVLEKRLESLERENTE"
     gene            complement(162009..162272)
                     /locus_tag="HPSH112_RS00820"
                     /old_locus_tag="HPSH112_00820"
     CDS             complement(162009..162272)
                     /locus_tag="HPSH112_RS00820"
                     /old_locus_tag="HPSH112_00820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001127852.1"
                     /translation="MPLETITLASIYEEQGFFEEALQIYTNILKKTPDHTEALKQIKR
                     LEKIQKNLAPFKHDATLERHYLNFIKGDYLSVENLEKWLVEWN"
     gene            complement(162305..163585)
                     /locus_tag="HPSH112_RS00825"
                     /old_locus_tag="HPSH112_00825"
     CDS             complement(162305..163585)
                     /locus_tag="HPSH112_RS00825"
                     /old_locus_tag="HPSH112_00825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015643230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase-like protease"
                     /protein_id="WP_001077531.1"
                     /translation="MNQVELLSPAGNLKKLKIALSYGADAVYGGVSHFSLRNRASKEF
                     TLKTFKEGIDYAHALNKKVYATINGFPFNSQLKLLEEHIYKMAELEPDAFIIAAPGVI
                     KLALKIAPHIPIHLSTQANVLNLLDAQVFYDLGVKRIVCARELSLNDAIEIKKALPDL
                     ELEIFVHGSMCFAFSGRCLISALQKGRVPNRGSCANDCRFDYEYYVKNPDNGVMMRLV
                     EEEGVGTHIFNAKDLNLSNHIAEILSSNAISALKIEGRTKSSYYAAQTTRIYRLAVDD
                     FYNNTLKPSFYASELNTLKNRGFTDGYLMRRPFERLDTQNHQTAISEGDFQVNGEITE
                     DGRFFACKFTTTTNAAYEIIAPKNAAITPIVNEIGKIYTFEKRSYLVLYKILLENNTE
                     LETIHSGNVNLVRLPAPLPAFSFLRTQVEPKNGV"
     gene            complement(163588..164307)
                     /locus_tag="HPSH112_RS00830"
                     /old_locus_tag="HPSH112_00830"
     CDS             complement(163588..164307)
                     /locus_tag="HPSH112_RS00830"
                     /old_locus_tag="HPSH112_00830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000189984.1"
                     /translation="MTQEELDALMNGGDLENLEALEAKEETKEEPKEVKENSNHSEKM
                     TVKKEDAEKYGKISPNEWPPPPPTEEHKVVHQLDDVTRDSEVKATQIFDQLDLIGASA
                     EKIAKMVKKIQEPLQKHQEIFDNLHSHFPNIESFKTALNEQQEILNALKSIEEEAANC
                     SDSSMQAMDIMQFQDIHRQKIERVVNVMRALSQYMNSLFEGKIDDSKRVSSATYITGD
                     DDKDLASADDIEALIASFGAK"
     gene            complement(164382..165473)
                     /locus_tag="HPSH112_RS00835"
                     /old_locus_tag="HPSH112_00835"
     CDS             complement(164382..165473)
                     /locus_tag="HPSH112_RS00835"
                     /old_locus_tag="HPSH112_00835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_000371099.1"
                     /translation="MDNYTYSELLKSLQNKCDNIALIIKPEKIKQELERIEKEQEDPN
                     FWQDVLKARDTNKEKVRLNRLLETYQKTKNSLDESTELFELAQNDNDEVTLSLLYEEA
                     PVLEHSVQKVEIEIMLSGENDASNAIITIQPGAGGTESQDWASILYRMYLRWAERRGF
                     KSEILDYQDGEEAGIKGVAFIIKGENAYGYLKNENGVHRLVRISPFDANAKRHTSFAS
                     VQISPELDDDIDIEIDEKDVRYDYYRASGAGGQHVNKTESAVRITHFPTGIVVQCQND
                     RSQHKNKASALKMLKSKLYELELEKQQSTAKNEEKSEIGWGHQIRSYVLAPYQQVKDA
                     RSNTAYSNVEAILDGDIDAILEGVLIAKA"
     gene            complement(165534..166709)
                     /locus_tag="HPSH112_RS00840"
                     /old_locus_tag="HPSH112_00840"
     CDS             complement(165534..166709)
                     /locus_tag="HPSH112_RS00840"
                     /old_locus_tag="HPSH112_00840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin molybdenumtransferase MoeA"
                     /protein_id="WP_000253360.1"
                     /translation="MVSFKEALKIHSSIPLEPLEIEIISLFESIGRILAEDIICIHAL
                     PKFNQSAMDGYGFKMQDLGKKTQVIQRIFAGDDVSALEVKENECVKIMTGAMVPKGIE
                     TIVPIECMLESHTNFALAPKDFKINANIRQKGENASLNSVLVPKNTRLNYGHIALIAS
                     QGLKEIKAFRKLKIALFSSGDELVPLGQNALECQVYDVNSVGIFNMLKNYNTHFLGVL
                     KDNKDLQLKPLESQDYDVILSSAGVSVGDKDFFKDALKEKNALFYYEKVNLKPGKPVT
                     LAKLNQSIIIGLPGNPLSCLLVLRVLILPLLERLSLNKDFKLKPFKAQINAPLKLKGE
                     RTHLILGNYSNNQFIPYNNNRYESGAIQALAQVDSIALIDEGVGLVQGEIEILRFEN"
     gene            complement(166719..167486)
                     /locus_tag="HPSH112_RS00845"
                     /old_locus_tag="HPSH112_00845"
     CDS             complement(166719..167486)
                     /locus_tag="HPSH112_RS00845"
                     /old_locus_tag="HPSH112_00845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="WP_000883704.1"
                     /translation="MLDFIQELSTPHVRDFFLLFLRVSGVLSFFPFFENHLVPLSVRG
                     ALSLYVSAIFYPTLEFSNAAYTPEGFIIACLCELFLGVCASIFLQIVFASLVFATDSI
                     SFSMGLTMASAYDPISGSQKPIVGQALLLLAILILLDLSFHHQIILFVDHSLKAVPLG
                     QFVFEPALAKNIIKAFSHLFVIGFSMAFPILCLVLLSDIIFGMIMKTHPQFNLLAIGF
                     PVKIAIGFVGIILIISAIMGRFKEEISLAFSTISKIF"
     gene            complement(167461..168255)
                     /locus_tag="HPSH112_RS00850"
                     /old_locus_tag="HPSH112_00850"
     CDS             complement(167461..168255)
                     /locus_tag="HPSH112_RS00850"
                     /old_locus_tag="HPSH112_00850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001238968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_001238970.1"
                     /translation="MRLNYPSKVSEEGFQVMVLSLSILKKSFNDFLSARMLLINLGPI
                     LLSLAFFGAVFYYNGANIVGYCQTLLPQSLNDYSHSQGFFAGVFAWVFKALVYFLVFW
                     IVILLSLVINIFASVFYTPLVVSYLHQKYYPHVVLEEFGSILFSIKYFLKSLIFMLLW
                     MAVLTPLYFIPFIGVFGVFFSIIPHFLFFKNTMSLDIASMIFNHQSYQNLLKQHRLKH
                     YRFSFFCYLFSLIPFFNFFATLLQTLMLTHYFFILKKKNARFYSRA"
     gene            complement(168246..168541)
                     /locus_tag="HPSH112_RS00855"
                     /pseudo
     CDS             complement(168246..168541)
                     /locus_tag="HPSH112_RS00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014534360.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            168688..169587
                     /locus_tag="HPSH112_RS00860"
                     /old_locus_tag="HPSH112_00855"
     CDS             168688..169587
                     /locus_tag="HPSH112_RS00860"
                     /old_locus_tag="HPSH112_00855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="WP_000739407.1"
                     /translation="MKKNILNLALVGALSASFLMAKPAHNANNATHNTKKTADSSAGV
                     LATVDGIPITKSDFDMIKQRNPNFDFDKLKEKEKEALIEQAIRTALVENEAKTEKLDQ
                     TPEFKAMMEAVKKQALVEFWAKKQAEEVKKIQIPEKEMQDFYNANKDQLFVKQEAHAR
                     HILVKTEDEAKRIISEIDKQPKTKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQ
                     MAPDFSKAAFALTPGNYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEK
                     LFQERMNQRIEELRKRAKIVINK"
     gene            169604..170527
                     /locus_tag="HPSH112_RS00865"
                     /old_locus_tag="HPSH112_00860"
     CDS             169604..170527
                     /locus_tag="HPSH112_RS00865"
                     /old_locus_tag="HPSH112_00860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_000960448.1"
                     /translation="MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPL
                     FIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVM
                     IDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIEDNISVDEKDAVLVNPKEA
                     EQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDG
                     VRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQ
                     FDLRKFFSPAQLALKNVVKERMKLLGSANKI"
     gene            170549..171112
                     /locus_tag="HPSH112_RS00870"
                     /old_locus_tag="HPSH112_00865"
     CDS             170549..171112
                     /locus_tag="HPSH112_RS00870"
                     /old_locus_tag="HPSH112_00865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_000974265.1"
                     /translation="MAIGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKS
                     FLDGKVIEKTFHAGDKCEEPNLVEKTMQYLYHDGDTYQFMDIESYEQIALNDSQVGEA
                     SKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNFKGDTSSASKKPATLETGAV
                     VQVPFHVLEGEIIKVNTETEEYLEKVK"
     gene            complement(171651..172679)
                     /locus_tag="HPSH112_RS00875"
                     /old_locus_tag="HPSH112_00870"
     CDS             complement(171651..172679)
                     /locus_tag="HPSH112_RS00875"
                     /old_locus_tag="HPSH112_00870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000941829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudaminic acid synthase"
                     /protein_id="WP_000941829.1"
                     /translation="MLQRPKIVAELSANHNQDLNLAKESLHAIKESGADFVKLQTYTP
                     SCMTLNSKEDPFIIQGTLWDKENLYELYQKASTPLEWHAELFELAKKLDLGIFSSPFS
                     SKALELLESLNCPMYKIASFEIVDLDLIEKVARTKKPIILSSGIATHTELQDAISLCK
                     GAGNFDITLLKCVSAYPSKIEDANLLSMVKLGETFGVKFGLSDHTIGSLCPILATTLG
                     ASMIEKHFILNKSLQTPDSAFSMDFNGFKSMVEAIKQSVLALGEEEPKINPKTLEERR
                     FFMRSLFVIKDIQKGEALTSDNIKALRPNLGLHPKFYKEILGQKASKFLKANTPLSAD
                     GIERSLQV"
     gene            complement(172683..173324)
                     /locus_tag="HPSH112_RS00880"
                     /old_locus_tag="HPSH112_00875"
     CDS             complement(172683..173324)
                     /locus_tag="HPSH112_RS00880"
                     /old_locus_tag="HPSH112_00875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000588227.1"
                     /translation="MIKAINISHAFEKPLYNGVNLHIKPKESLAILGVSGSGKSTLLS
                     HLATMLKPNSGTISLLEHQDIYALNSKKLLELRRLKVGIVFQSHYLFKGFSALENLQV
                     ASILAKQEIDHSLLEQLGIAHTLKQGVGELSGGQQQRLSIARVLSKKPKIIIADEPTG
                     NLDTTSANQVISMLQNYITEKEGALVLATHDEHLAFTCSQVYRLEKEVLIKEK"
     gene            complement(173324..174598)
                     /locus_tag="HPSH112_RS00885"
                     /old_locus_tag="HPSH112_00880"
     CDS             complement(173324..174598)
                     /locus_tag="HPSH112_RS00885"
                     /old_locus_tag="HPSH112_00880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206979.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_001236920.1"
                     /translation="MRLILFNQNAFLLACAFVSSVYANAVLDAYAVENPYVSITLTSL
                     LAPLSMLAFLKTPKNSAFALGFFVGVLLFYWCALSFRYSDFTYLLPLIIVLIALVYGV
                     LFYLLLYFENPYFRLLSFLGSSFIHPFGFDWLVPDSFFSYSVFRVDKLSLGLVFLACI
                     FLSAKQFKKYRIIAVLLLLSALDFNGFKTSDLKKVGNIELISTKTPQDLKFDSNYLNN
                     IENNILKEIKLAQSKQKTLIVFPETAYPIALENSPFKAKLEDLSGNIAILIGTLRTQG
                     YSLYNSSFLFSKESVQIADKVVLAPFGETMPLPEFLQKPLEKLFFGESAYLYRNASNF
                     SDFTLDDFTFRPLICYEGTSKPAYSNSSSKIFIVMSNNAWFSPSIEPTLQKTLLKYYA
                     RRYDKIILHSANFSTSYILNPSLLGDILFRKR"
     gene            174848..175549
                     /locus_tag="HPSH112_RS00890"
                     /old_locus_tag="HPSH112_00890"
     CDS             174848..175549
                     /locus_tag="HPSH112_RS00890"
                     /old_locus_tag="HPSH112_00890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015644650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001106302.1"
                     /translation="MNYIDLALLVVVVAFGIRGFYHGFVSEVAGTLGIVLGVYLASRY
                     SVAVGHLFSEHLYDLRNETMTNLIGFLLVLASIWVFFLAFGVLLGKVLVFSGLGIIDK
                     ALGFIFSCLKTFLVLSFILYALSKMEVMKDANAYLQEKSAFFSTMKSVASKIMRLDGV
                     KHVEQNLKNNLEEMSDGVKNKESLNKTKESFDKAIDKGMEALKEKAKDLPKNMLDPKA
                     NQTPPNHTPSNKEPL"
     gene            175559..177064
                     /locus_tag="HPSH112_RS00895"
                     /old_locus_tag="HPSH112_00895"
     CDS             175559..177064
                     /locus_tag="HPSH112_RS00895"
                     /old_locus_tag="HPSH112_00895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine--tRNA ligase"
                     /protein_id="WP_000492522.1"
                     /translation="MFSNQYIQQRIHKANSLREEGKNPYKNGLKRSLTNAAFLEKYAY
                     VKGLEEPKDKEKCESIVGRVKLLRLMGKACFIKIEDESAILQAYVSQNELNDEFKSLK
                     KHLEVGDIVLVKGFPFATKTGELSVHALEFHILSKTIVPLPEKFHGLSDIELRYRQRY
                     LDLIVNPSVKDVFKKRSLIVSSVRKFFETEGFLEVETPMMHPIPGGANARPFITYHNA
                     LEIERYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTY
                     EDLIELSKRLFDYLLKTLNLPSKIIYNDMEVDFNQTSVISYLDALETIGGISKDILEK
                     EDRLLAYLLEQSIKVEPDLTYGKLLAEAFDHFVEHQLINPTFVTQYPIEISPLARRND
                     SNPNIADRFELFIAGKEIANGFSELNDPLDQLERFKNQVAEKEKGDEEAQYMDEDYVW
                     ALAHGMPPTAGQGIGIDRLVMLLTGAKSIKDVILFPAMRPVKNDFNVESEE"
     gene            177064..178314
                     /gene="glyA"
                     /locus_tag="HPSH112_RS00900"
                     /old_locus_tag="HPSH112_00900"
     CDS             177064..178314
                     /gene="glyA"
                     /locus_tag="HPSH112_RS00900"
                     /old_locus_tag="HPSH112_00900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206982.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_000323095.1"
                     /translation="MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFASVMEAM
                     GSVLTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAV
                     YHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVNLDGYIDYEEALKIAQ
                     SVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTGEHAHPFPHCH
                     VVSSTTHKTLRGPRGGLILTNDEEIAAKIDKAIFPGTQGGPLMHAIAAKAVGFKENLK
                     PEFKAYAQLVKSNMQVLAKALQEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGN
                     AGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVS
                     LQLHVKEELKAMASQFPVYQQPIF"
     gene            178325..178867
                     /locus_tag="HPSH112_RS00905"
                     /old_locus_tag="HPSH112_00905"
     CDS             178325..178867
                     /locus_tag="HPSH112_RS00905"
                     /old_locus_tag="HPSH112_00905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_000138085.1"
                     /translation="MTEMELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNAM
                     LTSSLIQKHLKKEIEIAHNLILRNDKVENIVFDYNGRNPERFYHKVQLLLREEGFMNF
                     TAYNTKTPGHLHLYVHKGHTELGEGERLVKTLSMKLAQGLPKEWRVFPSNEWPKEFNI
                     LALPYEVFAKERGSFWAKHL"
     gene            178889..179686
                     /locus_tag="HPSH112_RS00910"
                     /old_locus_tag="HPSH112_00910"
     CDS             178889..179686
                     /locus_tag="HPSH112_RS00910"
                     /old_locus_tag="HPSH112_00910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001290452.1"
                     /translation="MSEKERLNEVILEEENNGGGTKKVFLIVAIAIIILAVLLMVFWK
                     STRVAPKETFLQTDSGMQKIGNTKDEKKDDAFENLNLDLSKQESDLDKVADNVKKQES
                     DAFNMPTQTNQTQTEIKTTEETQEAKKELKAVENTPMSTQKESQAVVKKETPHEKPKV
                     KDKEAHKDKAKHAAKEPKAKKEAHKEVPKKANSKTTKGHYLQVGVFAHTPNKAFLQAF
                     NQFPHKIEDRGATKRYLIGPYKSKQEALMHADEVSKKMTKPVVIEAR"
     gene            complement(180073..181534)
                     /locus_tag="HPSH112_RS00915"
                     /pseudo
     CDS             complement(180073..181534)
                     /locus_tag="HPSH112_RS00915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000924332.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            181932..182465
                     /locus_tag="HPSH112_RS00925"
                     /old_locus_tag="HPSH112_00930"
     CDS             181932..182465
                     /locus_tag="HPSH112_RS00925"
                     /old_locus_tag="HPSH112_00930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TIGR00645 family protein"
                     /protein_id="WP_000890445.1"
                     /translation="MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLS
                     HLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDF
                     NALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSA
                     LLAAVTNNIAFSQNKGH"
     gene            complement(182471..183979)
                     /locus_tag="HPSH112_RS00930"
                     /old_locus_tag="HPSH112_00935"
     CDS             complement(182471..183979)
                     /locus_tag="HPSH112_RS00930"
                     /old_locus_tag="HPSH112_00935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase D family protein"
                     /protein_id="WP_000689085.1"
                     /translation="MKIFLVLLSVFFFNGCFGLVYKTPISSPPISYDPYTTAIGSLYA
                     EKLKENPNHSAAILLEDGFDALLHRVGLIRMSQKSIDMQTYIYKNDLSSQVIAKELLN
                     AANRGVKVRILLDDNGVYSDFSDIMLLNFHKNIEVKIFNPYYIRNKGLRYFEMLADYE
                     RIKKRMHNKLFIVDNFAVIIGGRNIGDNYFDNDLDTNFLDLDALFFGGVASKAKESFE
                     RYWRFHRSIPVSLLRTHKRLKNNAKEIAKLHEKIPISAEDKNQFKKKVNDFIERFQKY
                     QYPIYYGNAIFLADSPKKIDTPLYSPIKIAFEKALKNAKDSVFIASSYFIPGKKMMKI
                     FKNQISKGIELNILTNSLSSTDAIVVYGAWERYRNQLVRMGANVYEIRNDFFNRQIKG
                     RFSTKHSLHGKTIVFDDNLTLLGSFNIDPRSAYINTESAVLFDNPSFAKRVRLSLKDH
                     AQQSWHLVVYRHRVIWEAVEEGILIHEKTSPDTSFFLRLIKEWSKVLPEREL"
     gene            complement(184001..184738)
                     /gene="frdB"
                     /locus_tag="HPSH112_RS00935"
                     /old_locus_tag="HPSH112_00940"
     CDS             complement(184001..184738)
                     /gene="frdB"
                     /locus_tag="HPSH112_RS00935"
                     /old_locus_tag="HPSH112_00940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206990.1"
                     /note="part of three member fumarate reductase enzyme
                     complex FrdABC which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdC is the
                     cytochrome b-556 subunit; the catalytic subunits are
                     similar to succinate dehydrogenase SdhAB; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     iron-sulfur subunit"
                     /protein_id="WP_001282387.1"
                     /translation="MSDNERTIVIRVLKFDPQSAVSKPHFKEYQLKETPSMTLFIALN
                     LIREHQDPDLSFDFVCRAGICGSCAMMVNGRPRLACKTLTSSFESGMITLMPMPSFTL
                     IKDLSVNTGDWFGDMTKRVESWAHSKEEVDITKPEKRIEPDEAQEVFELDRCIECGCC
                     IASCGTKLMRPNFIGAAGMNRAMRFMIDSHDERSDDDFYELVGDDDGVFGCMSLIACH
                     DTCPKELPLQSSIATLRNRMLKVGKSR"
     gene            complement(184731..186875)
                     /locus_tag="HPSH112_RS00940"
                     /old_locus_tag="HPSH112_00945"
     CDS             complement(184731..186875)
                     /locus_tag="HPSH112_RS00940"
                     /old_locus_tag="HPSH112_00945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="WP_000705988.1"
                     /translation="MKITYCDALIIGGGLAGLRASIACKQKGLNTIVLSLVPVRRSHS
                     AAAQGGMQASLANAKKSEGDNEDLHFLDTVKGSDWGCDQQVARMFVTTAPKAIRELAS
                     WGVPWTRIKKGDRPAVVNGEHVTITERDDRHGYILSRDFGGTKKWRTCFTADATGHTM
                     LYAVANEALHHKVDIQDRKDMLAFIHHDNKCYGAVVRDLITGEISAYVSKGTLLATGG
                     YGRVYKHTTNAVICDGAGAASALETGVAKLGNMEAVQFHPTALVPSGILMTEGCRGDG
                     GVLRDKFGRRFMPAYEPEKKELASRDVVSRRILEHIQKGYGAKSPYGDHVWLDIAILG
                     RNHVEKNLRDVRDIAMTFAGIDPADSEEQTKDNMQGMPANEPEYGQAMAKQKGWIPIK
                     PMQHYSMGGVRTNPKGETHLKGLFCAGEAACWDLHGFNRLGGNSVSEAVVAGMIIGDY
                     FASHCLEAQIEINTQKVEAFIKESQDYMHFLLHNEGKEDVYEIKERMKEVMDEKVGVF
                     REGKRLEEALKELQELYARSKNICVKNKVLHNNPELEDAYRTKKMLKLALCITQGALL
                     RTESRGAHTRIDYPKRDDEKWLNRTLASWPSAEQDMPTIEYEELDVMKMEISPDFRGY
                     GKKGNFIPHPKKEERDAEILKTILELEKLGKDRIEVQHALMPFELQEKYKARNMRLED
                     EEVRARGEHLYSFNVHDLLDKHNANLKGEHHE"
     gene            complement(186885..187652)
                     /locus_tag="HPSH112_RS00945"
                     /old_locus_tag="HPSH112_00950"
     CDS             complement(186885..187652)
                     /locus_tag="HPSH112_RS00945"
                     /old_locus_tag="HPSH112_00950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206992.1"
                     /note="part of three member fumarate reductase enzyme
                     complex FrdABC which catalyzes the reduction of fumarate
                     to succinate during anaerobic respiration; FrdAB are the
                     catalytic subcomplex consisting of a flavoprotein subunit
                     and an iron-sulfur subunit, respectively; FrdC is the
                     cytochrome b-556 subunit; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate dehydrogenase/fumarate reductase
                     cytochrome b subunit"
                     /protein_id="WP_001183659.1"
                     /translation="MQQEEIIEGYYGASKGLKKSGIYAKLDFLQSATGLILALFMIVH
                     MFLVSSILISDEAMYKVAKFFEGSLFLKAGEPAIVSVVATGIILILVVHAFLALRKFP
                     INYRQYKVFKTHKHLMKHGDTSLWFIQALTGFAMFFLASIHLFVMLTEPESIGPHGSS
                     YRFVTQNFWLLYIFLLFAVELHGSIGLYRLAIKWGWFKNVSIQGLRKVKWAMSVFFIV
                     LGLCTYGAYIKKGLENKDNGIKTMQEAIEADGKFHKE"
     gene            187866..188570
                     /locus_tag="HPSH112_RS00950"
                     /old_locus_tag="HPSH112_00955"
     CDS             187866..188570
                     /locus_tag="HPSH112_RS00950"
                     /old_locus_tag="HPSH112_00955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triose-phosphate isomerase"
                     /protein_id="WP_000160975.1"
                     /translation="MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFL
                     GLLPNSFLHFTLGAQNAYPRDCGAFTGEITSQHLEELKINTLLIGHSERRLLLKESPS
                     FLKEKFDFFKSKNFKIVYCIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEP
                     IWAIGTKKSASLEEIYLTHGFLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIG
                     SASLELENFKTIISFL"
     gene            188580..189407
                     /locus_tag="HPSH112_RS00955"
                     /old_locus_tag="HPSH112_00960"
     CDS             188580..189407
                     /locus_tag="HPSH112_RS00955"
                     /old_locus_tag="HPSH112_00960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-[acyl-carrier-protein] reductase"
                     /protein_id="WP_000506179.1"
                     /translation="MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESL
                     EKRVRPIAQELNSPYVYELDVSKEEHFKPLYDSVKKDLGSLDFIVHSVAFAPKEALEG
                     SLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMVHYNVMGL
                     AKAALESAVRYLAVDLGKHNIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN
                     VSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ"
     gene            189417..190427
                     /locus_tag="HPSH112_RS00960"
                     /old_locus_tag="HPSH112_00965"
     CDS             189417..190427
                     /locus_tag="HPSH112_RS00960"
                     /old_locus_tag="HPSH112_00965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl)glucosamine
                     N-acyltransferase"
                     /protein_id="WP_000777056.1"
                     /translation="MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARY
                     LKLLKDSKAGAVFIRKKESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE
                     PKHFKKVTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILE
                     DNVTIHAGSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETL
                     IKEGVKVDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEF
                     TQIGGKSAVGKDLPPNTNFAGAIPAMEIHEWHHFLAHLRTNFRKQQKTSLLQKAKGFF
                     KS"
     gene            190999..191652
                     /locus_tag="HPSH112_RS00965"
                     /old_locus_tag="HPSH112_00970"
     CDS             190999..191652
                     /locus_tag="HPSH112_RS00965"
                     /old_locus_tag="HPSH112_00970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001042548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS607 family transposase"
                     /protein_id="WP_001042542.1"
                     /translation="MNKRMLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRY
                     KLESLRRINRNAVFNQDELKTIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQ
                     DLGSGMNYYKKGLTKLLNLILDNQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVII
                     NKGDENVRFEEELAKDVLEIITVFSARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA"
     gene            191627..192886
                     /locus_tag="HPSH112_RS00970"
                     /old_locus_tag="HPSH112_00975"
     CDS             191627..192886
                     /locus_tag="HPSH112_RS00970"
                     /old_locus_tag="HPSH112_00975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001274343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001274344.1"
                     /translation="MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENY
                     QLGIKTNHLQLKKEFNALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVS
                     YPKFKKKREFQGSFYIGGDQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATIT
                     QKGDHFYVSISCGVDESEYKRTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDK
                     LTRKLVRISRQLSKKIHPKTKGDKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTS
                     SLIRHSNSFCLESLKVKNMFKNHRLAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTY
                     YPSSKTCSNCQKVKQDLKLKDRIYQCLECGFELDRDINAAINLLKHLVGRVTAEFTPM
                     DLTALLNDLSKNRLATSKVELGIQQKP"
     gene            complement(192909..194717)
                     /locus_tag="HPSH112_RS00975"
                     /old_locus_tag="HPSH112_00980"
     CDS             complement(192909..194717)
                     /locus_tag="HPSH112_RS00975"
                     /old_locus_tag="HPSH112_00980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662189.1"
                     /translation="MQAENMDIDLKNLPSTPLYPLKNPTLTPEQLEQKRKELIVDLNQ
                     KSKELTELGLLDKLGGFVGYQTQNAKDREKQLTDLKTQAIDNKLDFKDLPNALKDEYY
                     NNAETSLFNPLKTKNEIAKEDYQKDLQRKEILKKTSQELTKSDKDLIDNDNGFFNNAL
                     DFITGASEADKLKEYKEKEKAKDITKEIQKAYSAFSNIDKNKDFFSLFTSEDKEAQEK
                     AKKDFETIAKNLYHFDSVIYNEKNEPFVVKGDKVYKINDGFIDNFTQSLLNNKFSIAG
                     SVTGGLAGAKYGKSAGALGLVGGAIAGAALGATTGAATDAIITNLALDRENKADEIIR
                     HALSDGALSLATDTLMLGAGKVLKPLAKAPLKLAEMSMPFQFTKNFFTGNAKRASEII
                     ETTLSKEQQQALKEFSARFGGETKINTNNANDFLREKIKSVFKGDESKLNAYDKVKEI
                     LTLDNHKEQQQAFIRAIRSDETGNTLAFLVEAANLSPKANASLKSILNQTTENLTKSL
                     KQFDLKDYEIKSVFDNLEQGTKESYDKALNEIIGKLYDNSYKVNLRESVQDATNLEKF
                     LNDLKAQGEIDPQAKSFLRQIEENVYNPLLQTYKIL"
     gene            complement(194795..196447)
                     /locus_tag="HPSH112_RS00980"
                     /old_locus_tag="HPSH112_00985"
     CDS             complement(194795..196447)
                     /locus_tag="HPSH112_RS00980"
                     /old_locus_tag="HPSH112_00985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000118379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000118378.1"
                     /translation="MSWIDISVSPGSSSQGSNAILSGFIQSLGNALNNAHFGGISGFP
                     RQLSNENDQIVGYYDDPNGYYAVSRKFLAQKNYYSNERLKNAFGRLINHQNRINQLTQ
                     EIMDKENAINSLNNEIHHINQEIDKQNQAISNLNQEIANLNNEINALKNAIKQEQEKL
                     NALELETSNKNQIEESLKKLEKLKEELKRLKKKSKWKKQFNFLTDNSSNKEAKQQRAL
                     QASQEHAAFLNFFLTDPYAILPKGFIYEYHNPGKETYNALNAPNNMDGINNQFKVNAL
                     NQVLDNSYQKFLPGNDSYNALGSIEQVKALKFYDLVLNYHPESENTQSALFFKQISQY
                     AKGLRLKILTAKTSKKNLKRIEELEKTIKQEQERLNDKDLNALTQDLQKEQENALKFK
                     ESIKAKQNYINALKNAINQKEHAKNPIEQERQNQQNAKREKEQERQNQQNAKREKEQE
                     RQNLNNEINAIGNERLTIKELGTKDNFLGIQPYFNHTGRTYARAAFSDKNKSIKEYYE
                     VETKIKNILGFYRIGESDERILQRFLQLSPAVQNELALLMLN"
     gene            complement(196451..198022)
                     /locus_tag="HPSH112_RS00985"
                     /old_locus_tag="HPSH112_00990"
     CDS             complement(196451..198022)
                     /locus_tag="HPSH112_RS00985"
                     /old_locus_tag="HPSH112_00990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000705261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_000705261.1"
                     /translation="MKITNLAPLKDRIQIMEVLESYIDFHKVGANFKACCPFHDERSA
                     SFIVSPEKNIYHCFGCGVSGDALKFLQEYKKLSFLEAVEEVAKIYNYHLEYETDAKIE
                     RNNHLKEILAYANNLFKERLKNEPKVLNYLTQTRAISLEMIEAYDLGYCLHGDLEVLK
                     ERFNADDLIACGLFSNKNEDKELRSFCNYRITIPLKDSKGQIRSFSARLCIPRLLKAN
                     NAPKYLNGRETSLYNKTFFLYNYHRALESIKEKKQVIICEGFFDVLAYEHFYYKNAIC
                     TSGTAFTKEHLAFLNKLNVELCFSFDNDNAGTEATIRALDLCLKNHVTNMSVIKIKDS
                     SVKDLSDYQKLNRRPNLAKINGFKFYCSYLLRAELTTPQKDLNYRNILKILEAFEPFM
                     QADLLKILNSFLAQKSVKPVKQKNLPGKLDLLEARVYATMLESEEFRYIARRFLTPSD
                     VKYPTFFKRIVCSDFRGLDFLKKFKTIPESYQKSSLVWLKTKGLKNSLAVALDCKDYA
                     LAEAINAKIKEIQKD"
     gene            complement(198019..199194)
                     /locus_tag="HPSH112_RS00990"
                     /old_locus_tag="HPSH112_00995"
     CDS             complement(198019..199194)
                     /locus_tag="HPSH112_RS00990"
                     /old_locus_tag="HPSH112_00995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000429247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase DnaB"
                     /protein_id="WP_000429246.1"
                     /translation="MENLIMKSFLDYPQHIEDFLKDISVKSFNPFNQKLIKVLIEMNQ
                     RNQVPRLETIKLRIAEKEFQSEEFKRILEADSYPDYLNLKSDFKTYLCFQMQEHLANK
                     LKEATRKSEVFDYEFLNKYINLGIVRSGKYFWEWEEYFKNKPPIEKIETGINYLDIIT
                     EGGIELGQIVLLSGDPEAGKTLLGVQFLMNAQQQHKVTYFGFEFSVRKHIETLRNKNF
                     NIKADNYFIDDQSCELNDLISQIRSLSKEGHKVFLIDSQMKIQAPIVGRTIEEIETSK
                     FSALGETARSLQVLIILIVQNSKNDSYTPTGSRKGGHEAHLMIRIERIKRNELPHLKD
                     FNERAKHRRIVILKNKQTGLSGYRYVKNVDYRFFEVDYNGSGQQFQHDEHEEYGGLI"
     gene            complement(199205..199471)
                     /locus_tag="HPSH112_RS00995"
                     /old_locus_tag="HPSH112_01000"
     CDS             complement(199205..199471)
                     /locus_tag="HPSH112_RS00995"
                     /old_locus_tag="HPSH112_01000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001225499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001252548.1"
                     /translation="MRRHGNDRTALIKELLLTKRKKISLRDSNLKELKRLKRKNNYKL
                     AQIVRLAILKGLKQFKNENLLVHLTLKEFDSFLEILEEKNQKKR"
     gene            complement(199663..200613)
                     /locus_tag="HPSH112_RS01000"
                     /old_locus_tag="HPSH112_01005"
     CDS             complement(199663..200613)
                     /locus_tag="HPSH112_RS01000"
                     /old_locus_tag="HPSH112_01005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001106767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_001106767.1"
                     /translation="MNYILKQPMKFGYTQISNEICEDERVSDIAIAIYAYIKKHATTF
                     KLCIEDIAKRFNRNTKTIYKYLNELKDLGYIEFERERKKDGTFSKFFRFIMGNFSKKQ
                     AQKSAKKDAIHKENISVWINPQKQASNADDTEAQSMSTYFPSFTLKRKNKNKHENIRS
                     SENFSTKKFDEKQQVFSNDRDLKDSVKDSSLKSSNISNFSLFDRFSAFFSSILGNLDT
                     KHLNQYERLAFEEFLNYRSEKHKLSYSTKKALLHQCEALKAQGYDLVACINQSIRRNY
                     NEIYEVMHFEKPSCQSKAKGEEVMDQFEYNDCYNGFIFGR"
     gene            complement(200610..200918)
                     /locus_tag="HPSH112_RS01005"
                     /old_locus_tag="HPSH112_01010"
     CDS             complement(200610..200918)
                     /locus_tag="HPSH112_RS01005"
                     /old_locus_tag="HPSH112_01010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000191219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000191219.1"
                     /translation="MTQEKLKPIDLEVLIALNKKAYLPKTADKISKDLRIDYYYTLNI
                     FKKLEAKGLCIQWIINKKKEKEKKNNYYKVCCLSDFGKDLCTYLKALKSVKTKKKDQQ
                     "
     gene            complement(200921..201127)
                     /locus_tag="HPSH112_RS01010"
                     /old_locus_tag="HPSH112_01015"
     CDS             complement(200921..201127)
                     /locus_tag="HPSH112_RS01010"
                     /old_locus_tag="HPSH112_01015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000659597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000037340.1"
                     /translation="MSKKETNMEIFQYLAYQTIKESNTDLSFFDFIQKLEKLQKTHTI
                     RSSVCNVRNKRVTSYSILLQKKAV"
     gene            complement(201124..202273)
                     /locus_tag="HPSH112_RS01015"
                     /pseudo
     CDS             complement(201124..202273)
                     /locus_tag="HPSH112_RS01015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000798973.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific integrase"
     gene            complement(202382..202681)
                     /locus_tag="HPSH112_RS01020"
                     /old_locus_tag="HPSH112_01030"
     CDS             complement(202382..202681)
                     /locus_tag="HPSH112_RS01020"
                     /old_locus_tag="HPSH112_01030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001249252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001249252.1"
                     /translation="MRQKRETETSFNQLKEITQSIQAHQALKTNQNANVSELTPKRAA
                     QEPKRRAQGNCVLKPTKKTFSERQKTTIREPIQESANARTKTKEANQKGDNNAKA"
     gene            202980..204137
                     /locus_tag="HPSH112_RS01025"
                     /old_locus_tag="HPSH112_01035"
     CDS             202980..204137
                     /locus_tag="HPSH112_RS01025"
                     /old_locus_tag="HPSH112_01035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine adenosyltransferase"
                     /protein_id="WP_000655143.1"
                     /translation="MKDSFLFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACE
                     TLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGIGEQSP
                     DINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLTFALAQKRKDNTLPF
                     LRPDGKSQVSVRYENNKPVSIDTIVVSTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLH
                     DNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAA
                     YAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSVYVNTHNTSKHSSAELEKCVRSVF
                     KLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKTEEIQAFFKR"
     gene            204204..204617
                     /locus_tag="HPSH112_RS01030"
                     /old_locus_tag="HPSH112_01040"
     CDS             204204..204617
                     /locus_tag="HPSH112_RS01030"
                     /old_locus_tag="HPSH112_01040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-diphosphate kinase"
                     /protein_id="WP_000813725.1"
                     /translation="MKQRTLSIIKPDALKKKVVGKIIDRFESNGLEVIAMKRLHLSVK
                     DAENFYAIHKERPFFKDLIEFMVSGPVVVMVLEGKDAVAKNRDLMGATDPKLAQKGTI
                     RADFAESIDANAVHGSDSLENAHNEIAFFFAARDL"
     gene            204642..204998
                     /locus_tag="HPSH112_RS01035"
                     /old_locus_tag="HPSH112_01045"
     CDS             204642..204998
                     /locus_tag="HPSH112_RS01035"
                     /old_locus_tag="HPSH112_01045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001159237.1"
                     /translation="MQFEMRKIAFNVPKAFSLEHEGVVLEGEVVRVGAKLFRLEARLK
                     GELMLVCDTSGKEFKKSLDESLVLHISDGLWDTQSQSLDFDNLDVIESFNGFIDLSEI
                     LRSEVESIRLDYHYAD"
     gene            205014..205160
                     /locus_tag="HPSH112_RS01040"
                     /old_locus_tag="HPSH112_01050"
     CDS             205014..205160
                     /locus_tag="HPSH112_RS01040"
                     /old_locus_tag="HPSH112_01050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_206999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="WP_000290428.1"
                     /translation="MAVPDRRVSKTRAAKRRTHYSVKLAKPIKAKDGTWKLPHHINKF
                     TKEY"
     gene            205225..206247
                     /locus_tag="HPSH112_RS01045"
                     /old_locus_tag="HPSH112_01055"
     CDS             205225..206247
                     /locus_tag="HPSH112_RS01045"
                     /old_locus_tag="HPSH112_01055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acyltransferase"
                     /protein_id="WP_000975857.1"
                     /translation="MMKIVIDLMGADHGVLPIIEGVSRALENKSFSAVLVGDKDKATP
                     FISKELASKVEMIHTQDYIKMEEAATEAIKRKESSIYLGMDILKNGADALISAGHSGA
                     TMGLATLRLGRIKGVERPAICTLMPSVGKRPSVLLDAGANTDCKPEYLIDFALMGYEY
                     AKSVLHYDSPKVGLLSNGEEDIKGNMLVKETHKMLKAYDFFYGNVEGSDIFKGVVDVV
                     VCDGFMGNVVLKTTEGVASAIGSIFKDEIKSSFKSKMGALMLKNAFDILKQKTDYAEY
                     GGAPLLGVNKSVIISHGKSNARAIECAIYQAISTVESQVCLRITKAFESLKPSVSVPQ
                     SDQQDA"
     gene            206271..207266
                     /locus_tag="HPSH112_RS01050"
                     /old_locus_tag="HPSH112_01060"
     CDS             206271..207266
                     /locus_tag="HPSH112_RS01050"
                     /old_locus_tag="HPSH112_01060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketoacyl-ACP synthase III"
                     /protein_id="WP_000397790.1"
                     /translation="MEFYASLKSIAMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKER
                     RFANDEEKSSDLGVIAAKQAIERAHLTPKDIDLVVVATLSPDFLAMPSTACVLSAKLG
                     IENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAEKTSSVLDFKDRGTCILF
                     GDGAGACVIGRTKRLKESVLDVQISANGNFSNYLYTPRTLKPTPFNAKEEASEPFLCM
                     KGNEVFKLAVKTLLKDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQV
                     VLTVHKYGNTSAASIPMAMCEAYEEGRLKKGDLMLLDAFGGGLTWGSALVYFGGS"
     gene            207288..207590
                     /locus_tag="HPSH112_RS01055"
                     /old_locus_tag="HPSH112_01065"
     CDS             207288..207590
                     /locus_tag="HPSH112_RS01055"
                     /old_locus_tag="HPSH112_01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014533915.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012443284.1"
                     /translation="MKKMIFLFLVVLGGLEAQSTYCSDHCEGTPDSRIPPMGFYFSFA
                     HSVKYYLQDPQERDHKLEKCHKAFDSTLKVNFITKSFKKDCKHAQMALEQSQQKTP"
     gene            complement(207887..208270)
                     /locus_tag="HPSH112_RS01060"
                     /old_locus_tag="HPSH112_01070"
     CDS             complement(207887..208270)
                     /locus_tag="HPSH112_RS01060"
                     /old_locus_tag="HPSH112_01070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000473927.1"
                     /translation="MFKKMCLSLLMISSVCVGAKDLDFKLDYRATGGKLMGKMTDSSL
                     LSITSMNDEPVVIKNLIVNRGNSCEATKKVEPKLGDKFKKEKLFDHELKYSQQIFYRL
                     NCKPNQLLEVKIITDKGEYYHKFSQ"
     gene            complement(208316..211442)
                     /locus_tag="HPSH112_RS01065"
                     /pseudo
     CDS             complement(208316..211442)
                     /locus_tag="HPSH112_RS01065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001987427.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     STS             211006..212105
                     /standard_name="ha2440"
                     /db_xref="UniSTS:515549"
     gene            211407..212648
                     /locus_tag="HPSH112_RS01070"
                     /old_locus_tag="HPSH112_01085"
     CDS             211407..212648
                     /locus_tag="HPSH112_RS01070"
                     /old_locus_tag="HPSH112_01085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter"
                     /protein_id="WP_000249696.1"
                     /translation="MVQFQNTLIKFHALPFFKNSNLIYNAKLNKTCYKENSNTIILRI
                     KMLTQEDVLNALKTIIYPNFEKDIVSFGFVKNIALHDNQLGLLIEIPSSSEETSAILR
                     EDISKAMQKIGVKALNLDIKTPPKPQAPKPTTKNLAKNIKHVVMISSGKGGVGKSTTS
                     VNLSIALANLNQKVGLLDADVYGPNIPRMMGLQNADVIMDPSGKKLIPLKAFGVSVMS
                     MGLLYDEGQSLIWRGPMLMRAIEQMLSDIIWGDLDVLVVDMPPGTGDAQLTLAQAVPL
                     SAGITVTTPQIVSLDDAKRSLDMFKKLHIPIAGIVENMGSFVCEHCKKESEIFGSNSM
                     NELLEAYHTQILAKLPLEPKVRLGGDRGEPIVISHPNSVSAKIFEKMAQDLSAFLERV
                     EKEKLADNKDIQPTQTHACSH"
     gene            complement(212664..213683)
                     /locus_tag="HPSH112_RS01075"
                     /old_locus_tag="HPSH112_01090"
     CDS             complement(212664..213683)
                     /locus_tag="HPSH112_RS01075"
                     /old_locus_tag="HPSH112_01090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_008682875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS biosynthesis protein"
                     /protein_id="WP_000229182.1"
                     /translation="MVEGLSLENVAKLEETIAPFSAFSSIEFLDITDEELEPRHNYYK
                     LDPLIAGGIKKLYLKLNSFSQKRFSKMIMCRFFFASLFPQYEKMIMFDVDTLFVGDIS
                     ESFFIPLDDHYFGAVREKDLIAMNRNSAKDLYELRQMHAKTIGVADAFPNLKEAQILF
                     DNYFNAGFLALNLKSWRKENLENQLIGFFLLKNEKLLFNDQDTLCFVCRGRILELPYS
                     YNAHPSFLDTPSFPSVKEARMLHFWGDKPWKLFSVIGAKKWHEALIQTPFKDAYFNAP
                     FLDHLFESLQNRDKEIHALNKILSFSDKRHSFESLLPRLSSKLLIEFLLFKAKQKVKR
                     LIKRV"
     gene            complement(213707..213826)
                     /locus_tag="HPSH112_RS01080"
                     /old_locus_tag="HPSH112_01095"
     CDS             complement(213707..213826)
                     /locus_tag="HPSH112_RS01080"
                     /old_locus_tag="HPSH112_01095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001158626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS 1,2-glucosyltransferase"
                     /protein_id="WP_001156401.1"
                     /translation="MQEIVPIVVTFDNNYCIPAGVSLFSMLANAKRERERERE"
     gene            213984..215336
                     /locus_tag="HPSH112_RS01085"
                     /old_locus_tag="HPSH112_01100"
     CDS             213984..215336
                     /locus_tag="HPSH112_RS01085"
                     /old_locus_tag="HPSH112_01100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207007.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014662194.1"
                     /translation="MLNQKVWLGLLALHGVFLNAFEYQISARVGSFSRIAFNQSVINS
                     KKGIYPTGSYVTTTGALQVDSSLLPKGIENHKLGFGVGGEIGSLAYDSTKFLIDEADP
                     KAGFQPANWYYMGRWEGYLMQHSQNWTREQKAQNARPYVLYNLYLDYQYKDIFGIKLG
                     RYPSKALFLSGFNQGFELFYRWKKFRIEWFSTFGRALANEQSIRDFYAPVNYKQKTNY
                     GMHNLNLIYENKYIRVAPFIWFYPKNFNAPGFEITHDTKSYWKSDWRIQTTFYAWFPL
                     YSDYLSKDYYRASLIGKKSASLFVFQRVHFRSYRFGWSVYKNFGNGSAQLGWNGSPVD
                     PFYDTKDDTPYEDAYSNFYNANSITINAFIGKSIKNLLVQLYGKLTYSPRADSQSLGV
                     TFKYNLKKHIYLMLMFNGYQITMHKGYKVGFFTSGYNPDFAQTIQDRSYFMSSMSYRF
                     "
     gene            215388..217253
                     /locus_tag="HPSH112_RS01090"
                     /old_locus_tag="HPSH112_01105"
     CDS             215388..217253
                     /locus_tag="HPSH112_RS01090"
                     /old_locus_tag="HPSH112_01105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone HtpG"
                     /protein_id="WP_000070505.1"
                     /translation="MSNQEYTFQTEINQLLDLMIHSLYSNKEIFLRELISNASDALDK
                     LNYLMLTDEKLKGLNITPGIHLSFDSQKKTLTIKDNGIGMDKNDLIEHLGTIAKSGTK
                     SFLSALSGDKKKDSALIGQFGVGFYSAFMVASKIVVQTKKVNSDQAYAWVSDGKGKFE
                     ISECVKEEQGTEITLFLKDEDSHFASRWEIDSVVKKYSEHIPFPIFLTYTDTKYEGEG
                     DNQKEIKEEKCDQINQASALWKMNKSELKDKDYKEFYQSFAHDNSEPLSYIHNKVEGS
                     LEYTTLFYIPSKAPFDMFRVDYKSGVKLYVKRVFITDDDKELLPSYLRFVKGVIDSED
                     LPLNVSREILQQNKILANIRSASVKKILSEIERLSKDEKNYHKFYEPFGKVLKEGLYG
                     DFENKEKLLELLRFYSKDKEKLVSLKEYKENLKENQKSIYYLLGENLDLLKASPLLEK
                     YAQKGYDVLLLSDEIDAFVMPGVNEYDKTPFKDASHSESLKELGLEEINDEVKERFKD
                     LMKAFEENLKDEVKGVELSSHLTSAVALIGDEQNAMMANWMRQMGQSVPENKKTLELN
                     PNHAILQKLLKCEDKEQLSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL"
     gene            complement(217444..218202)
                     /locus_tag="HPSH112_RS01095"
                     /old_locus_tag="HPSH112_01110"
     CDS             complement(217444..218202)
                     /locus_tag="HPSH112_RS01095"
                     /old_locus_tag="HPSH112_01110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000901629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 repeat Cys-rich protein HcpA"
                     /protein_id="WP_000901629.1"
                     /translation="MLGSVKKTLFGVLCLGALCLRGLMAEPDAKELVNLGIESAKKQD
                     FTQAKTHFEKACELKDGFGCVFLGAFYEEGKGVGKDLKKAVQFYTKGCELNDGYGCRL
                     LGNLYYNGQGVPKDAKKASQYYSKSCELNHAEGCMVLGSLYHHGVGTPKDSRKALDLY
                     EKACDLKDSPGCINAGYIYGIAKNFKEAIVRYSKACELNDGRGCYNLGVMQYNGQGTA
                     KDEKQAVENFKKGCKSGVKEACDALKELKIELWF"
     gene            complement(218288..219469)
                     /locus_tag="HPSH112_RS01100"
                     /old_locus_tag="HPSH112_01115"
     CDS             complement(218288..219469)
                     /locus_tag="HPSH112_RS01100"
                     /old_locus_tag="HPSH112_01115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000992405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="WP_000339204.1"
                     /translation="MDALEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENGV
                     KNLFLYRIFNPPKEHTEEKHAKEKHAKKEHAKESVKPLHFCFAGHIDVVPPGNHWQSD
                     PFKPIIKEGFLYGRGAQDMKGGVGAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTR
                     LMLEKLKEKDLLPHMAVVAEPTCEKILGDSIKIGRRGSINGKLILKGTQGHVAYPQKC
                     QNPIDALASVLPLISGVHLDDGDEYFDPSKLVITNLHAGLGANNVTPASVEIIFNARH
                     SLKTTKESLKEYLEKVLKSVPHALELESSSSPFITASHSKLASVLKENILKTCHTTPL
                     LNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDERVSLKELELLEKVFLGVLENLSE
                     K"
     gene            complement(219480..221345)
                     /locus_tag="HPSH112_RS01105"
                     /old_locus_tag="HPSH112_01120"
     CDS             complement(219480..221345)
                     /locus_tag="HPSH112_RS01105"
                     /old_locus_tag="HPSH112_01120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine-5-carboxymethylaminomethyl(34)
                     synthesis enzyme MnmG"
                     /protein_id="WP_000238020.1"
                     /translation="MVKESDILVIGGGHAGIEASLIAAKMGARVHLITMLIDTIGLAS
                     CNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTY
                     RIFARNLVLNTPNLSVSQEMTESLIIENDEMVGVTTNINNTYKAKKVIITTGTFLKGV
                     VHIGEHQNQNGRFGENASNSLALNLRELGFKVERLKTGTCPRVAGNSIDFEGLEEHFG
                     DTNPPYFSYKTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPS
                     IEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALIT
                     RYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLAL
                     KNQDPFILKRNEAYIGVLIDDLITKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAY
                     RLGLMEEDFYKGLKKDQQEIQDNLKRLKECVLTPSKEVLKRLNELDENPINDKVDGVS
                     LLARDSFNLEKMRSFFSFLTPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSI
                     PKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRKNS"
     gene            221441..223099
                     /locus_tag="HPSH112_RS01110"
                     /old_locus_tag="HPSH112_01125"
     CDS             221441..223099
                     /locus_tag="HPSH112_RS01110"
                     /old_locus_tag="HPSH112_01125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate transporter"
                     /protein_id="WP_000427541.1"
                     /translation="MENHSHANTHTDTRADDKSTKIVRLLGLIGGALIALIICYALNA
                     QLPHIVEEIPKLNSLNYKAMPVVAGVAVLMGIWWMTEAIDLPATALLPLVLFSVFSVD
                     QFASVSSSYASPIIFLFMGGFILALSMQKWNLHTRIALSIILLVGTSPRRLILGFMIA
                     TGFLSMWVSNTATAVMMLPIGMSVLQLVAKLVGKENASNSWHQKEEITKAHGGIMGNI
                     VHKGKDITQVIQEKTIIYRTNFSICLMLGIAYAASIGSLGTLIGTPPNALLAGYMKTA
                     FNIEIDFAQWMVFGTPLAFIMLILSWLLLTYVIFPLKIKEIPGGKEVIRVELKKLGRL
                     SWAEISVGVIFILASLGWIFLDTILKSWGIKIDKIDSVIAMGVSALLFILPANHHGDR
                     LIDWGVAKKLPWDVLLLFGGGLALSAQFSKTGLSLWIGHLVSGFSHLPILFIIFMVTL
                     MVIFLTEITSNTATAAAFLPVIGGVAMGMGYENHQSLLLTIPVALSATCAFMLPVATP
                     PNAIAYGSGYVKITDMIKAGLWLNLVGVVLISAFSYFLVSLVFN"
     gene            223112..223912
                     /locus_tag="HPSH112_RS01115"
                     /old_locus_tag="HPSH112_01130"
     CDS             223112..223912
                     /locus_tag="HPSH112_RS01115"
                     /old_locus_tag="HPSH112_01130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_000656910.1"
                     /translation="MKEELFKEKSRYITGFVLIIVAGLILYADNLLLFWAVLGGIYVV
                     GFSEALRLFQVKASFSLYLILVLSWVAAYFNGRSIECALISAMVMASIIAYQKAHHSE
                     AILPFLYPGVGFFALFGVYKDFGAVAIIWLLVVVVASDVGAFFGGKLLGKTPFTPTSP
                     NKTLEGALIGVVLASVLGSFVGMGKLSGGFFMALLFSFLTALMAVFGDLYESYLKRKA
                     GIKDSGKILPGHGGVLDRLDSMLFGALGLHALLYFLEVWKETAVFLGD"
     gene            223913..225019
                     /locus_tag="HPSH112_RS01120"
                     /old_locus_tag="HPSH112_01135"
     CDS             223913..225019
                     /locus_tag="HPSH112_RS01120"
                     /old_locus_tag="HPSH112_01135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate reductoisomerase"
                     /protein_id="WP_000260815.1"
                     /translation="MVVLGSTGSIGKNALKIAKKFKVGIEALSCGKNIALINEQIKVF
                     KPKKVAILDPNDLNGLEPLGAKVFVGLEGIDAMVEECVSNLVINAIVGVAGLRASFKS
                     LQTNKKLALANKESLVSAGHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGG
                     AFRDTPLELIPIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKID
                     ALIERSSIVHALVEFEDNSIIAHLASADMQLPISYAIDPKLASLSASIKPLDLYALSA
                     IKFEPISMERYTLWRYKDLLLENPKLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQA
                     LESYAKTPFKLSNLDEVLALDREVRERFGNVARV"
     gene            225070..225369
                     /locus_tag="HPSH112_RS01125"
                     /old_locus_tag="HPSH112_01140"
     CDS             225070..225369
                     /locus_tag="HPSH112_RS01125"
                     /old_locus_tag="HPSH112_01140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001911400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000523438.1"
                     /translation="MGLKNKIKGFIKERMPFVVRYVRSLKGDKNIYGEINHEIKEMLE
                     AKKLHSLQEKALFNHDHQESVFLAIASLNNESFIERNKSIYKNSSLNYNYGGGGI"
     gene            225381..226211
                     /locus_tag="HPSH112_RS01130"
                     /old_locus_tag="HPSH112_01145"
     CDS             225381..226211
                     /locus_tag="HPSH112_RS01130"
                     /old_locus_tag="HPSH112_01145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000508689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-1,4-N-acetylgalactosamyltransferase"
                     /protein_id="WP_041199786.1"
                     /translation="MHPTLTLPNPTHLGYFDYDKESQNPKSPLNPWAFIRVKNEIVTL
                     EENLFSMLPAIQRGVIGFNDCDDGSKEVILEFCKKFPSFIPISYPYEVILKDCPSLWH
                     QFYHYCNYTFSFIPKNEWVIKIDCDHIYDAKKLYESFYIPKSIKEVVMYSRINFVVRD
                     FEVFVRNDGDFGFLDAWGDHWLFYNDCEPFEIWQHNGDFYEILKLKDKHHIKDKELMQ
                     WHFPLAKKRRNAIVDNDLIPLKDFKKHHADLIGTRIEESMLDEKRILEMYQKFNLAKE
                     "
     gene            complement(226227..226778)
                     /locus_tag="HPSH112_RS01135"
                     /old_locus_tag="HPSH112_01150"
     CDS             complement(226227..226778)
                     /locus_tag="HPSH112_RS01135"
                     /old_locus_tag="HPSH112_01150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipid-binding protein"
                     /protein_id="WP_000846558.1"
                     /translation="MKTFEVMIQTDSQGYLDAKFGGNAPRGFLNPNGLPTYSPKISWQ
                     KVEGAQSYALELIDHDAQKVCGMSFVHWVVGNISYNVLEENASMMDKRIAQGVNSLTQ
                     GFIRSSLNESEKQRSNLNNSTYIGPMPPNGDHHYLIQVYALDIPKLALKAPFFLGDLH
                     DKMRGHIIAIGRKEFLYKQFVRK"
     gene            226905..227384
                     /locus_tag="HPSH112_RS01140"
                     /old_locus_tag="HPSH112_01155"
     CDS             226905..227384
                     /locus_tag="HPSH112_RS01140"
                     /old_locus_tag="HPSH112_01155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000253589.1"
                     /translation="MVSIEGMESKINRLSAKIDALLEQQKRVISLLETYLSVYPTQEV
                     SNKFFKGVSQGMELAPEIAQEDEEKRLYVLQYLSHVDITKNKQDSQLKKDCLEFIQRF
                     NVPKPIMVTALYNLRGIKPTKKEVAKQLQKLYVWGKRYQQGGIDALKDRRGRPLKKP"
     gene            227396..227578
                     /locus_tag="HPSH112_RS08170"
                     /pseudo
     CDS             227396..227578
                     /locus_tag="HPSH112_RS08170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001251172.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
     gene            227569..228720
                     /locus_tag="HPSH112_RS01145"
                     /old_locus_tag="HPSH112_01160"
     CDS             227569..228720
                     /locus_tag="HPSH112_RS01145"
                     /old_locus_tag="HPSH112_01160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001962614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase, NifS family"
                     /protein_id="WP_079990329.1"
                     /translation="MYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAI
                     AEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVTEHPA
                     VRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLIFPIE
                     EIGAICKEKGVLFHTDAVQAIGKIPVDVLKANVDFLSFSAHKFHGPKGIGGLYIRSGV
                     GLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALL
                     KIPDVMVVGDRIHRVPNTTLISVRGIEGEAMLWDLNRSNIAASTGSACASEDLEANPV
                     MVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAATRLRNISSSY"
     gene            228742..229722
                     /locus_tag="HPSH112_RS01150"
                     /old_locus_tag="HPSH112_01165"
     CDS             228742..229722
                     /locus_tag="HPSH112_RS01150"
                     /old_locus_tag="HPSH112_01165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster assembly scaffold protein
                     NifU"
                     /protein_id="WP_001051963.1"
                     /translation="MAKHDLVGSALWDAYSKEVQRRMDNPTHLGVITEEQAKARNAKL
                     IVADYGAEACGDAVRLYWLVDESTDKIVDAKFKSFGCGTAIASSDMMVELCLNKRVQE
                     AVKITNLDVERGLRDEPDTPAVPGQKMHCSVMAYDVIKKAAGMYLGKNAEDFEEEIIV
                     CECARVSLGTIKEVIRLNDLKSVEEITNYTKAGAFCKSCVRPGGHEKRDYYLVDILKE
                     VREEMEAEKLKATANKSQSGELAFREMTMVQKIKAVDKVIDENIRPMLMMDGGDLEIL
                     DIKESDDYIDVYIRYMGACDGCMSAATGTLFAIENALQELLDRSIRVLPI"
     gene            229878..230111
                     /locus_tag="HPSH112_RS01155"
                     /old_locus_tag="HPSH112_01170"
     CDS             229878..230111
                     /locus_tag="HPSH112_RS01155"
                     /old_locus_tag="HPSH112_01170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000450339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CopG family transcriptional regulator"
                     /protein_id="WP_000450342.1"
                     /translation="METTENTDETRLRGAKNKLGRKPKADANKKTRAVSLYFSDEQYQ
                     KLEKMASEEEESVGSYIKRYILKALRKIEQNGA"
     gene            230200..231570
                     /locus_tag="HPSH112_RS01160"
                     /old_locus_tag="HPSH112_01175"
     CDS             230200..231570
                     /locus_tag="HPSH112_RS01160"
                     /old_locus_tag="HPSH112_01175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_000243215.1"
                     /translation="MVLKKRNILAKKTSLFECQHCGFTSPKWLGKCVQCNAWESFIEL
                     NQAQKEVLNTLKNPIPKAQKSVSIAEIEHEEVIKFSSTQSELDIVLGGGIAKGGLYLV
                     GGSPGVGKSTLLLKVASGLAKNQQKVLYVSGEESLSQIKMRATRLDCIEKELYLLNEI
                     NWPVIKANIESENYFACVIDSIQTLYSPEISSAPGSISQVREITFELMRLAKTRNIAV
                     FIIGHITKEGSIAGPRVLEHMVDSVLYFEGDPSRELRILRSFKNRFGPTSEIGLFEMK
                     EQGLVSAKEASSLFFSQEEPMEGSAITITLEGSRALILEIQALVSECSFGAPKRLANG
                     FDTNRLNMLIALLEKKLEIPLNRHDVFINVSGGIKISEPACDLAVIASILSSFKNRKI
                     DNKTAFLGEVSLNGRILEAPNLNARLKEMENYGFLKAILPKKPSQKTSIKCYEANAVG
                     KIVEWM"
     gene            231693..232772
                     /locus_tag="HPSH112_RS01165"
                     /old_locus_tag="HPSH112_01180"
     CDS             231693..232772
                     /locus_tag="HPSH112_RS01165"
                     /old_locus_tag="HPSH112_01180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207022.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide-methionine (R)-S-oxide reductase"
                     /protein_id="WP_000866564.1"
                     /translation="MKVLSYLKHFYLFLLIGAIMQANESMGSQHQKTDERVIYLAGGC
                     FWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHESDHAESVKVIYDPKKISLDKLL
                     RYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
                     PLKNYVRAEEYHQDYLKKNPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQY
                     EVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDV
                     VKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRYCINSAALRFIPLKDMEK
                     EGYGEFIPYIKKGELKKYIQDKKTH"
     gene            232925..233713
                     /locus_tag="HPSH112_RS01170"
                     /old_locus_tag="HPSH112_01185"
     CDS             232925..233713
                     /locus_tag="HPSH112_RS01170"
                     /old_locus_tag="HPSH112_01185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001140566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001140588.1"
                     /translation="MAKTLKPNLDKDELNTLYKSNLSYAKNTHEHFFKTKKDLDYKLF
                     NPSIMHEQGYISFMGGQGAKRLLDMLYKLAFNAKSNKIALDRHYAKTFLQIVARTLRK
                     NVNILEEQGLIEVIKNKQRYLYVYLKDYRELEGYNSVGANKKNNIPSPFFLQIMRFLE
                     KFAKAIERVTINKKECIIHIPSQELMQRANNVVLKFTPIFNPNTTYTLTYKDLTNKDI
                     PSNLCFYQTAIVKKNLLKALKDRECVGEPINNSPKVSNYFQESA"
     gene            233716..233940
                     /locus_tag="HPSH112_RS01175"
                     /old_locus_tag="HPSH112_01190"
     CDS             233716..233940
                     /locus_tag="HPSH112_RS01175"
                     /old_locus_tag="HPSH112_01190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000188956.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000188956.1"
                     /translation="MTPSDILNICFDLNEKTLQIDFSQTDTETQNKILEELFGKELLQ
                     EKLKGHVLKILELTSNILFQSQPSTKRERQ"
     gene            233937..234416
                     /locus_tag="HPSH112_RS01180"
                     /old_locus_tag="HPSH112_01195"
     CDS             233937..234416
                     /locus_tag="HPSH112_RS01180"
                     /old_locus_tag="HPSH112_01195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000571128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000571647.1"
                     /translation="MIELTLDKKSIQIDEELLDIKKHLEKFYSNKEQEIIAKTLESET
                     ELTCSYLWDKDFLLLEQLLENNLGHFTFESEFALLKDREPLNLDQIKQMSVLKVLTYE
                     MTQALKNQIIHLSQVVNEESLEKDEELVVYHLDFKLNQQSYKVIAQFCVIKKERNIA"
     gene            234413..234703
                     /locus_tag="HPSH112_RS01185"
                     /old_locus_tag="HPSH112_01200"
     CDS             234413..234703
                     /locus_tag="HPSH112_RS01185"
                     /old_locus_tag="HPSH112_01200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014661734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000736104.1"
                     /translation="MKKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLQSPTGKGI
                     LMIIFIAIGIFVWKNLDRWKEILLTILGVVLGTLIFFKAPALAQWFMTSVGN"
     gene            234713..234976
                     /locus_tag="HPSH112_RS01190"
                     /old_locus_tag="HPSH112_01205"
     CDS             234713..234976
                     /locus_tag="HPSH112_RS01190"
                     /old_locus_tag="HPSH112_01205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001177721.1"
                     /translation="MQLVGISVSNLKEISSKEKFLWLNAKSFLLSSFVPFVMTPWLDI
                     LNSLMLYACFLLVFSIAEFFDEDISDILIAHSKIKTKSNSFYA"
     gene            234988..235224
                     /locus_tag="HPSH112_RS01195"
                     /old_locus_tag="HPSH112_01210"
     CDS             234988..235224
                     /locus_tag="HPSH112_RS01195"
                     /old_locus_tag="HPSH112_01210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000806906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000806906.1"
                     /translation="MKQEIVVEKPNKMTITYNLEQTISKLKESVNLLEKNEQYNDAYT
                     LVCGIKSIVDDFHKNVILHVSNNSKPPKRKGKSS"
     gene            235224..>236107
                     /locus_tag="HPSH112_RS01200"
                     /pseudo
     CDS             235224..>236107
                     /locus_tag="HPSH112_RS01200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015085629.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
     gene            236297..236734
                     /locus_tag="HPSH112_RS01205"
                     /old_locus_tag="HPSH112_01225"
     CDS             236297..236734
                     /locus_tag="HPSH112_RS01205"
                     /old_locus_tag="HPSH112_01225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006018183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS200/IS605 family transposase"
                     /protein_id="WP_041199789.1"
                     /translation="MVYSCKYHIVWCPKYRRKVLVGAVELRLKEIIQEVAKELRVEII
                     EMQTDKDHIHILADVDPSFGVMKFIKTAKGRSSKVLRQEFNHLKTKLPTLWTNSCFIS
                     TVGGVPLNVVKQYIENQQNSNRPKQKEKWKNYVDNLQTKALHQ"
     gene            236697..237844
                     /locus_tag="HPSH112_RS01210"
                     /old_locus_tag="HPSH112_01230"
                     /pseudo
     CDS             236697..237844
                     /locus_tag="HPSH112_RS01210"
                     /old_locus_tag="HPSH112_01230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000909425.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            <237899..>238678
                     /locus_tag="HPSH112_RS01215"
                     /old_locus_tag="HPSH112_01235"
                     /pseudo
     CDS             <237899..>238678
                     /locus_tag="HPSH112_RS01215"
                     /old_locus_tag="HPSH112_01235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001960286.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
     gene            complement(238694..239953)
                     /locus_tag="HPSH112_RS01220"
                     /old_locus_tag="HPSH112_01240"
     CDS             complement(238694..239953)
                     /locus_tag="HPSH112_RS01220"
                     /old_locus_tag="HPSH112_01240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001274343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001274344.1"
                     /translation="MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENY
                     QLGIKTNHLQLKKEFNALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVS
                     YPKFKKKREFQGSFYIGGDQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATIT
                     QKGDHFYVSISCGVDESEYKRTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDK
                     LTRKLVRISRQLSKKIHPKTKGDKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTS
                     SLIRHSNSFCLESLKVKNMFKNHRLAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTY
                     YPSSKTCSNCQKVKQDLKLKDRIYQCLECGFELDRDINAAINLLKHLVGRVTAEFTPM
                     DLTALLNDLSKNRLATSKVELGIQQKP"
     gene            complement(239928..240581)
                     /locus_tag="HPSH112_RS01225"
                     /old_locus_tag="HPSH112_01245"
     CDS             complement(239928..240581)
                     /locus_tag="HPSH112_RS01225"
                     /old_locus_tag="HPSH112_01245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001042548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS607 family transposase"
                     /protein_id="WP_001042542.1"
                     /translation="MNKRMLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRY
                     KLESLRRINRNAVFNQDELKTIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQ
                     DLGSGMNYYKKGLTKLLNLILDNQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVII
                     NKGDENVRFEEELAKDVLEIITVFSARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA"
     gene            <240548..241629
                     /locus_tag="HPSH112_RS01230"
                     /old_locus_tag="HPSH112_01250"
                     /pseudo
     CDS             <240548..241629
                     /locus_tag="HPSH112_RS01230"
                     /old_locus_tag="HPSH112_01250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000892161.1"
                     /note="frameshifted; internal stop; incomplete; partial in
                     the middle of a contig; missing start; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
     gene            241631..241765
                     /locus_tag="HPSH112_RS08175"
     CDS             241631..241765
                     /locus_tag="HPSH112_RS08175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000723782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB7"
                     /protein_id="WP_080024685.1"
                     /translation="MKKMQYLAFILVAVILNACSNKFIEMKKSPCALNTPIIQGGLYV
                     "
     gene            241758..242924
                     /locus_tag="HPSH112_RS01235"
                     /old_locus_tag="HPSH112_01255"
     CDS             241758..242924
                     /locus_tag="HPSH112_RS01235"
                     /old_locus_tag="HPSH112_01255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001917653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000067669.1"
                     /translation="MSNLQEIREHLKELENSFEIGSFSKEYIKEYAKCFFMGLSMFLV
                     QQKEEQDKENKEEDCHKEALLNQDAKENKEELIKNIQTNIAKNQELEKISFEKWANKI
                     QERVLPELERIVTHKLKDNVMPKLNTQLESFKKDELDLSSVFEIQRKNTQMAYRLAIG
                     GLIGVISLSVALAFLMPLKQIEPYFVDFANSDKHFAVVQKADTKVDYGEAFLRNLVGS
                     YIMGRETINHIDDKIRLNETIREQSSDEVWKTLEQLVSGKGSIYSKSNMDREIKIINI
                     SIYKQGKQQNIAVADIVAKVFDKGYLISEKRYKVSLIYHFKPLIQFDYSSMPKNPTGF
                     IVDKYSLSEIASIKALDKTYKKVERPHSKIEYKKPEPTNPQNNPANEPNNKGEQ"
     gene            242921..244558
                     /locus_tag="HPSH112_RS01240"
                     /old_locus_tag="HPSH112_01260"
     CDS             242921..244558
                     /locus_tag="HPSH112_RS01240"
                     /old_locus_tag="HPSH112_01260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000617222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_000198989.1"
                     /translation="MTRVFGGISFAISLLAPLLAENNIQNYNEPMDYSKGDVSLQPFN
                     NQTNQETQPSANHNTQPNSMQTPMPNQNSYSQPTTPIQNNQPNNAQTQTMLNNAKQFT
                     NNALNNTKQTITNTTNYVNNKLSPKPNDVPISAFKDNRDLNNQIEPNTSNHETKESDE
                     NSDSTLKPMTNFNAIQNNFFAKNRSIKDNAHFIHYTIGDTFNIRLRYAMTTTFIFDEP
                     IAQVVLGDDIGFSTKMLGEDKEHLISNILLIKPLQIGVDSNLTIIGKSGKVYSFYVFS
                     TTYTSSKNPALMVYVSSKEYFKHFTSSKKETNKEIKTTHSTPNKDIKVSHAPKKIAKK
                     SPSIKEQNLKSKNPTTTKTAIENAPLSLNRFKSPSYPPSNALANSRKASENFKVISNS
                     AKTFKEHRHSQDEMKYVDYSAKIKDDGKFIRIGDNVNHIYINKKKMEYGYVIIDKKKR
                     KWYCLWMCKKVVKSKYKDDLPTQIFNDEQFTYFKFNRSNARSKFPVVYKVVDGYDNPV
                     NSRVVGDYLIAEDVSNQWNLKLGKAYLCIEKIAKRAK"
     gene            244555..245753
                     /locus_tag="HPSH112_RS01245"
                     /pseudo
     CDS             244555..245753
                     /locus_tag="HPSH112_RS01245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000814199.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            245737..247935
                     /locus_tag="HPSH112_RS01250"
                     /old_locus_tag="HPSH112_01275"
     CDS             245737..247935
                     /locus_tag="HPSH112_RS01250"
                     /old_locus_tag="HPSH112_01275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000730441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000730445.1"
                     /translation="MKKKSNVFKILMSLCLALSTSQALVIQTMQDWNLRKNSEFKALV
                     VVSNKVQENTLAMGHYKVSKNRANLSIMVTHIKKGNDYKTLQSPPNAIKEIKGKLVLK
                     KGTRIVLGGENDSEMSSAIGINKNTYTSSKNGKGFSGSGASGMGYASGYGDTGNNTSS
                     NGSNGSSMSGTSGTNGSRGANGSNGTNGANGYQGVGSNPFPPIAGSGSGSSGSSNSDY
                     TPFTSSGGGMGGGFIPFPYSPGLQNGSGANGINGTNGANGTNGANGSNSANGGTASAD
                     SHYTNEFCTAPVRNGNTMSLDIVDRNGSCFKMQAFRNDNVCQYSYDFENMKAIKQTQF
                     YFINRENKSVNIGGCVDLVGKQFEFPMYEDANRCKLDTTTNKGYGSGSASFFQTEILF
                     RGLDNLIHVAKSCTDFAGVQEQLVKYDNDPATRTVQRVINQYYIDPITKQKVFISHNV
                     VSPLKFSYQTYACGKWQFDDAKLEAYRPTQIRIFDTVANQYYNVTGCDYTSDMGKVPK
                     IVQPYTKISVASSVKGEEVGDLNLPQYTTFEIQKMALNSSDLTTTSYCNDGWGSWTKT
                     HSYTGYSNGGLRTLAKWVTQYKTINQGTTIEYIRPRNEGDSDAVYDTYKYYYVSQAQK
                     TLQRIPLTIYINSINLSDEYRKNFELTTLSQKLNLNNGVKQIINTQDFTNWQATYYRP
                     NGNGNLCMSYSFSSGSPWKSSNKGKYCSWAQTPNANYSCASHNNWIVPNQ"
     gene            247948..248889
                     /locus_tag="HPSH112_RS01255"
                     /old_locus_tag="HPSH112_01280"
     CDS             247948..248889
                     /locus_tag="HPSH112_RS01255"
                     /old_locus_tag="HPSH112_01280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001917650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000366896.1"
                     /translation="MDLYLKKALFLASLSCLNANESFVDNSDFLAIMPSEKEEDISQE
                     QKLEQKLEQKLEQKSAELLQSQVKREFKEKKKSQKHFKAMQTKNGFFLGSEIAITSTS
                     LKQSLSLISNATDDSITYSHTSSNANFNMGVLMGYQHYFGATKRHGIKFSTHLYGGTP
                     SAVSTNIDIYNSKVSTNYTPLNFGLDIKYLFDFLNVIKKNRHTLGLSVGFGWRMQYYF
                     AKIDPIKTMRSEFITNKPKDIFSHGFYPAIGLHYYLNHHQFEVNYRFGGAINYQSLTP
                     SKIVAQNGNFKGEVLFSNFITKATNSSYIAFNYTYLF"
     gene            248883..249182
                     /locus_tag="HPSH112_RS01260"
                     /old_locus_tag="HPSH112_01285"
     CDS             248883..249182
                     /locus_tag="HPSH112_RS01260"
                     /old_locus_tag="HPSH112_01285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006564525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041199223.1"
                     /translation="MLIFKEPMMLDEITQKNELEPISNKQNQEPKEVEKMPLNNIQKA
                     KELKNNANLIVRRTDELDKAINKRESLQREFERRIKHLDNKIETLSKKIEELKRK"
     gene            249187..250131
                     /locus_tag="HPSH112_RS01265"
                     /old_locus_tag="HPSH112_01290"
     CDS             249187..250131
                     /locus_tag="HPSH112_RS01265"
                     /old_locus_tag="HPSH112_01290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000362467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbB"
                     /protein_id="WP_000365304.1"
                     /translation="MDLNKLKDYRALRNAILRLLPYLDSGITELIMNKEKEIWLYKLD
                     GTREKVFDENLDKAFMLGFGEQLASFRDLFFNANYPTLNTSIPTSRYRVSMNHFAISA
                     DNELSLNIRVPSEKKFDLKAFKLSGVCQYDYEYLQKLMIEGKNLLISGGTGSGKTSFL
                     NALIEFIPKHTRIVSVEDSEELDLRAFENHKSLLVDKTESSKFTYENALNMAMRMSPD
                     RLMVGEIDTRNALLFLRFGNTGHKGMVSTLHADSVHGVIEAIALNLQMNKSGLDVSVA
                     RKFFESSVDIVVQIVLDKATNTRYIQEILPTKELESSL"
     gene            250128..250646
                     /locus_tag="HPSH112_RS01270"
                     /old_locus_tag="HPSH112_01295"
     CDS             250128..250646
                     /locus_tag="HPSH112_RS01270"
                     /old_locus_tag="HPSH112_01295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001923824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000760569.1"
                     /translation="MKKYQNKRKLGKRINCFISNECKDILENYLKVKKISVTECIESL
                     LLALDPSKETLRARDFYESLFKVISLNQHVYKELMANGNNINQIAKNTNIAIKYNKPF
                     YLQNLAFLEELFKTMDTLNKNIEDCKKVSLELLLQIYKEQKSETELNTISKILNALNE
                     KQSATGPKKDNE"
     gene            250643..252784
                     /locus_tag="HPSH112_RS01275"
                     /old_locus_tag="HPSH112_01300"
     CDS             250643..252784
                     /locus_tag="HPSH112_RS01275"
                     /old_locus_tag="HPSH112_01300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000783776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000783796.1"
                     /translation="MKMQFVKAFCVLFSILLIPLFFILANYYVFDAIKSFRQAYFFSQ
                     SVFIGLYKGASILDLKFEVYITMIMSLMPLVATIYMSIQKTKETSHGYARWANVKDIE
                     CFKIFSKEGFCKVVHRLGVQFDKGFILGKFGFPKLRDVCYDKPLGAMIVAPPGAGKTA
                     CVALPNLLTLPNSCIITDIKGELRDKTAGYRQKFLNNRILIFNPYGDDNTCYFNPFDK
                     RIVKPMNFDQRLRLVQENANNVFISEEKGEDHWVSKAKDLFSFYALHDVCSKDETNFF
                     DVAMGPNRDYVNLIDKRSRYYKQLYQHDKKTGEIILDPQTNEPILIPNVNARKLWYLQ
                     VSEQKYADPKDPRNFDPNEPEPAPRSEGALDEIVRNDARAWANSAEEEFASIISTFNR
                     FVSVFKSNQVRIATSKMSFDYEELRTDNISLYIVIAQKDINTLAPLVRVILESIAKNL
                     LTNESSKKEERIYMILDEFVRFGKLPFLLEMPALCRSYNVVPLFITQDYAMIRKNYSD
                     DDLKILKGVVHYNIVFKMNSAEDAEIVSKEVGEFTRQSKNYSTEKGQLVFGGSSSYSH
                     EGRNLLTAQDIMNIKSDEVIVIVTGAKATPLKLKANYWFRDKELLKRANLPIDLEVER
                     KRFKESVQPTTSQKESENSNLTESEKDNENPTTSQEKNKNENTEQENHNEIDEILKKP
                     LSEISMEEKRALFKKMQQGDEQSEQEKDTQS"
     gene            252867..260810
                     /locus_tag="HPSH112_RS01280"
                     /old_locus_tag="HPSH112_01305"
     CDS             252867..260810
                     /locus_tag="HPSH112_RS01280"
                     /old_locus_tag="HPSH112_01305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001170018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
                     /protein_id="WP_049793595.1"
                     /translation="MLDNGDIATNNLAEESDKVNETQEPLPYVVKTQINTARMISRNP
                     IEWARYLSFERRVHKDNSREDVNFFANGEIKESSRVYEANEKGFERRITKKYDLIDRN
                     KEFFSKEIDILTYKNSLEELKEQGLEIQLTHHHETHKKTLENGNEIAKEYDYLKDIYH
                     EVERTKTGELVRGIIPSISSAEYFKLYNKLPFESINNENTKLNTNNTIKNTIETNASN
                     NIIQNNDNNNPNLSIADLELEQQNLGEQNGKERTNRADEPNRTRAGIPQEIHRRSEHG
                     GQQEGVERSSDEELLHQDSSLFIEPREQGGTRGVYRSSDQQAVSEKSHRERDKLHEHV
                     SRGDGVSARADTRADSNGASSQASRMENGARSEEKGDNPSDERGVSPTPQSPSHQQNS
                     SRDLGLSLSREQPGQTGRLRLFDHGQMGSLFPTDHENQRSKNDNELDRSSNRTNENGD
                     KSPRQNGSANQESARSERYGIAQGSSSQSVLPLAQSRLHHAGLSTPNGLGNLEEDRDQ
                     ERGLLSNLDHLESLLNAIRNNTIASEPDFRTRLLEAIQNNEPLKDSIVGMQLLKDPTT
                     KIFYDKFQLKISPKKVLEILENRIKKSIETANETLNAFNALDSQAIDGNAISNSVGLN
                     PTQESGITDNSVELNNAQEQTAQEQDTQENAQTTIKQETPTAPAIPLNPKIDFKPSEE
                     VLIKGAKTRYKANIKAIELLKELQAKQEILKGDYYATQEEQKILAQFSGWGGLESYFK
                     KDQRPEEFKELNALLTKDEFRRAYSSTRDAYYTPKLVIDSIYQGLDQLGFNNDNHQKE
                     IFEPSLGTGKFIAHAPSDKNYRFMGTELDPISANISKFLYPNQVINNTALENHQFYQE
                     YDAFVGNPPYGSHKIYSSNDKELSNESVHNYFLGKAIKELKDDGIGAFVVSSWFMDGK
                     NPKMREHIAQNTTFLGAIRLPNSVFKATGAEVSSDIVFFKKGVDGATNQSFTKAMPYY
                     DKIIDSLDNDTLFALQNNRFDSFTPSDQLKIVNAIASHFGFKQEKLQRWYEKIDTANF
                     GYREQDYKIIKGFIDKVGENNINLNEQTLNEYFIHHPENILGHLSLEKTRYSFEINGE
                     QIYKYELQALEDKSLDLSQALHQAIEKLPKDVYQYHKTTFKTDALIIDANNERYQEVQ
                     KLIKNLERGELVKWDNLYFQLEQNNERGIFLKPTKINSKVQDSRLKAYFKIKDALNDL
                     TSAELSPLSSDLELESKRVRLNLVYDEFVKKFGYLNENKNRKDIKQDLYGAKVLGLEK
                     DFEKEITPRSAKMQNIEPRQAQAKKAQIFFERTLNPKKELIITNAKEALIASINQKGG
                     LNLHFIRDHFATQSLETTIKELLEQKLIYKDHKDNGDYVLANDYLSGNVKRKLKEVKE
                     AINQGVEGLEANVKDLELIIPKDLKATEIMANINSPWIPTQYLEEFLIELAANHYEKQ
                     YGDKMTDYQLGNLKEGIKVEHLSGAYEVLVRNNELNELYGIRHKDKPHSYKAPFESLL
                     IKVLNNKDLSVKYAQVDPNDPKKEIFITDEEQSNLARQKAEELKEAFKDWIYKDYTRR
                     THLEQIYNDTFNNSVLKTYDGSQLELEGFNHHISLRPHQKNAIFRTIQDRAVCLDHQV
                     GAGKTLCAIASCMEQKRMGLVNKTLIAVPNHLTKQWGDEFYKAYPNANVLVVDSKDIT
                     EKERELLFNQIANNNYDAVIIAHTHLELLSNPRGIIEELKEEELVNAEKNFERQELAY
                     KNNPRETKKPNERAFKSKLDKIRAKYDAILEKQGSHIDISQMGIDNLIVDEAHLFKNL
                     AFETSMEKIAGLGNQQGSNRARDLLIKTRYLHQNNKKIMFLTGTPIANSLSEMYHLQR
                     YLTPDVLEERGLEFFDDWAKTYGEVVNDFELDTSAQSYKMVNRFSKFSDVQGLSTMYR
                     AFADIVSNDDILKHNPHFVPKVYGDKPINVVVKRSQEVAQFIGVADENGKYNEGSIID
                     RMQKCEGKKSKKGQDNILSCTTDARKVALDYRLIDPNAKVEKEFSKSYAMAKNIYENY
                     LETNATKGTQLGFIGLSTPKTHSQKVSLEALDNAHEIENKNPLDEAQELLESLSSYDE
                     NGNLIAPSKKELENELKEKEAKSVNLDEELAKGCKFDVYSDVLRHLVQMGIPQNEIAF
                     IHDAKTEEQKQDLFKKINRGGVRVLLGSPAKMGVGTNVQERLVAMHELDCPWRPDELL
                     QMEGRGIRQGNILHQNDPENFRMKIYRYATEKTYDSRMWQIIETKSKGIEQFRNAHKL
                     GLNELEDFNMGSSNASEMKAEATGNPLIIEEVKLRAEIKNEEAKYKAFNKENYFNEEN
                     LKNNSSKLDYLKQELKDLETLQSSVMIPTHTEIKLYDLKNEESKDYELIKVKEVEPLK
                     ENASMSEELTHKKLKEQNKQIAEQNKEKLDAIKKQFASNLNDLFFNEERDCKLLEYKG
                     FVVNAYKTKYQVEFSLNPKDNPNIAYSPSNMVYKNDTANMFSSYNFCGEIKFDGFLKR
                     LDNAITKLPEKIKELENSIKITQENIAKYTRLVEQKPPYPRLEYLQALKWDHKTLIDD
                     LAKMSKDRDYKPVFNPKSQEVLEKMNAEKRASLENEGKEMTEIKNSNKEQEIKRDIKS
                     DDEVRQHIEQVIEKEIEKGTENISSSELITTNNIDYYENEEVEIIKSRGRR"
     gene            260933..261181
                     /locus_tag="HPSH112_RS01285"
                     /old_locus_tag="HPSH112_01310"
     CDS             260933..261181
                     /locus_tag="HPSH112_RS01285"
                     /old_locus_tag="HPSH112_01310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001105118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001105118.1"
                     /translation="MNYDVLMGFLALIGLILWYGYGLRQYLKLKDENKRLKEKLQRCN
                     CNIKIPSILEVVNRPIIMDIKGELPHLAKNYRNNQIKE"
     gene            261185..263245
                     /locus_tag="HPSH112_RS01290"
                     /old_locus_tag="HPSH112_01315"
     CDS             261185..263245
                     /locus_tag="HPSH112_RS01290"
                     /old_locus_tag="HPSH112_01315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001066142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="WP_000655368.1"
                     /translation="MKDSVIIIESPNKVAKIKEITGASVFATIGHFMQLKSYDEDNNF
                     KPTFEYDPQKKKRIFEIIEACKNKKVYIATDPDREGYAIGYHFYEKIKRIASSIYRAE
                     FFEITPSGINKGLQNASLFENTNKQMYQSALARRVADMLLGFTLSPYLGKALGQMKGS
                     SAGRVQTPCLKLIVDRDREIEKFKALPENEKVSYQIQAKINDNANKEVIIKHCDENGE
                     EIKFNDKEEALKLFESLKDNKACLLKDLKNSVAETKPKKPFITSTLLEKASSELGLGI
                     SEVQSLAQSLFEAGLITYIRTDAESLSVEFLNEAENFYTPIYKEVYLKREYKAGKQSQ
                     AEAHEAIRITHPHTYENLESVVYNAGITNQDALKLYQLIFERTIESQGKNAIYDKQDL
                     LFKIKNEYFKCSVKSLKSAGFLAMFSKKELESDESNDDKDDKEKDQNAQFNLKIDDVL
                     SLNDLVLATIKRNTPSPYKEAGFVKLLENKGIGRPSTYATYLPALLKREYFSISQDKK
                     HTITPTHKGKRVVEVFENAYQFIIDLTYTKQMEEVLDEIVENKSSYVDFISNLSSKCP
                     KIEKLERNDDEIKPSSEGQITYMENILRDLQLELSEEFKNYKEDNRVAKAFLDRYIKE
                     HEFFKKNNKKASSSNNDETRPATPKQIRFAESLAKKHHVKLPKDYKSNMKVCGDFINE
                     YSKK"
     gene            263300..263767
                     /locus_tag="HPSH112_RS01295"
                     /old_locus_tag="HPSH112_01320"
     CDS             263300..263767
                     /locus_tag="HPSH112_RS01295"
                     /old_locus_tag="HPSH112_01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000965780.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000965782.1"
                     /translation="MLYIPPTSKEVYVSSIVALNIHSPQGTGDWHSSRALMPNAIDLC
                     YYIYGKDQERNTNHLLGDLGIIDGTERLNKMGYYPENSPTYIAEHPRACVDYLYMAVL
                     KTGSLGRVMLDEWFPSIEDKKSVYALIEVMKPKLNKQERENLDKWIARNPITE"
     gene            263737..264528
                     /locus_tag="HPSH112_RS01300"
                     /old_locus_tag="HPSH112_01325"
     CDS             263737..264528
                     /locus_tag="HPSH112_RS01300"
                     /old_locus_tag="HPSH112_01325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000377497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000377513.1"
                     /translation="MDSKKPYYRVILSEQEIYHERLMRAIVKNLVDTPMVLKGGTALY
                     LGYGLNRFSEDLDFDCHKKINLLSKVKSAIPSGIILNDIHIKKDTNSVGRYMVRYATK
                     GNKEEQTLKLEVSYRDAPKESEFNVIEGMKIAKVERIIDNKLCACFDGEHTRTKARDL
                     FDLHFLAKHYEEHFNLDLAKRLKEFSKDPDKLASNYLEDKNDDILLNKIMDLEETALE
                     LSIMAHLIHKKLEKQSYSLNTLKEPNVYNSLDNSNENTHTSKHRR"
     gene            complement(264821..265189)
                     /locus_tag="HPSH112_RS01305"
                     /old_locus_tag="HPSH112_01330"
     CDS             complement(264821..265189)
                     /locus_tag="HPSH112_RS01305"
                     /old_locus_tag="HPSH112_01330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000365697.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000365690.1"
                     /translation="MDLQQIDDLEKKLEESLNKEEQVSELENHLEQEPNTKEVKTPKK
                     RGRKKSILDEDKKKSFNVSFSPSIIKELDEFLLEFGSFKETRSTFIEEALIRHLKHRK
                     NTQEQKLLKQIEKLQNKERD"
     gene            complement(265230..265898)
                     /locus_tag="HPSH112_RS01310"
                     /old_locus_tag="HPSH112_01335"
     CDS             complement(265230..265898)
                     /locus_tag="HPSH112_RS01310"
                     /old_locus_tag="HPSH112_01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000150792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_000150792.1"
                     /translation="MTICIANEKGGSGKSTLCLNLAVQLLKDNKEVIVFDTDSQKSME
                     VFTEIRTQKEHKTFSLFNRSSGFSDTLKQMVSKYENILIDTKGEYSKETQKAMLLSDI
                     VLVPTTPSQLDTEVLANMLERIEQLQELNENLRALIIINRMPTIPTLKERQALIEFIK
                     ENNPSDKITLLENSLSERIVYKRSVSEGLGVIEYSDKKAINEWANFYNELKGYLEKEK
                     KHAL"
     gene            complement(266519..266713)
                     /locus_tag="HPSH112_RS08180"
     CDS             complement(266519..266713)
                     /locus_tag="HPSH112_RS08180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001946286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024687.1"
                     /translation="MPFCLSLLLKNLFRMPLRLQKNQGLDLFTISKCVRTHMPLFKLK
                     LSKKPKCVRTHFEGSNSTTP"
     gene            266874..267917
                     /locus_tag="HPSH112_RS01315"
                     /old_locus_tag="HPSH112_01345"
     CDS             266874..267917
                     /locus_tag="HPSH112_RS01315"
                     /old_locus_tag="HPSH112_01345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000649249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000649249.1"
                     /translation="MKAWNEMDIKEQKEIFAQFLANEIAQSLNAGLEFKANNRAYNGN
                     VGNAYNGLNALILDAKQHENGYESNVWVGLDDALKLGANPKEVEFIKNNTKSKNNKEG
                     IYDKASIAYIRDYEMRYVKARDKEGNLIPLKDKEGNARRNAKGEIIYEYEKVPQRDKL
                     GNIKYMQDGVTPFYEFKKEKIDIEPTLEIKNLYNVNIFQTLDKTKLKELDPKTLRTQY
                     ISHTFSMDNQNLVIYDLSKHLNEKEYKKVLDYVEQYGATHSEKSKQYNISQSYQQEPK
                     VEIAPSTENNVKENNEMNMEQFNKMLEMAQNNPQMLAMLQQTLNKGAEQQKHDNYFAN
                     DEAAPTQSKGRGR"
     gene            267917..269742
                     /locus_tag="HPSH112_RS01320"
                     /pseudo
     CDS             267917..269742
                     /locus_tag="HPSH112_RS01320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001150787.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            269752..271185
                     /locus_tag="HPSH112_RS01325"
                     /old_locus_tag="HPSH112_01360"
     CDS             269752..271185
                     /locus_tag="HPSH112_RS01325"
                     /old_locus_tag="HPSH112_01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001942499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000323426.1"
                     /translation="MAYIPNLTALPLHEILLDNGYTYNKNKTSKNNPCLKHENEEGSL
                     VIFKNQNKDGSISYTYKETHTDKVGNIITFCKDRNISVEDLIAGKLEDYLNKQDNLKA
                     RNNTQENNEEVQKIREEFNNLKPYDLENATLIKKREIDVKLLEPYKEHLKTDSLNNLI
                     LATYLAFEDKRLNVIPIHQYGINKRLNTPLTTDKEGNIRDKPLKSIAQGNKGIEVLYP
                     NDLNLVKNVIVTENIFDSLAYLELQDLDPKESVLISTAGQFNAQKLELFFQSFFKQLK
                     NRQQGAYNNYLRQEEQWQELVRQGKANDDFKSVVVETYTDIIKNYQRGKNTPIYNKRV
                     EKTREFRKPQPVNQPQESFNVVLAFDNDVKGKGYREKCEGILYALLQQFPTIYTPFSK
                     DCNDDLKLAHIIENKAINIDIMAEFLESSLEKLNNNDTPIQEKENIMDKLEQIDSLKP
                     FSKEFKDILENIKENLQTQSYVKGRGR"
     gene            271185..272441
                     /locus_tag="HPSH112_RS01330"
                     /old_locus_tag="HPSH112_01365"
     CDS             271185..272441
                     /locus_tag="HPSH112_RS01330"
                     /old_locus_tag="HPSH112_01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001161917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_001161914.1"
                     /translation="MQGNSLSIYETILSLFSDPTKKIFYNIATQTAEVLKAQMIINAV
                     LVILFMIWAYKRVKEGDIFQFKTAMGVVVFIVFMGVLNWAMDNPTTYMNMLKDTIFYP
                     SNKLTEIITNSMTSLQTLTGKNDLTLGSLIDKSYYSITQLYREVFSDLSWKTFFTMFP
                     MLIIFLLLVLAQILLIGLILIIVLITLVETLTWLSLGFAVLPLVLFPQTNGMLFSYLK
                     KLISLTFYQPCIMVVSFLNFSMIESITLKIPTQAEIINGFYNKGHIVDQMIENGSNQA
                     INNFQNAMGAYTSVLGFFIILILGSVICFFLIKRVPDFINNIFGTSGGVGAVTEMMQK
                     IGMTIGGAVVGGSMVMVANQAKQAYQSAGGGLAGLQAGARAMFGAGLSGGITTMANAK
                     GAKAGVRHFVASVKSGFGLDNDRNNK"
     gene            272453..273704
                     /locus_tag="HPSH112_RS01335"
                     /pseudo
     CDS             272453..273704
                     /locus_tag="HPSH112_RS01335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000737422.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(273708..274358)
                     /locus_tag="HPSH112_RS01340"
                     /old_locus_tag="HPSH112_01380"
     CDS             complement(273708..274358)
                     /locus_tag="HPSH112_RS01340"
                     /old_locus_tag="HPSH112_01380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000593528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000636430.1"
                     /translation="MIVLKRLDKILRTGLLVGALVVCSPLNVMAKPLFTDANLIDYLS
                     KSKSNIKKEYAIDCNSQIDGSKYLNDGWNLSKNLPQEWKTAFLSCVNKKQLSKKEQEL
                     QKIIDERNEQIKKDEEWLVACRNYVRESRKKAESNFLKKNRCSKSEDGKISCYSNAFY
                     SAYGDTKPKWWTYSGSHFEEKFENEQNQADHECLSKAASLAIMHPKLEIKRAVRQP"
     gene            274579..275046
                     /locus_tag="HPSH112_RS01345"
                     /old_locus_tag="HPSH112_01385"
     CDS             274579..275046
                     /locus_tag="HPSH112_RS01345"
                     /old_locus_tag="HPSH112_01385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001153440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001153440.1"
                     /translation="MQDLQDFKNDITLILSKDRLDTYDNLEQYKENLKLISSITPKIS
                     NLEIYLRNALDYCLTQNKGSEWVFDENSLIPLIEELKNKKKEISHSLILSKMSLGAVI
                     KLIFFYKLESSVLNLRHFNFKKYYQDNKNTLLVNDRKQSLYDYIKVHIALSLL"
     gene            complement(275121..275328)
                     /locus_tag="HPSH112_RS08185"
                     /pseudo
     CDS             complement(275121..275328)
                     /locus_tag="HPSH112_RS08185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001939878.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            275383..276171
                     /locus_tag="HPSH112_RS01350"
                     /old_locus_tag="HPSH112_01395"
     CDS             275383..276171
                     /locus_tag="HPSH112_RS01350"
                     /old_locus_tag="HPSH112_01395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001106876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662200.1"
                     /translation="MNYKELLEFDDYAMDLTIRMAHHSTAIENNPLSLAETISILTAE
                     YIPREMPQRAFFEVKNYQNMLPFLLENLKKEQKIDSFFVRELHGILMNFLLPNKGTFK
                     TTDNMILGASFETTPSFQVPMAMKEWCDNLHYKMNTLQGEEEKLKAILEQHILFERIH
                     PFSDGNGRVGRALILYSVLEQNLVPFVITKDRKEAYIKALDTHNIESLYQLAKIFQEF
                     ELTRIQGQMVLNKNKQENDNTDDLGNNDYLENTNEYTVTPKHRR"
     gene            complement(276459..277526)
                     /locus_tag="HPSH112_RS01355"
                     /old_locus_tag="HPSH112_01400"
     CDS             complement(276459..277526)
                     /locus_tag="HPSH112_RS01355"
                     /old_locus_tag="HPSH112_01400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_000933814.1"
                     /translation="MLNNKLTKSQRELFDNLKVFLYTKVKNFTPIQDVNDMALILNTQ
                     NKVLKCNNVEQLRQLCHILYNQGIKHTIMMQGLFLFFEYFRDNLKLRSFRMLSEEQVI
                     NFLFELAQNRKPSSMAKYVMYLRQFFDYLDRKKHYNFDFALKNLAFAKTKESLPRHLN
                     YKDLKSFLKTLLEYKPTTSFEKRNKCVLLIVILGGLRKCEVLNIELKHIQVEEQNYSI
                     LIQGKGRKERKAYIKKSLLEPSLNAWLSDDYRLKYFNGAYLFKKDKQKSQNSLTLYNF
                     IPLIFKLAQIKHYKQYGTGLHLFRHSFATLIYQETQDLVLTSRALGHSSLLSTKIYIH
                     TTQEHNKKVALVFDSLIDNKK"
     gene            complement(278485..280293)
                     /locus_tag="HPSH112_RS01360"
                     /pseudo
     CDS             complement(278485..280293)
                     /locus_tag="HPSH112_RS01360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207787.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="relaxase"
     gene            281450..281668
                     /locus_tag="HPSH112_RS01365"
     CDS             281450..281668
                     /locus_tag="HPSH112_RS01365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001263677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001263677.1"
                     /translation="MRVGLNDKWDNQKLENKWVISSYEIYNSEGEPPSLLMAQLQGVG
                     LGTPKLTEPNLTTNALKNQESYKMVFMP"
     gene            complement(281790..282623)
                     /locus_tag="HPSH112_RS01370"
                     /old_locus_tag="HPSH112_01420"
     CDS             complement(281790..282623)
                     /locus_tag="HPSH112_RS01370"
                     /old_locus_tag="HPSH112_01420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000392956.1"
                     /translation="MEESTAFILALVGLFTGITAGFFGIGGGEIVVPSAIFAHFSYSH
                     AVGISLMQMLFSSVVGSIINYKKGLLDLKEGSFAAFGGLMGAILGSFILKIIDDKILM
                     AVFVVVVCYTFIKYAFSNNKKPEHFEEMHFDLHANNKTPDKKRPIPFVSMDRTHGVLM
                     LAGFVTGIFSIPLGMGGGILMVPFLGYFLKYDSKKIVPLGLFFVVFASLSGVISLYNG
                     RVLDNISVQAGVITGIGAFLGVGIGIKLIALANEKVHKILLLLIYALSILATLHKLIM
                     G"
     gene            complement(282830..284911)
                     /locus_tag="HPSH112_RS01380"
                     /old_locus_tag="HPSH112_01430"
     CDS             complement(282830..284911)
                     /locus_tag="HPSH112_RS01380"
                     /old_locus_tag="HPSH112_01430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024737.1"
                     /translation="MKKSLLLSLSLMASLSRAEDDGFYMSVGYQIGEAAQMVKNTGAL
                     QNLADKYDNLSNLLNQYNYLNSLVNLASTPSAITSAIDNLSSSAINLTSATTTSPAYQ
                     AVALALNAAVGMWQVIAFGISCGPGPNLGPEHLENGGVRSFSNTPNYSYSTNSGTTTT
                     TCNGASNVGPNGILSSSEYQTLNTAYQTIQTALNQSQGGGMPALNGSKKMVVNINQTF
                     TRNPTTENTYPDGDGNYYSGGFAIPIQLKFNSVNDAENLLQQAATIMQVLTTQNPHVN
                     GGGGAWGFHGKTGSVMDIFGESFNAINEMIKNAQAVLEKTKQLNANENTQITQPENFN
                     PYTSKDKGFAQEMLNRANAQAEILSLAQQVANNFHSIQGPIQQDLEECLAGSAGVIND
                     KTYGSGCAFVKETLNSLEQHATYYGNQVNQEKALAQTILDFKGALNTLNNDQKAINSA
                     ISSLPNAKSLQNMTHSTQNPNSPEGLLTYSLDSNKYNQLQATTQELGKNPFRRFGMIS
                     SQTNNGAMNGIGVQMGYKQFFGKKRNWGLRYYGFFDYNHAFIKSSFFNSASDVWTYGV
                     GMDALYNFINDKNTNFLGKNNKLSVGLFGGFALAGTSWLNSEFVNLNVVGNIYSAKMN
                     VANFQFLFNLGLRMNLARSKKKDSDHAAQHGVELGVKIPTINTDYYSFMGAELKYRRL
                     YSVYLNYVFAY"
     gene            285156..286328
                     /locus_tag="HPSH112_RS01385"
                     /old_locus_tag="HPSH112_01435"
     CDS             285156..286328
                     /locus_tag="HPSH112_RS01385"
                     /old_locus_tag="HPSH112_01435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001227434.1"
                     /translation="MRKKGMFEKIQKEWLSNIQKDLLSGFVVGLSVIPETAGFAIMVG
                     LDVGVAFYTTFYMAFVLSFFGARKAMISAAAGSVALILVGVVKNYGLEYAGVATLMAG
                     VLQILLGYLKIGNLLRFIPQSVMYGFVNALGILLLMEQFKFLQNQNVGVFILLVIGIL
                     IIYLFPLITKKIPSNLVCILIVSAIALIFDTHAPNLGSIEQGISGFHPIIIPKNLDFK
                     ILIELLPYALSLALVGTIESLLTAKTLDMILKDGVSDKNKETKAQGLGNIISGLLGGM
                     TGCALVGQSIINAKSGAKTRLSTFFAGFSLMVLVLVFNEYVVKIPIVAVVAVMVMISF
                     TTFNFQSIINIKKIKPYDTLNMLLVVAVVLYTHNLAIGVVVGVLVNALWIKSKGIA"
     gene            complement(286363..286437)
                     /locus_tag="HPSH112_RS01390"
                     /old_locus_tag="HPSH112_t08196"
     tRNA            complement(286363..286437)
                     /locus_tag="HPSH112_RS01390"
                     /old_locus_tag="HPSH112_t08196"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(286403..286405),aa:Asn,seq:gtt)
     gene            complement(286568..288019)
                     /locus_tag="HPSH112_RS01395"
                     /old_locus_tag="HPSH112_01440"
     CDS             complement(286568..288019)
                     /locus_tag="HPSH112_RS01395"
                     /old_locus_tag="HPSH112_01440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000751101.1"
                     /translation="MKKTILLSLMASSLLAEDDGVFMSVGYQIGEAAQMVKNTGEIQK
                     VSNAYDNLNNLLTRYNELKQTASNTDSSTAQAIDNLKESANRLKTTPNSANQAVSSAL
                     SSAVAMWQVIASNLANNSLPTNEYEKINTISQSLQNTLENKNNNLTIDNDYEQLLTQA
                     STIISTLQSQCPGIDGGNGKPWGINASGNACNIFGNTFNAINSMINSAKKAAAQSRRT
                     DPESPNQPNAFTNADFNKNLNQVSSVINNTISYLKGDNLATIYNTIQKTPGSKGFQSL
                     VSRSSHSYSLNETQYSEFQTTTKEFGHNPFRSVGLINSQSNNGAMNGVGVQLGYKQFF
                     GKNKFFGIRYYAFFDYNHAYIKSNFFNSASNVFTYGAGSDLLLNFINGGSNQNRKISF
                     GIFGGIALAGTTWLNSQFVNLKTTTSIYSAKINNTNFQFLFNTGLRLQGIHHGVELGV
                     KIPTINTNYYSFMGAKLAYRRLYSVYFNYVLAY"
     gene            complement(288213..288938)
                     /locus_tag="HPSH112_RS01400"
                     /old_locus_tag="HPSH112_01445"
     CDS             complement(288213..288938)
                     /locus_tag="HPSH112_RS01400"
                     /old_locus_tag="HPSH112_01445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="WP_000584031.1"
                     /translation="MIIIPARLKSSRFENKVLEDIFGLPMVVRCAKNANLVDECVVAC
                     DDESIMQTCQKFHIKAVLTSKHHNSGTERCLEAAQILGLKNDERVLNLQGDEPFLEKE
                     VILALLEATKNAPFMATCAKVIDEEQAKSPNLVKVVLDSQSNALYFSRSLIPFLRDAG
                     MKRQTPLLGHIGIYGFHNKEILEELCALKPCVLEELEKLEQLRALYYQKKIAVKIVQS
                     QSVGIDTKEDLQNALKIFSPNLL"
     gene            289051..289848
                     /locus_tag="HPSH112_RS01405"
                     /old_locus_tag="HPSH112_01450"
     CDS             289051..289848
                     /locus_tag="HPSH112_RS01405"
                     /old_locus_tag="HPSH112_01450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000603198.1"
                     /translation="MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTN
                     KKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLIVSKDGNLVIGLGGIFFSNNAGDVK
                     LLTETNQKILALNTNQQNSAKLNAIFDEVPADYAIELPSTNAENKDKILYIVSDPMCP
                     HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISIL
                     EKIYSTQYDINDQKEPEDLRTKVENTTKKIFESGMIKGVPFLYHYKA"
     gene            289864..290517
                     /locus_tag="HPSH112_RS01410"
                     /old_locus_tag="HPSH112_01455"
     CDS             289864..290517
                     /locus_tag="HPSH112_RS01410"
                     /old_locus_tag="HPSH112_01455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000743486.1"
                     /translation="MKKPYRKISDYAIVGGLSALVMVSIVGCKSNADDKPKEQSSLSQ
                     SVQKGAFVILEEQKDKSYKVVEEYPSSRTHIIVRDLQGNERVLSNEEIQKLIKEEEAK
                     IDNGTSKLIQPNNGGGGSNESSGFGLGSAILGSAAGAILGSYIGNKLFNNPNYQQNAQ
                     RTYKSPQAYQRSQNSFSKSVPSASSMGGASKGQSGFFGSSRPTSSPAVSSGTRGFNS"
     gene            290542..291714
                     /locus_tag="HPSH112_RS01415"
                     /old_locus_tag="HPSH112_01460"
     CDS             290542..291714
                     /locus_tag="HPSH112_RS01415"
                     /old_locus_tag="HPSH112_01460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathionylspermidine synthase"
                     /protein_id="WP_001197176.1"
                     /translation="MQVIPLKPLDNKTLEEIGLDWHTNDDMSSYIADEMVVVSQKEAD
                     AYYDACNELYDMFVETAEEAIQNDRFFELDIPNALIPMIKQSFEEEVHWHIYGRFDLA
                     GGLDGKPIKLLEFNADTPTMLYETAVIQWALLKANGYDENKQFNNLYEALGENFKRMV
                     TLGEDTSRFEEMYEGWKILFSSVRGNIEEERTMRFLQDAAQSVGFETDFSYIDEVEFN
                     AEEGVFKNGLNYEFLFKLIPWENIAIDEPELALLMQGMMENKNTIFLNPAYTILFQSK
                     RFLKLLWDRYPNHPLLLETSYEPLSNKKQIKKVAFGREGANSEIFEASMQSLLKTDGV
                     YSNHKPVYQEFYELNSHNGLYYQPNVFFAYESCALGFRKGGLILDNFSKFVSHMLQ"
     gene            291714..292244
                     /locus_tag="HPSH112_RS01420"
                     /old_locus_tag="HPSH112_01465"
     CDS             291714..292244
                     /locus_tag="HPSH112_RS01420"
                     /old_locus_tag="HPSH112_01465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000226282.1"
                     /translation="MVAMMRYFHIYATTFFFPLALLFAISGLSLLFGVRQDTGAKIKE
                     WVLEKSLKKEERLDFLKDFLKENHIAMPKKIEPREYRGALVIGTPLYEINLETKGAQI
                     KIKTIERGFLGALIMLHKAKVGVVFKTLLGIFCVFLLLFYLSAFLMVAFKDTKRMFIS
                     VLIGFVVFFGAIYWSL"
     gene            complement(292689..293756)
                     /locus_tag="HPSH112_RS01425"
                     /old_locus_tag="HPSH112_01475"
     CDS             complement(292689..293756)
                     /locus_tag="HPSH112_RS01425"
                     /old_locus_tag="HPSH112_01475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 repeat protein HcpE"
                     /protein_id="WP_000111768.1"
                     /translation="MSVKILKMLVCGLFFWSLQAHLWGKKDNSFLGVAERAYKSGNYS
                     KATSYFKKACNDGVSEGCTQLGIIYENGQGTKIDYKKALEYYQSACQGDDREGCFGLG
                     GLYDEGLGTTQNYQEAIDAYAKACVLKHPESCYNLGIIYDRKIKGNAAQAVTYYQKSC
                     NFDMAKGCYVLGVAYEKGFLEVKQSNHKAVIYYLKACRLDDGQACRALGSLFENGDAG
                     LDEDFEVAFDYLQKACTLNNSGGCASLGSMYMLGRYVKKDPQKAFNFFKQACDMGNAV
                     SCSRMGFMYSQGDAVPKDLRKALDNYERGCDMGDEVGCFALAGMYYNMKDKENAIMIY
                     DKGCKLGMKQACENLTKLRGY"
     gene            complement(293850..294218)
                     /locus_tag="HPSH112_RS01430"
                     /old_locus_tag="HPSH112_01480"
     CDS             complement(293850..294218)
                     /locus_tag="HPSH112_RS01430"
                     /old_locus_tag="HPSH112_01480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit III"
                     /protein_id="WP_001235917.1"
                     /translation="MRLFIALVLFLWLSLNAKEADFISDLEYGMALYKNPRGVACAKC
                     HGIKGEKQEITFYYEKGEKKILYAPKINHLDFKTFKDALSLGKGMMPKYNLNLEEIQA
                     IYLYITSLAHKEERKEPFKP"
     gene            complement(294218..295138)
                     /locus_tag="HPSH112_RS01435"
                     /old_locus_tag="HPSH112_01485"
     CDS             complement(294218..295138)
                     /locus_tag="HPSH112_RS01435"
                     /old_locus_tag="HPSH112_01485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207035.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylbilane synthase"
                     /protein_id="WP_000527620.1"
                     /translation="MGNLVIGSRGSELALWQANHIKERLKKECSIESEIQIVKTKGDK
                     ILDTPLNKIGGKGLFTKELEELLLKGEIDLAVHSLKDVPVVFEKGLDLACITKRADVR
                     DTFLSVKFPDLMSLPKGAKVGTTSLRRSMQLKLKRQDLDTESLRGNVQTRLKKLECGE
                     FDAIILAEAGLCRLEIQGAKYRKAFSVEEMIPSMGQGALGVEMLKSHKHFATLQKLND
                     EESAFCCHLEREFIKGLNGGCQIPIGVHASLMGDRVKIRAVLGLPNGKEVIAKEKQGD
                     KTKALDLVQELLEAFLQSGAKEILEKAQLF"
     gene            complement(295149..296882)
                     /locus_tag="HPSH112_RS01440"
                     /old_locus_tag="HPSH112_01490"
     CDS             complement(295149..296882)
                     /locus_tag="HPSH112_RS01440"
                     /old_locus_tag="HPSH112_01490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_000899234.1"
                     /translation="MLFSKLFAPTLKEPPKDAVLKSHKHLAQAGYIYQVGSGIYNFLP
                     LAKKVLDKIENITHKRMQEHGAQNILMSFVVLASLWEKSGRLDKYGKELLVFKDRKDN
                     DFVLSPTLEENITEIAANFIKSYKQLPVHLYQIHTKFRDEIRPRFGLVRAREFIMKDG
                     YSFHEDAESLDKEFLNTQSAYKEILSDLGLDFRIVEADSGAIGGSKSREFVVLTECGE
                     DTIVVCKNCDYAANIEIAKRSKRPEPLNVPKAQLAKFPTPNTTSAQSVAEFFKTEPYF
                     VLKALVRKVIHKDKETLACFFVRGDDNLEEVKALNALNLLGANALELREASKEDLNNA
                     GLIAGFIGPYGLKKHVSYIIFDEDLKEGDCLIVGANEKDFHAVGVDLKGFENLVYADI
                     VQVKESDHCPDCQGELKYHKSLEVGHIFKLGQGYAKSLKASFLDKNGKERFFEMGCYG
                     IGISRLLSAILEQKSDDLGCVWTKNTAPFDVVIVVSNWKDEAQKKLAFEVYERLRQKG
                     VDALLDDRDARFGAKMRDFELIGERLALIVGKQTLESKEFECIKRANLEKRTLKDTEL
                     EEKILEMLKSE"
     gene            complement(296886..298235)
                     /locus_tag="HPSH112_RS01445"
                     /old_locus_tag="HPSH112_01495"
     CDS             complement(296886..298235)
                     /locus_tag="HPSH112_RS01445"
                     /old_locus_tag="HPSH112_01495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="WP_000418277.1"
                     /translation="MELETHLSKYFTLAFTHKSMGLEMREKLAINSSATLKEFLQTIK
                     NHCPNIKECMVLSTCNRFEIYASLKHGAHANEQKSALLKILAQNKKMSVSDLEKCVLM
                     SVDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKC
                     AAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNK
                     QFEALILGRNEAKFEDFIKELEEPKKVSFQNIENLNAYINEYQLLFCATSSPHFIVQN
                     DMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVRENVENRQESRTKAYEI
                     VGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYESNIEKILH
                     NAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSSANHAQNLNLYKCEYYEE"
     gene            complement(298235..299158)
                     /locus_tag="HPSH112_RS01450"
                     /old_locus_tag="HPSH112_01500"
     CDS             complement(298235..299158)
                     /locus_tag="HPSH112_RS01450"
                     /old_locus_tag="HPSH112_01500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl-diphosphate synthase"
                     /protein_id="WP_001156626.1"
                     /translation="MQEKQLKAIQNKIASWIKEIESAFIDELFSKIGPSKMLRSKLML
                     ALLNGKTDAILLDKAFNLCAIVEMIQTASLLHDDVIDKATMRRKLPSINALFGNFNAV
                     MLGDVFYSKAFFELSKMGESIAQTLSNAVLRLSRGEIEDVFVGECFNSDKQKYWRILE
                     DKTAHFIEASLKSMAILLNKDAKIYADFGLNFGMAFQIIDDLLDITQDAKTLGKPNFS
                     DFKEGKTTLPYLLLYEKLNPHEQGLLISYFKQDSHEIIEWTKEKFKQYGIIEETLKTA
                     QVYSKKALEAIKKENNLILEKLAQDVIYRTF"
     gene            complement(299168..299563)
                     /locus_tag="HPSH112_RS01455"
                     /old_locus_tag="HPSH112_01505"
     CDS             complement(299168..299563)
                     /locus_tag="HPSH112_RS01455"
                     /old_locus_tag="HPSH112_01505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001004144.1"
                     /translation="MNELIRYGLMFLFFLKAFGLDYGIDKTLELKKDEVFKAIIKDTS
                     NEQTKEITLYWTLYANKGLVINMRFNHFPYQFILYTDHARNTYNLKVFEEKFSSNSVL
                     SLVFKDFKEDKAALRLLALMPLVFSPKEP"
     gene            complement(299556..299840)
                     /locus_tag="HPSH112_RS01460"
                     /old_locus_tag="HPSH112_01510"
     CDS             complement(299556..299840)
                     /locus_tag="HPSH112_RS01460"
                     /old_locus_tag="HPSH112_01510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001206067.1"
                     /translation="MRDYSELEIFEGNPLDKWNDIIFHASRKLSKKELERLLELLALL
                     ETFIEKEDLEEKFESFAKALRIDEELQQKIESKKTDIVIQSMANILSGNE"
     gene            complement(299861..300295)
                     /locus_tag="HPSH112_RS01465"
                     /old_locus_tag="HPSH112_01515"
     CDS             complement(299861..300295)
                     /locus_tag="HPSH112_RS01465"
                     /old_locus_tag="HPSH112_01515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA starvation/stationary phase protection
                     protein"
                     /protein_id="WP_000846459.1"
                     /translation="MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIY
                     EEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHL
                     EKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA"
     gene            complement(300500..301645)
                     /locus_tag="HPSH112_RS01470"
                     /old_locus_tag="HPSH112_01520"
     CDS             complement(300500..301645)
                     /locus_tag="HPSH112_RS01470"
                     /old_locus_tag="HPSH112_01520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="two-component sensor histidine kinase"
                     /protein_id="WP_000748841.1"
                     /translation="MKKSKRLKRPYLKRSHLKHSYKASSFKGLLKKEDNVISLENFKP
                     KESEDLLENFSNKKDMQELLGLLNQFILQSYKVEKEFKDYKALYEWVIEILPQAIWVV
                     NENGSFFYKNSLANQSHEVFNKAKLENFNTEIEHENKSYLVQQNSIQGKQIITATDIS
                     AQKRQERLASMGKISAHLAHEIRNPVGSISLLASVLLKHANEKTKPIVVELQKALWRV
                     ERIIKATLLFSKGIQANRTKQSLKTLESDLKEALNCYTYSKDIDFLFNFSDEEGFFDF
                     DLMGIVLQNFLYNAIDAIEALEESEQGQVKIEAFIQNEFIVFTIIDNGKEVENKSALF
                     EPFETTKLKGNGLGLALSLQVVKAHEGSIALLENQEKTFEIKILNAS"
     gene            complement(301642..301959)
                     /locus_tag="HPSH112_RS01475"
                     /old_locus_tag="HPSH112_01525"
     CDS             complement(301642..301959)
                     /locus_tag="HPSH112_RS01475"
                     /old_locus_tag="HPSH112_01525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000609407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000609407.1"
                     /translation="MINNNKAMLEQYNVSKLASEEKLKALAQNKNDKLLKEQTDSFEA
                     LLLKFMLDSAMKMDNPLYPKAPGDEIYTSMYKDTLSKELSGNFGYSEMLFNFLKEQEK
                     QKS"
     gene            complement(301956..302984)
                     /locus_tag="HPSH112_RS01480"
                     /old_locus_tag="HPSH112_01530"
     CDS             complement(301956..302984)
                     /locus_tag="HPSH112_RS01480"
                     /old_locus_tag="HPSH112_01530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar P-ring protein FlgI"
                     /protein_id="WP_000832089.1"
                     /translation="MKRVFLWLIFVLAFHKLLAEKIGDIASVVGVRDNQLIGYGLVIG
                     LNGTGDKSGSKFTMQSISNMLESVNVKISADDIKSKNVAAVMITASLPPFARQGDKID
                     IQISSIGDAKSIQGGTLVMTPLNAVDGNIYALAQGAITSGNSNNLLSANIINGATIER
                     EVSYDLFHKNAMVLSLKNPNFKNAIQVQNTLNKVFGNKVAIALDPKTIQITRPERFSM
                     VEFLALVQEIPINYSAKNKIIVDEKSGTIVSGVDIMVHPIVVTSQDITLKITKEPLDN
                     SKNAQDLDNNMSLDTAHNTLSSNGKNITIAGVVKALQKIGVSAKGMVSILQALKKSGA
                     ISAEMEIL"
     gene            303173..304651
                     /locus_tag="HPSH112_RS01485"
                     /old_locus_tag="HPSH112_01535"
     CDS             303173..304651
                     /locus_tag="HPSH112_RS01485"
                     /old_locus_tag="HPSH112_01535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_000395605.1"
                     /translation="MEFNQPPLPTEIDDDAYHKPSFNDLGLKESVLKSVYEAGFTSPS
                     PIQEKAIPAVLQGRDVIAQAQTGTGKTAAFALPIINNLKNNHTIEALVITPTRELAMQ
                     ISDEIFKLGKHTRTKTVCVYGGQSVKKQCEFIKKNPQVMIATPGRLLDHLKNERIHKF
                     VPKVVVLDESDEMLDMGFLDDIEEIFDYLPSEAQILLFSATMPEPIKRLADRILENPI
                     KIHIAPSNITNTDITQRFYVINEHERAEAIMHLLDTQAPKKSIVFTRTKKEADELHQF
                     LASKNYKSTALHGDMDQRDRRASIMAFKKNDADVLVATDVASRGLDISGVSHVFNYHL
                     PLNTESYIHRIGRTGRAGKKGMAITLVTPLEYKELLRMQKEIDSKIELFEIPTINENQ
                     IIKTLHDAKVSEGIISLYEQLTEIFEPSQLVLKLLSLQFETSKIGLNQQEIDAIQNPK
                     EKTPKTSNKKTHQREQARSFKKGQHQDRHPKTNHHSKKPKRR"
     gene            304672..305760
                     /locus_tag="HPSH112_RS01490"
                     /old_locus_tag="HPSH112_01540"
     CDS             304672..305760
                     /locus_tag="HPSH112_RS01490"
                     /old_locus_tag="HPSH112_01540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001121071.1"
                     /translation="MPIDLNEHLKKKNSQRETPTPNTPNDGGRFIPPSNSFNSKKLSV
                     LIVIVLLGVIAFLAKPFEVISSGEIGIKITAGKYEPTPLQPGIHFFVPIIQDILIVDT
                     RIRNINFSRTEDMGVAGKNQGIFRNDAINVMDSRGLTVSIELTVQYRLNPQTTPQTIA
                     TYGLSWEQKIINPVVRDVVRSVVGRYPAEDLPIKRNEIAALINSGINKEVSKLPNTPV
                     ELSSIQLREIVLPAKIKEQIEKVQIARQESERVKYEVERSKQEAQKQAALAKGEADAN
                     RIKAQGVADAIVIEAKAKSQANLSISQSLSDKLLRLRQIEVQGQFNEALKTNNNAQIM
                     LTPGGAVPNIWIDTKSKVKSSIAETKEP"
     gene            305767..306306
                     /locus_tag="HPSH112_RS01495"
                     /old_locus_tag="HPSH112_01545"
     CDS             305767..306306
                     /locus_tag="HPSH112_RS01495"
                     /old_locus_tag="HPSH112_01545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000157389.1"
                     /translation="MASLAFIQAFLESFKGFLSQATLISVLIASVLILFCAILLLLAL
                     LLRNRLARYIAATAFLGAFLSMPFALNVLLTQTIYPIETRILHANPLSYSKAFSLQVG
                     VKNNSKFTLNKCVLRLEVLKNPHNFVEEHAFKLFVKKSYEKTFKEKILPEESKVFSFF
                     IDNYPYLKTAPYQVSLFCL"
     gene            complement(306370..307920)
                     /locus_tag="HPSH112_RS01500"
                     /old_locus_tag="HPSH112_01550"
     CDS             complement(306370..307920)
                     /locus_tag="HPSH112_RS01500"
                     /old_locus_tag="HPSH112_01550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000889790.1"
                     /translation="MLEIKNLNCVLNAHFSLQNINISLNPSERVAIVGESGSGKSSIA
                     NIIMRLNPRFKPHNGEVLFETTNLLKESEAFMQHLRGNAIAYIAQDPLSSLNPLHKIG
                     KQMSEAYFLHHKNASKTLLKEKVLNAMQQVQLDEKFLNRYPYELSGGQRQRVCIAMGI
                     INAPKLLICDEPTTALDAQIQNQILDLLKQLSVEKNIALLFISHDLKAVKRLADRVYV
                     LKKGEIVETNSTKELFNDPKHEYSKLLIQASNLPAKNLKALDETLLEVKDFSVYYLQK
                     RFFRPSLKKPLIASVNFSLKAKENIGIIGESGSGKSSLALGLLKLALNSGEEKILGQS
                     VGLLNSKAFKPYRKILQMVFQDPYASLNPRLSIQSILTEALHFAYPKASKEEWHHLAK
                     LCLEEVCLNPELLNFYAYELSGGERQRVAIARAIALKPKIILLDEPTSALDKSIQKSV
                     LELLLDLQEKQDLSYLFISHDLDVIKAFCDKVLVISEGKVVEMGTIKEVFDNPKHAYT
                     KRLLESRL"
     gene            complement(307930..308946)
                     /locus_tag="HPSH112_RS01505"
                     /old_locus_tag="HPSH112_01555"
     CDS             complement(307930..308946)
                     /locus_tag="HPSH112_RS01505"
                     /old_locus_tag="HPSH112_01555"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_080024738.1"
                     /translation="MSSLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDRPL
                     FIYKDNKAYFPMFKDYAEVEFGGDFFTPTDYNDPYVKDTLLKDAFIIHALIPYSYDTI
                     IMDLDSPAPTPPSFKHLLGTDDQARDVLARLVYGYRVSLVFGILLTLFSVLIGVSLGA
                     FQGYYGGLIDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLVLLFSWMGLSQV
                     VRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYVPFLMAASISTLVSL
                     DFLGFGMPIGSASLGELVNQGKDNLTTPHLAIVAFVAISLLLSVLVFIGEGVRDAFNA
                     NMLK"
     gene            complement(309055..309130)
                     /locus_tag="HPSH112_RS01510"
                     /old_locus_tag="HPSH112_t08198"
     tRNA            complement(309055..309130)
                     /locus_tag="HPSH112_RS01510"
                     /old_locus_tag="HPSH112_t08198"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(309095..309097),aa:Ala,seq:ggc)
     gene            309317..310738
                     /locus_tag="HPSH112_RS01515"
                     /old_locus_tag="HPSH112_01565"
     CDS             309317..310738
                     /locus_tag="HPSH112_RS01515"
                     /old_locus_tag="HPSH112_01565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000788612.1"
                     /translation="MKNHSFKKTIALSLLAGMSLCNAEEDGAFFVIDYQTSLARQELK
                     NPGFTQAQELKQLIRDGAVRLQTSAIPLSYYLDILGNKTKILLSESVKDNAQPPQALV
                     NLEQSLGILGKLLDLSQQYANQGVIKPLVVDVGKEQIGITDSMLLVAQNIVLALGQVD
                     LSKIQQNNNKQLYENIMQVMLLGAGGTNGAYNGVSVGDIATGMQNFSSQTGLIGANST
                     VSELNALIKSGISLDRETLGLGSFIEKNICSSASSCFSKGQLIYKKGLDRSINIISAS
                     LDQFENSASSLYKISYIPNLFSLKDYQSASMNGFGAKMGYKQFFTHKKNIGLRYYGFL
                     DYGYANFGDTNLKVGANLVTYGVGTDFLYNVYERSRRRERTTIGLFFGAQIAGQTWST
                     NVTNLLSGQRPDVKSSSFQFLFDLGVRTNFAKTNFNKHRLDQGIEFGVKIPVIAHKYF
                     ATQGSSASYMRNFSFYVGYSVGF"
     gene            310751..312163
                     /locus_tag="HPSH112_RS01520"
                     /old_locus_tag="HPSH112_01570"
     CDS             310751..312163
                     /locus_tag="HPSH112_RS01520"
                     /old_locus_tag="HPSH112_01570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017180429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_014662201.1"
                     /translation="MKNTNTKEIKNTRMKKGYSQYHALKKGLLKTALLFSLPLSMALA
                     EDDGFYMGVGYQIGGAQQNINNKGSTLRNNVIDDFRQVGVGMAGSNGLLALATNTTMD
                     ALLGIGNQIVNTNTTVGNNNLELTQFKKVLPQIEQRFETNKNAYSVQALQVYLSNVLY
                     NLVNNNGSNNGVAPEYVGIIKVLYGSQNEFALLATESVALLNALTRVNLDSNSVFLKG
                     LLAQMQLFNDTSSAKLGQIAEGLEKSGGVGSMLQKDVKTISDRIATYQENLKQLGGML
                     NNYDEPYLPQFGPGKSSQHGVINGFGIQMGYKQFFGSKRNIGLRYYAFFDYGFTQLGS
                     LSSAVKANIFTYGAGTDFLWNIFRRVFSDQSLNVGVFGGIQIAGNTWDSSLRGQIENS
                     FKETPTPTNFQFLFNLGLRAHFASTMHRRFLSASQSIQHGMEFGVKIPAINQRYLKAN
                     GADVDYRRLYAFYINYTIGF"
     gene            312262..313497
                     /locus_tag="HPSH112_RS01525"
                     /old_locus_tag="HPSH112_01575"
     CDS             312262..313497
                     /locus_tag="HPSH112_RS01525"
                     /old_locus_tag="HPSH112_01575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207053.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthase"
                     /protein_id="WP_000796204.1"
                     /translation="MADVVVGIQWGDEGKGKIVDRIAKDYDFVVRYQGGHNAGHTIVH
                     KGVKHSLHLMPSGVLYPQCKNIISSAVVVSIKDLCEEISAFENLENRLFISDRAHVIL
                     PYHAKKDAFKEKSQNIGTTKKGIGPCYEDKMARSGIRMGDLLDDKILEERLNAHFKAI
                     DPFKEAYDLGENYEKDLREYFKTYIPKICPFIKDTTSMLIEANQKGEKILLEGAQGTL
                     LDIDLGTYPFVTSSNTTSASACVSTGLNPKAINEVIGITKAYSTRVGNGPFPSEDTTP
                     MGDHLRTKGAEFGTTTKRPRRCGWLDLVALKYACALNGCTQLALMKLDVLDGIDAIKV
                     CVAYERKGERLEAFPSDLKDCTPIYQTFKGWEKSVGVRKLDDLEPNAREYIRFIEKEV
                     GVKIRLISTSPEREDTIFL"
     gene            313494..313922
                     /locus_tag="HPSH112_RS01530"
                     /old_locus_tag="HPSH112_01580"
     CDS             313494..313922
                     /locus_tag="HPSH112_RS01530"
                     /old_locus_tag="HPSH112_01580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000712748.1"
                     /translation="MKKFASVLVQLKILALEKIEQKLKSKRLELQQNEREILDKQAQL
                     SAFKNPELGGMSLFLQTQQLKSAIRMEIEYYQQESENLNKDLKILEKEYLLANQELEK
                     AKIILENEKRKEKEILEKKEQALLDENAMILHWQKEGLHA"
     gene            313915..314592
                     /locus_tag="HPSH112_RS01535"
                     /old_locus_tag="HPSH112_01585"
     CDS             313915..314592
                     /locus_tag="HPSH112_RS01535"
                     /old_locus_tag="HPSH112_01585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="WP_001226661.1"
                     /translation="MRKILLMGLILQALFGEEATQELLQCSAIFESKKAELKDDLRRL
                     GEKEQSLRILQTENARLLDEKNDLLNKKEKEVEEKLKNLAAKEEAFKALQTEEKKRLK
                     NLIEENESILRGIKQAKDSKIGETYSKMKDSKSALILENLPTQNALEILMALKPQELG
                     KILAKMDPKKAAALTELWQKPPRENKEIPKTIPPMPPIAPMPPIAPTPSKEPMIKDPN
                     TKEPAGV"
     gene            314589..315638
                     /locus_tag="HPSH112_RS01540"
                     /old_locus_tag="HPSH112_01590"
     CDS             314589..315638
                     /locus_tag="HPSH112_RS01540"
                     /old_locus_tag="HPSH112_01590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000971256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RIP metalloprotease RseP"
                     /protein_id="WP_041199790.1"
                     /translation="MMFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLC
                     FFKLFGTQFALSLIPLGGYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFF
                     NFLFAILVYFFLALGGEKVLLPVIGDLEKNALEAGLLKGDKILSINHKKIASFREIRS
                     VVAHARGELVLEIERNHQILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGV
                     VSYSLFQAFEKALSRFKEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSHASSVSM
                     LLLFGAFLSINLGILNLLPVPALDGAQMLGVVFKNIFKIALPAFMQNALWLAGVGFLV
                     FIMFLGLFNDLTRLL"
     gene            315651..316913
                     /locus_tag="HPSH112_RS01545"
                     /old_locus_tag="HPSH112_01595"
     CDS             315651..316913
                     /locus_tag="HPSH112_RS01545"
                     /old_locus_tag="HPSH112_01595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="WP_000382879.1"
                     /translation="MDVLSVSEINAQIKALLEATFLQVRVQGEVSNLTIHKVSGHAYF
                     SLKDSQSVIRCVLFKGNANRLKFALKEGQEVVVSGGISAYVPRGDYQINCFEIEPKDI
                     GSLTLALEQLKEKLRLKGYFDEANKLPKPHFPKRVAVITSQNSAAWADMKKIASKRWP
                     MCELVCINALMQGEGCVQSVVESIAYADSFHDTKNAFDAIVVARGGGSMEDLYPFNDE
                     KIADALHLAKTFSMSAIGHESDFLLSDLVADLRASTPSNAMEILLPSSDEWWQRLDGF
                     NVKLHRSFKILLHQKKVHLEHLEVSLKRLSFENKHHLNALKLEKLKIALENKTLEFLR
                     FKKTLLEKISTQTLTSPFLQTKTERLNALENALKLAHANLKLPQFGAFVSKNNQAIEL
                     EALKRGDKIELSNEKARASAEILSVDRV"
     gene            complement(316932..318104)
                     /locus_tag="HPSH112_RS01550"
                     /old_locus_tag="HPSH112_01600"
     CDS             complement(316932..318104)
                     /locus_tag="HPSH112_RS01550"
                     /old_locus_tag="HPSH112_01600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012443295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_014534198.1"
                     /translation="MHKVFIMEALECLKRIEKESIQTIYIDPPYNTKSSNFEYEDAHA
                     DYEKWIKEHLILAKAVLKQSGCIFISIDDNKMAEVKIIANEIFGTCNFLGTFITKQAT
                     RSNAKHINITHEYVLSYAKNKAFAPGFKILRTLLPIYAKPLKDLMRMIKNVFKQKGQA
                     QAQLVLKEQIKELSQKEHFNFLKNYNLVDEKGEIYFAKDLSTPSNPRSVAIQEINLFL
                     EPLKSRGWSSDEKLKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLDFYSRQGTKDL
                     EKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNKDYYLNWS
                     FYLCQKEEKIKNNPQAASILKNKGYKNTISNIMLLRLEKIVKRSEYEILKTKSILF"
     gene            complement(318097..318711)
                     /locus_tag="HPSH112_RS01555"
                     /old_locus_tag="HPSH112_01605"
     CDS             complement(318097..318711)
                     /locus_tag="HPSH112_RS01555"
                     /old_locus_tag="HPSH112_01605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001873033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662202.1"
                     /translation="MQFLNQSLGFFNKGHFEPIDRNFITESYQALKPIEEIQNKYNKH
                     DNDSFLNELRDSMVALYLDYELINIQKHGLDAKRSSSDEFLEIKQVSFQSKTWSATFN
                     DTTLEKAKVFCDIKTTLAVGVWNNISNLLFIVYGKHPKIGLYLEQKVKECHNESRRST
                     QTIGVSKLIKEFDFKMKPIDLKEQELINLFNLKFGHFSWENHLA"
     gene            318912..319589
                     /locus_tag="HPSH112_RS01560"
                     /old_locus_tag="HPSH112_01610"
     CDS             318912..319589
                     /locus_tag="HPSH112_RS01560"
                     /old_locus_tag="HPSH112_01610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000893463.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000893463.1"
                     /translation="MLERFKDFMREQPEPYKFLQVFYAQEKERFLNDKMNDCIKQNKS
                     KEEASILARQGFVSTIGRVLEKIIELLLKDFCTKNNVKMTNDKILRAKRINGELDRVK
                     RALLVHFGEYSVLPDGDIILYQTNKDNIKILAILSVKNSFRERFTEAPYWKLKLLQSP
                     ITSHIKVFMITPDNDNEISFKDKPKKARIVMEHELDGLYLAKSHFDQSSKIKGIENLL
                     EDLKRLL"
     gene            319586..320344
                     /locus_tag="HPSH112_RS01565"
                     /old_locus_tag="HPSH112_01615"
     CDS             319586..320344
                     /locus_tag="HPSH112_RS01565"
                     /old_locus_tag="HPSH112_01615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_000806081.1"
                     /translation="MKPYFSLEKLDLYHGDVSVLETFEKGFYDLCITSPPYNLSVEYQ
                     GSNDFRAYDDYLNWCKNWLKNCYFWGKEQARLCLNVPLDTNKHGKQSLGVDIIAIAKE
                     CGWKYQNTIIWNESNISRRTAWGSWLQASAPYAIAPVELIVVFYKNEYKRQKQTSTIS
                     KEEFLLYTNGLWNFSGESKKRLKHPAPFPRELPRRCIKLFSFLEDTIFDPFSGSGTTI
                     LEANALGRFSVGLEIEKEYCELSKKRILESLSLV"
     gene            320417..322987
                     /locus_tag="HPSH112_RS01570"
                     /old_locus_tag="HPSH112_01620"
     CDS             320417..322987
                     /locus_tag="HPSH112_RS01570"
                     /old_locus_tag="HPSH112_01620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein ClpB"
                     /protein_id="WP_001048002.1"
                     /translation="MNLFEKMTDQLHETLDSALALALHHKNAEVTPLHMLFVMLNNSQ
                     GILIQALQKMSVDIQALRLSVQSELDKFAKVSQINKQNIQLNQALIQSLENAQGLMAK
                     TGDSFIATDVYLLANMSLFESVLKPYLDTKQLQKTLESLRKGATIQSKNDDSNLESLE
                     KFGIDLTQKALENKLDPVIGRDEEIIRMMQILIRKTKNNPILLGEPGVGKTAVVEGLA
                     QRIVNKEVPKTLLNKRVVALDLSLLVAGAKYRGEFEERLKKVIEEVKKSANVILFIDE
                     IHTIVGAGASEGGMDAANILKPALARGELHTIGATTLKEYRKYFEKDMALQRRFQPIL
                     LNEPSINEALQILRGLKETLETHHNITINDSALIASAKLSSRYITDRFLPDKAIDLID
                     EGAAQLKMQMESEPAKLSSVKRSIQRLEMEKQALEMEKKESNAKRMQEILKELSDLKE
                     EKIQLEAQFENEKEVFREISRLKMETESLKKEAERFKRNGDYQQAGEIEYSKIPENKK
                     KEEELQHKWEAMQQNGALLQNALTENNIAEIVSQWTHIPVQKMLQSEKNRVLNIESEL
                     QKRVVGQEKAIKAIAKAIKRNKAGLSDSNKPIGSFLFLGPTGVGKTESAKALAQFLFD
                     SDKNLIRIDMSEYMEKHAISRLIGAAPGYVGYEEGGQLTEAVRRKPYSVVLLDEVEKA
                     HPDVFNLLLQVLDEGHLTDSKGVRVDFKNTILILTSNVASGALLEENLSEADKQKAIK
                     ESLRQFFKPEFLNRLDEIISFNALDSHAVANIVGILFENIQKKALERGINITLDEEAK
                     ELIAKAGFDRFYGARPLKRALYEMVEDKLAELILEDKIKENDSVAFVVENNEIVPKIK
                     "
     gene            323041..323763
                     /locus_tag="HPSH112_RS01575"
                     /old_locus_tag="HPSH112_01625"
     CDS             323041..323763
                     /locus_tag="HPSH112_RS01575"
                     /old_locus_tag="HPSH112_01625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein CcdA"
                     /protein_id="WP_000970974.1"
                     /translation="MMFDNTLINLFETAPLLTSLLAGILTFLSPCVLPLIPAYMSYIS
                     QISLEDIKDGKAKRVSVFLKSLMFVVGFSLVFLGVGMSMAKLIHSFSFSWVNYIAGGI
                     VILFGLHFLGVFRFAFLYKTQSFRLASKSNSMQRFYPFLLGMSFALGWTPCIGPIFTS
                     IVIMSASKDAYGLMLMVVFVVGLAIPFLLVALMLERALLFLKSLKKYNRAIEIVSGLV
                     LILMGILIVTNSMESLTNFLQK"
     gene            323773..324909
                     /locus_tag="HPSH112_RS01580"
                     /old_locus_tag="HPSH112_01630"
     CDS             323773..324909
                     /locus_tag="HPSH112_RS01580"
                     /old_locus_tag="HPSH112_01630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_000924936.1"
                     /translation="MLLKNASFYDGEVLKRADIRLKDSLIAEIKENLSPIKNEEVIEC
                     ANLFVLPSFIDLSVTGLEGYENLKQKAFKGGVGLLNVFNCDQSGIKNIMAIRNNQLAD
                     IATLKNKGGEILIVQSDAFLELISHYAKSYNLPLLISLENSFEALNSGALAYELGQNF
                     VENAFENTRLVRFMEVSRALQIPMLLDKVSSAATLKLIKAFNNLGAHLQAQTPLSHLI
                     LDESVYEDYEPRFKIAPPLRDKESQNALKETLKNDEITMLTSLHVFKNSNAELFEESA
                     FGCESIENAFSVAYTFLVQKKVISFQQLIKVMATNQARFLKLNAGEVKENQLANLMIV
                     DLNAQTRVNNKNSPFYGLELYGEVQRMILKGQTTLIKENACKKS"
     gene            324894..326123
                     /locus_tag="HPSH112_RS01585"
                     /old_locus_tag="HPSH112_01635"
     CDS             324894..326123
                     /locus_tag="HPSH112_RS01585"
                     /old_locus_tag="HPSH112_01635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207065.1"
                     /note="Catalyzes the hydrolytic cleavage of a
                     carbon-halogen bond in N-ethylammeline; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chlorohydrolase"
                     /protein_id="WP_001155840.1"
                     /translation="MQEIIGASLVFLCNEKCEVLEDYGVVFDEKIVEIGDYKSLTLKY
                     PHLKAQFFENSVLLPAFINAHTHFEFSNNKASFDYGSFSGWLGSVLNNGGAILENCQG
                     AIQNAISAQLKSGVGSVGAISNHLIEVNLLKKSPLNAVVFLEFLGSSYSLEKLKAFEA
                     KFKELKDLEDKKLKAALAVHAPYSVQKDMALSVIQLAKDSQSLLSTHFLESFEELEWV
                     ENSKGWFENFYQHFLKESHFKSLYKGANDYIDMFEDTHTLFVHNQFASLEMLKRIKSQ
                     VKNAFLITCPFSNRLLSGQALDLERTKEAGLSVSVATDGLSSNISLSLLDELRAFLLT
                     HNMPLLKLAKIALLGATRHGAKALALNNGEIEANKMADLSVFNFGEKFVKEQAVLQFL
                     LHAKEVERLFLGGKRVI"
     gene            326185..326427
                     /locus_tag="HPSH112_RS01590"
                     /old_locus_tag="HPSH112_01640"
     CDS             326185..326427
                     /locus_tag="HPSH112_RS01590"
                     /old_locus_tag="HPSH112_01640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000780041.1"
                     /translation="MKLVLAKNTRKSDAKSVELEDLYHKFSEDKRSIFYFAPTNAHKD
                     MLKAVDFFKEKGHTAYLDEVRVSSDEKDFLYELHII"
     gene            326437..327750
                     /locus_tag="HPSH112_RS01595"
                     /old_locus_tag="HPSH112_01645"
     CDS             326437..327750
                     /locus_tag="HPSH112_RS01595"
                     /old_locus_tag="HPSH112_01645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (N6-isopentenyl
                     adenosine(37)-C2)-methylthiotransferase MiaB"
                     /protein_id="WP_000870197.1"
                     /translation="MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKAADLILIN
                     TCSVREKPERKLFSEIGQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARN
                     VSKISQVIHKEKAVEVAIDYDESAYAFEFFEKKAQIRSLLNISIGCDKKCAYCIVPHT
                     RGKEISIPMDLILKEAEKLASNGTKELMLLGQNVNNYGARFSSEHAKVDFSDLLDKLS
                     EIQGIERIRFTSPHPLHMNDAFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKE
                     WFLNRVERLKALVPEVGISTDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRP
                     FTEAGAWKERVPLEVSSSRLERLQNRHKEILEEKAKLEVGKVHVVLVENRREIDNQIV
                     GFEGRSDTGKFIEVACKEKRNPGELVRVEIVSHSKGRLIATAKGN"
     gene            327790..328443
                     /locus_tag="HPSH112_RS01600"
                     /old_locus_tag="HPSH112_01650"
     CDS             327790..328443
                     /locus_tag="HPSH112_RS01600"
                     /old_locus_tag="HPSH112_01650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207068.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000053558.1"
                     /translation="MSLKFFRKNIVLRVVPRLAFGVLWLLHKTCKNRYFLAQNLKEKP
                     FIVSCWHGELGMIGFAYLRLQKPSVYVIASQHFDGSIATGLFESFGFKNIRGSSKKGG
                     VKVLIEGLKRLKEGCDVAITPDGPKGPRHSIADGVIALAQKSGVGISACRVVCRNAWR
                     LNTWDQFEIPKPFSEVHYYMLESVIIPKEWELSKAKEYLKTRMDSVGFGESQRGLGA"
     gene            328436..329416
                     /locus_tag="HPSH112_RS01605"
                     /old_locus_tag="HPSH112_01655"
     CDS             328436..329416
                     /locus_tag="HPSH112_RS01605"
                     /old_locus_tag="HPSH112_01655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000911945.1"
                     /translation="MLKGLKKALKERFCSQVYISFNVDHNLLSAQILRVKNHRIKEKF
                     FKTFETKVEIKSGEVPIQALKIARTYSQKYPYTYFSAMSKAKEVLCEKQAFEQIKREN
                     QDYQACEVNQKYCVYVESKDFLKDFKRFKIQDVDFLFSPFSLIYDFVRDHLEEKPLLY
                     LLLERSRFYFLIADKKEIFLAKSVFLEEQPEEFIESKEEDSMEMDNEAVNLFLSEIQE
                     DIDSLEEAIGLDSSKDNSEKNEDAYSLIEGMTNIPLIANALQEGLRSVYHSRDIDFVE
                     KVVVLDSCQIHQKALMHLQETLMIEVDRLDFSLVERLNILARMENENYAF"
     gene            329406..329939
                     /locus_tag="HPSH112_RS01610"
                     /old_locus_tag="HPSH112_01660"
     CDS             329406..329939
                     /locus_tag="HPSH112_RS01610"
                     /old_locus_tag="HPSH112_01660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001212809.1"
                     /translation="MRFSYIEPRAKYLISKLSKIWVFYIFLSFVVIGGLVWFMHNAIK
                     NTQNNASDLTIQERLYRHEISRLQVKTDETLKLIKEAKKRLNYNDDIRDVLQGLLNIV
                     PDLITINSIEIDQQSVVVSGKTPSKEAFYFLFQNKLNPMFDYSRAEFFPLSDGWFNFV
                     STNFSNSLLIKNPESIK"
     gene            329936..330475
                     /locus_tag="HPSH112_RS01615"
                     /old_locus_tag="HPSH112_01665"
     CDS             329936..330475
                     /locus_tag="HPSH112_RS01615"
                     /old_locus_tag="HPSH112_01665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000803109.1"
                     /translation="MKPLHFSHLDREQSGDVGFIIKNLVFLGVFSLFGWLNTEYFLWP
                     SMLELKKILLEENRKKSVLEYAQRHFETALTNYRNQKETGESLLKIFNDEESRRILEK
                     ILKKCFDAYKIKPLLSQKPFQKTQFFIMARASELEKTYLFFTLINKYLPSAQSQLPLK
                     ISKDDEGLLVQFSVSIDLQ"
     gene            330492..330890
                     /locus_tag="HPSH112_RS01620"
                     /old_locus_tag="HPSH112_01670"
     CDS             330492..330890
                     /locus_tag="HPSH112_RS01620"
                     /old_locus_tag="HPSH112_01670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/iron-chelating domain-containing protein"
                     /protein_id="WP_001150503.1"
                     /translation="MQDFDFSFNHKACEGCGAKCCVGESGYIFLNIQEMQKISAFLKL
                     ELEEFSQKYVKKVGYKFSLLEKDAKELGLACVFLDLETKKCQIYSMRPKQCQTFPFWE
                     SVKTFSKEQKEAFCQSCPGITQKTKETKVR"
     gene            330928..332220
                     /locus_tag="HPSH112_RS01625"
                     /old_locus_tag="HPSH112_01675"
     CDS             330928..332220
                     /locus_tag="HPSH112_RS01625"
                     /old_locus_tag="HPSH112_01675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent nuclease subunit B"
                     /protein_id="WP_000512686.1"
                     /translation="MGIQIKKRFLASLLLFSLFCLKAETLSEDHQILLSSDAFHRGDF
                     ASAQKGYMNLYKQTNKVVYAKEAAISAASLGDIKTAMHLAMLYQKITNNRNDVSINKI
                     LVDGYVQMGQIDKAIELLHKIRKEEKTIATDNVLGTLYLTQKRLDKAFPLLSKFYNAV
                     HDEDSLEKLITIYFLQNRKKEGLDLLQSHIDRYGCSEQLCQKALNTFTQFNELDLAKT
                     TFARLYEKNPIVQNAQFYIGVLILLKEFDKAQQIAELFPFDRRLLLDLYTAQKKFAQA
                     SKQASLIYQEKKDPKFLGLEAIYHYESLSTKNKKLTKQEMLPIIQKLEKATKERQQIL
                     AKTKDKEDAQDAFFYNFLGYSLIDYDLDIKRGMDFVRKALALDSGSVLYLDSLAWGYY
                     KLGNCLEAKKIFSSIAKEFIQAEPELKEHNKIIQECKK"
     gene            332208..332765
                     /locus_tag="HPSH112_RS01630"
                     /old_locus_tag="HPSH112_01680"
     CDS             332208..332765
                     /locus_tag="HPSH112_RS01630"
                     /old_locus_tag="HPSH112_01680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001155707.1"
                     /translation="MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTK
                     DCVFVTPDEVLGKLLEENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVH
                     QDLFISHYQLLESLVQGSDGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHL
                     KDLGVLGVLEKVPHSQNQKKIVFLD"
     gene            332822..333076
                     /locus_tag="HPSH112_RS01635"
                     /old_locus_tag="HPSH112_01685"
     CDS             332822..333076
                     /locus_tag="HPSH112_RS01635"
                     /old_locus_tag="HPSH112_01685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_000055463.1"
                     /translation="MSLLVNDECIACDACREECPSEAIEEGDPIYNIDPDRCTECYGY
                     DDDEPRCVSVCPVDAILPDPNNAESKEELKYKYESLKEQD"
     gene            333086..334540
                     /locus_tag="HPSH112_RS01640"
                     /old_locus_tag="HPSH112_01690"
     CDS             333086..334540
                     /locus_tag="HPSH112_RS01640"
                     /old_locus_tag="HPSH112_01690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine polyphosphate pyrophosphohydrolase"
                     /protein_id="WP_001074200.1"
                     /translation="MAKITTVIDIGSNSVRLAIFKKTSQFGFYLLFETKSRVRISEGC
                     YAFDGVLQEIPMQRAIKALSEFKEIALKYKSKKILCVATSAVRDAPNRLEFVARVKKA
                     CGLQIKIIDGQKEALYGGIACANLLHKNSGITIDIGGGSTECALIEKGKIKDLISLDV
                     GTIRIKEMFLDKDLDVKTAKAFIQKEVSKLPFKHKNAFGVGGTIRALSKVLMKRFDYP
                     IDSLHGYEIDAHKNLAFIEKIVTLKEDQLRLLGVNEERLDSIRSGALILLVVLEHLKT
                     SLMITSGVGVREGVFLSDLLRHHYHKFPPNINPSLISLKDRFLPHEKHSQKVKKECVK
                     LFEALSPLHKIDEKYLFHLKIAGELASMGKILSVYLAHKHSAYFILNALSYGFSHQDR
                     AIICLLAQFSHKKIPKDNAIAHMSAMMPSLLTLQWLSFILSLAENLCLTDSHHLKYTL
                     EKNKLVIHSNDALYLAKEMLPKLVKPIALMIEFA"
     gene            334537..335547
                     /locus_tag="HPSH112_RS01645"
                     /old_locus_tag="HPSH112_01695"
     CDS             334537..335547
                     /locus_tag="HPSH112_RS01645"
                     /old_locus_tag="HPSH112_01695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase I"
                     /protein_id="WP_000684655.1"
                     /translation="MKIAIVRLSALGDIIVSAVFLALIKECFTNAQIEWFVDERFGAI
                     LEHSPYIDKLHPIALKSALTTFNPLKIFKLFKSLRAYEYDIVIDMQGLIKSALITQML
                     KAPKKVGFDCASAREGLSAFFYSQKVSIAYNEPVLKRNFTLLSHALNLPKKEISEGLS
                     SRSKVFSYQDSPKIDALNLNKNKLKILFVLETSKLNKTYPIERFKELALALENFQICL
                     LWHASEDKANALYGALKNQRDVLLLPKLTLNEVKALLFKMDLIIGGDTGITHLAWALQ
                     KPSITLYGNTPMERFKLESPINVSLTGNSNANYHKKDFSIQNIEPKKIKECVLNLLKE
                     KE"
     gene            335544..336530
                     /locus_tag="HPSH112_RS01650"
                     /old_locus_tag="HPSH112_01700"
     CDS             335544..336530
                     /locus_tag="HPSH112_RS01650"
                     /old_locus_tag="HPSH112_01700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207078.1"
                     /note="acylates the intermediate (KDO)2-lipid IVA to form
                     (KDO)2-(lauroyl)-lipid IVA; essential for survival; plays
                     a role in cell responses to environmental changes; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lauroyl acyltransferase"
                     /protein_id="WP_000221276.1"
                     /translation="MTYKERLIHEKILNQGDKGFRTELRILSIFIVESLVNILGFILA
                     KMPHLWFLRCIKAVAWLMKTFDKRRYFDAKANLDFVFGDSKSEEEKKKIIKKGYENFA
                     FILLETIRVIFIPKDEYDARFTLINEENVWKSLNKEGQAITLCMHFGYWEAVGTTLAQ
                     YYKDYGRGCLGRLTKFAPINHMIMSRREAFGVRFVNKMGAMKELIKMYNQGNGLVGIL
                     VDQNVAPKDGVVVKFFNKDATHTTIASVLSRRYNIDIQPVFIDFNDDYSHYTATYYPS
                     MRSKITDNAENDILECTQAQASLCEEVIRKHPESYFWFHRRFKSTHPEIYQR"
     gene            complement(336585..337700)
                     /locus_tag="HPSH112_RS01655"
                     /old_locus_tag="HPSH112_01705"
     CDS             complement(336585..337700)
                     /locus_tag="HPSH112_RS01655"
                     /old_locus_tag="HPSH112_01705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine(34) transglycosylase Tgt"
                     /protein_id="WP_000347359.1"
                     /translation="MDFQLQAMDNNARAGLLNLAHSQVATPVFMPVGTQGCIKSLDAT
                     DMQDILGTKLILANTYHMYLRPGEKVVEKLGGLHRFTQFHGSFLTDSGGFQAFSLSDN
                     VKLQEDGIVFKSHIDGSKHLFTPAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESI
                     KRSAKWANLSLEYHKQKNRPNNNLFAIIQGGTHLKMRSLSVGLTHEGFDGYAIGGLAV
                     GESADEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAIGLGVDMFDCVMPTRNARNA
                     TLFTHSGKISIKNAPYKLDDTPIEENCTCYTCKRYSKAYLHHLFRAKELTYARLASLH
                     NLHFYLELVKNARNAILEKRFLSFKKEFLEKYHSRSH"
     gene            337751..339193
                     /locus_tag="HPSH112_RS01660"
                     /old_locus_tag="HPSH112_01710"
     CDS             337751..339193
                     /locus_tag="HPSH112_RS01660"
                     /old_locus_tag="HPSH112_01710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter TrkA"
                     /protein_id="WP_041199791.1"
                     /translation="MELKKIALILDGIVAKNFLDLVLRHYSNHNFYIVVVKNESLIPK
                     NYPSTFAFHCFDATSSFRLLQVLNDEVSDAFLIIQDFKEQRIIHKIIQTHFKRMRVVL
                     GVKRDGEKTLENNEENKDEKLILIDEFEVLANKFISRLPNIPSTPREFGLGKGEIMEI
                     DVPFGSIFAYRHIGSIRQKEYRIVGLYRNDVLLLSTKSLVIQPRDILLVAGNPEILNA
                     VYLQVKSNVGQFPAPFGKSIYLYIDMRLQSRKAMMRDVYQALFLHKHLKSYKLYIQVL
                     HPTSPKFYHKFLSLETESIEVNFDFYGKSFIQKLHEDHQKKMGLIVVGRELFLSKKHR
                     KALYKTATPVYKTNASGLSKTSQSVVVLNESLDINEDMSSVIFDVSMQMDLGLLLYDF
                     DPNKRYKNEIVNHYENLANALNRKIEIFQTDIRNPIMYLNSLRKPILHFMPFEECITH
                     TRFWWFLSTKVEKLAFLNDDNPQIFIPIAE"
     gene            339198..340229
                     /locus_tag="HPSH112_RS01665"
                     /old_locus_tag="HPSH112_01715"
     CDS             339198..340229
                     /locus_tag="HPSH112_RS01665"
                     /old_locus_tag="HPSH112_01715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="WP_001156103.1"
                     /translation="MQEILIPLKEKSYKVFLGELPEIELKQKALIISDSIVAGLHLSY
                     LLKRLKALEVRVCVIESGEKYKNFNSLERILNSAFEMQLNRHSLMIALGGGVISDMVG
                     FASSIYFRGIDFINIPTTLLAQVDASVGGKTGINTPYGKNLIGSFYQPKAVYIDLAFL
                     KTLEKREFQAGVAEIIKMAVCFDKNLVEILETKDLKDCLEEVVFQSVSIKAQIVTQDE
                     KEQNIRAGLNYGHTFGHAIEKETDYERFLHGEAIAIGMRMANDLALSLGMLTLKEYER
                     IEDLLKKFDLIFNYKITDIQKFYERLFLDKKSEDKTIKFILPKGVGAFEIASHIPKET
                     IIKVLEKWH"
     gene            340220..341785
                     /locus_tag="HPSH112_RS01670"
                     /old_locus_tag="HPSH112_01720"
     CDS             340220..341785
                     /locus_tag="HPSH112_RS01670"
                     /old_locus_tag="HPSH112_01720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001218172.1"
                     /translation="MALRVLLFFCFLFLQAEDKSQELLSIQKQMALVDKKLAKDDNVW
                     LKKFENYKIYNQIYTEKESVRQELRRLKNKKSKDLLKISTLEHTLKALESQQKMFESY
                     GVNPFKDLIERPNIPNIPNIANPIAIIDGISFIKSMRLKHESLKNNQTALEEVLRLLD
                     QKHQLLNQWHALDKNAKLSDEIYQTQAKRLELQGAQNILKTTIGIFQKDSDEAISIVK
                     SQVKNQLFKLVYVFLAALLSVVFAWILKIISSKYIENNERVYTVNKAINFVNVSVIIL
                     IFLFSYLENVTYLVTVLGFASAGLAIAMKDLFMSLLGWFIILIGGSVHVGDRVRIAKG
                     TDIFIGDVLDISMLHITILEDVTFTTYTNNRRAGRIIFVPNNYIFTTMFANYSHFGMK
                     TVWDGVDFCVTFDSDFKKASKIALNIATELSKEYTDITYKQLNKMRDRYSLRSLSVKP
                     RCFLMPESNGIKISVWYQTNSYATLSLRSKIVAEIVEAFLKEENIHIAYTTSKLLKVD
                     TEGDGFGNKREQK"
     gene            341782..343038
                     /locus_tag="HPSH112_RS01675"
                     /old_locus_tag="HPSH112_01725"
     CDS             341782..343038
                     /locus_tag="HPSH112_RS01675"
                     /old_locus_tag="HPSH112_01725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (N(6)-L-threonylcarbamoyladenosine(37)-C(2))-
                     methylthiotransferase MtaB"
                     /protein_id="WP_000758470.1"
                     /translation="MKKVYFKTFGCRTNLFDTQVMGENLKDFSATLEEQEADIIIINS
                     CTVTNGADSAVRSYAKKMARLNKEVLFTGCGVKTQGKELFEKGFLKGVFGHDNKEKIN
                     ALLQEKKRFFIDDNLENKHLDTTMVSEFVGKTRAFIKIQEGCDFDCNYCIIPSVRGRA
                     RSFEERKILEQVGLLCSKGVQEVVLTGTNVGSYGKDRGSNIARLIKKLSQIAGLKRIR
                     IGSLEPNQINDEFLELLEEDFLEKHLHIALQHSHDFMLEKMNRRNRIKSDRELLEIIA
                     SKNFAIGTDFIVGHPGESGSVFEEAFKNLESLPLTHIHPFIYSKRKDTPSSLMTDSVI
                     LEDSKKRLNAIKDLISHKNKAFRQLQLKLNTPLKALVEVQKDGEFKALDQFFNPIKIK
                     SDKPLRASFLEIRDYEIKERENHAVF"
     gene            343025..344677
                     /locus_tag="HPSH112_RS01680"
                     /old_locus_tag="HPSH112_01730"
     CDS             343025..344677
                     /locus_tag="HPSH112_RS01680"
                     /old_locus_tag="HPSH112_01730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FstH"
                     /protein_id="WP_001116733.1"
                     /translation="MPFSKNLENLTAPFKRIKNRSLVLALGFLILTFCLLLFLVLSDV
                     SRLISSKDFFYVIQSHPKQTLTEDENYFYANKGLYKTNKEAFLRAYKIPESMPIEKRE
                     NLNKVSKIFLALLFFISSMLFGIFWCLPKRLDTKMNLESVHKNELENAFQRYDALGVR
                     FEDIAGVDEVKEELLEVIDYLKNPKKYQDLGIFLPKGVLLIGPPGVGKTMIAKALASE
                     ARVPFFYESGSAFSQIYVGAGAKKVHELFMHAKRHAPSIIFIDEIDALGKARGGHRSD
                     EREATLNQLLTEMDGFLQNDEVVVIGATNQMEVMDEALLRSKRFDRRIFISLPDLSER
                     QSILEKLLENKKHALNYLKIAKICVGFSGAMLATLINESALNALKHQRIEITESDILE
                     VKDKIAYGKKKPQTLDENQKELVALYQSAKALSAYWLEIEFDKAPLLGEFIAFNENKI
                     HSESEIKNYIKVYLSGTIILELLYKERYSLSKQDLQKAKFLNEFMASELLLAPTKESL
                     SVLYEEQLEFLKPQIAACKRLSVLLLEQEYLEHSNLYDLLNG"
     gene            344680..345198
                     /locus_tag="HPSH112_RS01685"
                     /old_locus_tag="HPSH112_01735"
     CDS             344680..345198
                     /locus_tag="HPSH112_RS01685"
                     /old_locus_tag="HPSH112_01735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001210556.1"
                     /translation="MRFFSGFGFTDESVLFEKWLLKGAYDVSGFSIGAIKAIEYAYNE
                     ILQQRRINSLLLFSPCMLAHKSLAFKRLQLSSFQKDPQSYMDNFYQEVGLSAKLERFK
                     REGSLEELEFLLNYKYSDSTIRFLLEKGVKIEAFIGLRDRITDIQALLEFFMPLVQVW
                     QFKDCNHLLQKS"
     gene            345211..345684
                     /locus_tag="HPSH112_RS01690"
                     /old_locus_tag="HPSH112_01740"
     CDS             345211..345684
                     /locus_tag="HPSH112_RS01690"
                     /old_locus_tag="HPSH112_01740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000713306.1"
                     /translation="MKKFGLGVYLLLLGILGGSLIILGAIVAPIVFKASSILPELNLT
                     PFESGKLMAQIFVRFNYILGAIGFVVLLYEIISFIYYKRSLVYLILGVAIGALCFLFV
                     FYYTPYILNAQKAGEVALQSAEFARSHAQSEWLFKELFVLVCALFFWRLFGKNAL"
     gene            345747..354446
                     /locus_tag="HPSH112_RS01695"
                     /old_locus_tag="HPSH112_01745"
     CDS             345747..354446
                     /locus_tag="HPSH112_RS01695"
                     /old_locus_tag="HPSH112_01745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin outer membrane protein"
                     /protein_id="WP_000713677.1"
                     /translation="MKKFKKKPKSIKRSHQKTILKRPLWLAPLLISGFASGVYANNLW
                     DLLNPKVGGEYVHWVKGSQYCAWWEFAGCLKNVWGANHKGYDAGNAANYLSSQNYQAI
                     FVGSGNETGTYSLSGFTNYVGGNLTINLGNSVVLDLSGSNSFTSYQGYNQGKDDVSFN
                     VGAINLNGALEVGNRVGSGAGTHTGTATLNLNANQVNINSNISAFKTSQVNIGNANSV
                     ITIGSVSLSGDTCSSLTRVGVGANCSTSGPSYSFKGITNATNTAFSNASGSFTFEENA
                     AFSGAKLNGGTYTFNKGFSATNNTAFNSGSFNFKGASSFNGATFNNATYTFNNQATFQ
                     NSSFNGGTFTFNNQTNQTNSAQHPQILFENSSFSGNATTLKGFVDFQQAFNNSSHQLT
                     AQNASFNGANFNNTGKITIEKEVSFNNTTFNTSINTSNMTITGSVTLSGKNDLKNGST
                     LDFGSSQVTLTQGTTFNLTSLGDKNSVTILNSSGGITYNNLLNHALNSLTNALKTSEN
                     SSDPQNFAQGLWDMITYNGVTGQLLSANIVASKVADSSLSKSSTNPTKVYQVGYKIGD
                     IIYKLQETFSHNSIIIQALESGTYTPPPVISGSKFDLSASNYIDSNMPWYDHKSYIPK
                     SQNFTESGTYYLPSVQIWGSYTNSFKQTFSASGSNLVIGYNSTWTDHNVSSSDTVSFG
                     DTSGSALNGHCGPWPYYQCTGTTDGAYSAYHVYITANLRSGNRIGTGGAANLIFNGVD
                     SVNIANATITQHNAGIYSSSMTFSTQSMDNSQNWNGLNPNGTLSVYGATFTNQAKDGK
                     FIFNAGKAVFENTNFNGGSYQFSGDSLNFSNNNQFNSGSFEISAKNASFNNANFNNSA
                     SFNFNNSNATTSFVGDFTNANSNLQIAGNAVFGNSNNGSQNNANFNNTGSVNISGNAT
                     FDNVVFNSPTNMSVKGQVALNNITLKNLNAPLSFGDGTITFNAHSVINIGEAITNGNP
                     ITLVSSSKEIEYNNAFSKNLWQLINYQGHGASSEKLVSSVGNGVYDVVYSFNNQTYNF
                     QEIFSPNSISIRRLGVGMVFDYMDMEKSDHLYYQNALGFMTYMPNSYNNNLGDSNNTI
                     YYYDKSIDFYASGKTLFTKAEFSQTFTGQNSAIVFGAKSIWTNASDAPQSNTIIRFGD
                     NKGAGSNDASGHCWNLQCIGFITGHYEAQKIYITGSIESGNRISSGGGANLNFNGLQG
                     ILLTNATLYNRAAGTQSSSMNFTSKSVNIQAQNSYFIDDTAQNGGNPNFSFNALNLDF
                     SNSSFRGYVGQTQSVFKFNASNAINFTNSTNLSSGLYQMQAKSVSFDNSNLSVSVGTS
                     SIKANAINLSQNASINASNHSTLELQGGLNLNDTSSLNLNQSVINVSNNATINDYASL
                     IVNDGSRLNFNGTTNFNSANITTSLNHSSIVFKGAISLGGQFNLSNNSSLDFQGSSAI
                     TSNTAFNFYDNAFSQSPITFHQALDIKASLSLGGNLLNPDNSSVLNLKNSQLVFSDQG
                     SLNIANIDLLSDLNDNKNRVYNIIQAGMNNNWYERINFFGMRINDGVYDAINQTYSFT
                     NPLNNALKITESFKDNQLSVTLSQIPGIKNTLYNISSEVFNYQKVYNNANGMYSYSDD
                     AEGVFYLTSNVKGYYSPNQSYQASGSNNTTKNNNLTSDSSVISQTYNAQGNPISALHV
                     YNKGYNFNNIKALGQMALKLYPEIKKILGNDFSLSSLSALNSNALNQLTKLITPNDWK
                     NINELIDNANNSVVQNFNNGTLIVGAAKIGQTNANSAVVFGGLGYQKPCDYTDIVCQK
                     FRGTYLGQLLESSSADLGYIDTTFNAKEIYLTGTLGSGNAWGTGGSASVTFNSQTSLV
                     LNQANIVSSQTDGIFSMLGQEGINKVFNQAGLANILGEVAMQSINKAGGLGNLIADML
                     GSNSVIGGHLTPEQKNQTLSQLLGQNNFDNLMNDSGLNVAIKDLIRQKLGFWTGLVGG
                     LAGLGGIDLQNPEKLIGSMSINDLLSKKGLFNQITGFISANDIGQVISVVLQDIVKPS
                     SALQNDVAALSKQMIGEFLGQDTLNSLESLLQNQQIKSVLDKVLAAKGLGPIYEQGLG
                     DLMPNLGKKGLFAPYGLSQVWQKGDFNFNAQGNVFVQNSTFSNANGGALSFNAGNSLI
                     FAGNNHISFTNHAGALNLLSNQVSNINITTLNVSNGLKINAANNNVSVSQGNLFINAS
                     CAGQSDSTTANIANPCALSAQSANGASSSNASNNAQIALNNNDESLMVTANDFNFSGN
                     IYANGVVDFSKIKGSANIKNLYLYNNAQFQANNLIISNQAVLEKNASFMANNLNIQGA
                     FNNNATRKIEVLQNLTIASNASLSTGIYGLEVGGALNNFGAIHFNLENIQTPTPLIQA
                     EGIINLNTTQTPFMNVNNSMANNTTYTLLKSSRYIDYNINPNSLQSYLNLYTLINING
                     NRIEEKNGVLTYLGQRVLLQDKGLLLSVALPNSNNAHQNNILSLSVLHNQIKMSYGDK
                     VMDFTPPTLQDYIVGIQGQSALNQIEAVGGNNAIKWLSTLMMETKENPLFAPIYLKNH
                     SLNEILGVAKDLLNTASLISNPNFRNNATNLLELASYTQQTSRLTKLSDFRAREGESD
                     FSERLLELKNKRFSDPNPSEVFAKYSQPNKHPNNLWVQGIGGASFISGGNGTLYGLNV
                     GYDRLVKNVILGGYVAYGYSGFNGNIMHSLANNVDVGMYARAFLKRNEFTLSANETYE
                     GNASNINSSNPLLSVLNQRYSYNTWTTSVNGNYGYDFMFKQKSVVLKPQVGLSYHFIG
                     LSGMKGKMNDAAYKQFLMHSNPSNESVLTLNMGLESRKYFGKNSYYFVTARLGRDLLI
                     KSKGGNMVRFVGENTLLYRKGEVFNTFASVITGGEMHLWRLVYVNAGVGLKMGLQYQD
                     INITGNVGMRVAF"
     gene            354494..355711
                     /locus_tag="HPSH112_RS01700"
                     /old_locus_tag="HPSH112_01750"
     CDS             354494..355711
                     /locus_tag="HPSH112_RS01700"
                     /old_locus_tag="HPSH112_01750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="WP_000483590.1"
                     /translation="MFNYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYA
                     LKANSNLSILSLLAHLESGADCVSIGEIYRALKAGIKPYRIVFSGVGKSEFEIEQALK
                     LNILFLNVESFMELQTIEKIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVG
                     EKEALEMFLWAKKSAFLEPISVHFHIGSQLLDLEPIVEASQKVAKIAKSLIALGIDLR
                     FFDVGGGIGVSYENEETIKLYDYAQRILNALQGLDLTIICEPGRSIVAESGELITQVL
                     YEKKAQNKRFVIVDAGMNDFLRPSLYHAKHAIRVITPSKGRKISPCDVVGPVCESSDT
                     FLKGVNLPELEPGDKLVIEKVGAYGSSMASQYNSRPKLLELALEDHQIRVIRKREALE
                     DLWRLEEEGLKGV"
     gene            355716..356006
                     /locus_tag="HPSH112_RS01705"
                     /old_locus_tag="HPSH112_01755"
     CDS             355716..356006
                     /locus_tag="HPSH112_RS01705"
                     /old_locus_tag="HPSH112_01755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate mutase"
                     /protein_id="WP_001171423.1"
                     /translation="MQKNLDSLLENLRAEIDVLDNELSDLLDKRLEIALKIALIKQEN
                     PIYCPKREQEILKRLSQRDFKHLNGEILTGFYAEIFKISRKFQENALKELKK"
     gene            356019..356891
                     /locus_tag="HPSH112_RS01710"
                     /old_locus_tag="HPSH112_01760"
     CDS             356019..356891
                     /locus_tag="HPSH112_RS01710"
                     /old_locus_tag="HPSH112_01760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000461860.1"
                     /translation="MFEKITLAHKDLFSRFLNAQKIVLSDVSFTNCFLWQHARLIQVA
                     VIRDCLVIQTTYDNQKPFYFYPIGKNALECVKELLKREKNLRFHSLTLEQKDDLKDNF
                     VGVFDFTYNRDRSDYIYSIEELIALKGKKYHKKKNHLNQFLTNCANFVYEKISSQNRK
                     EVLEASKEWFLESQTDDIGLINENKGIQSVLENYESLDVKGGLVRVNGEIVSFSFGEV
                     LNEETALIHIEKARMDIAGAYQIINQQLLLNEFSHLTYANREEDLGLEGLRRSKMSYN
                     PVFLIDKYEAVAKN"
     gene            356892..358571
                     /locus_tag="HPSH112_RS01715"
                     /old_locus_tag="HPSH112_01765"
     CDS             356892..358571
                     /locus_tag="HPSH112_RS01715"
                     /old_locus_tag="HPSH112_01765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="para-aminobenzoate synthase"
                     /protein_id="WP_000575946.1"
                     /translation="MIFGDFKYQKRIKKLTATNLHELKNALDFISQNRGNGYFVGYLL
                     YEARLAFLDENFQSQTPFLYFEQFLERKKYSLEPLKEHAFYPKIHSSLDQKTYFKQFK
                     AVKEYLKNGDTYQVNLTMDLFLDTKAKLKRVFKEVIHNQNTPFKAFIENEFGSVLSFS
                     PELFFELEFLDTAIKIVTKPMKGTIARSNNPLIDEKNRLFLQNDDKNRSENVMIVDLL
                     RNDLSRLALKNSVKVNQLFEIISLPSVYQMISEIEAKLPLKTSLFEIFKALFPCGSVT
                     GCPKIKTMQIIESLEKRPRGVYCGAIGMVEEKKALFSVPIRTLEKRAREDFLHLGVGS
                     GVTYKSKAPKEYEESFLKSFFVMPKIEFEIVETMKIIKKDQKLEINNKNAHEERLMNS
                     AQYFNFKHDENLLDFELEKEGVLRVLLNKKGKLIKEYKALEPLKSLEIRLSEAPIDKR
                     NDFLYHKTTYAPFYQNARALIKQGVIFDEIFYNQDLELTEGARSNLILEIHNRLLTPY
                     FSAGALNGTGVMGLLKKGLVEHAPLKLQDLQRASKIYCINALYGLVEVKIK"
     gene            358764..359783
                     /gene="amiE"
                     /locus_tag="HPSH112_RS01720"
                     /old_locus_tag="HPSH112_01770"
     CDS             358764..359783
                     /gene="amiE"
                     /locus_tag="HPSH112_RS01720"
                     /old_locus_tag="HPSH112_01770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207092.1"
                     /note="aliphatic amidase; catalyzes the hydrolysis of
                     short-chain aliphatic amides to their organic acids and
                     can also transfer the acyl moiety of short-chain amides to
                     hydroxylamine to form hydroxamates; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acylamide amidohydrolase"
                     /protein_id="WP_001215732.1"
                     /translation="MRHGDISSSPDTVGVAVVNYKMPRLHTKNEVLENCRNIAKVIGG
                     VKQGLPGLDLIIFPEYSTHGIMYDRQEMFDTAASVPGEETAILAEACKKNKVWGVFSL
                     TGEKHEQAEKNPYNTLILVNDKGEIVQKYRKILPWCPIECWYPGDKTYVVDGPKGLKV
                     SLIICDDGNYPEIWRDCAMRGAELIVRCQGYMYPAKEQQIAIVKAMAWANQCYVAVAN
                     ATGFDGVYSYFGHSSIIGFDGHTLGECGEEENGLQYAQLSVQQIRDARKYDQSQNQLF
                     KLLHRGYSGVFASGDGDKGVAECPFEFYKTWVNDPKKAQENVEKFTRPSVGVAACPVG
                     DLPTK"
     gene            complement(359863..362343)
                     /gene="flgL"
                     /locus_tag="HPSH112_RS01725"
                     /old_locus_tag="HPSH112_01775"
     CDS             complement(359863..362343)
                     /gene="flgL"
                     /locus_tag="HPSH112_RS01725"
                     /old_locus_tag="HPSH112_01775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207093.1"
                     /note="with FlgK acts as a hook filament junction protein
                     to join the flagellar filament to the hook; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="WP_001266679.1"
                     /translation="MRVTFGSKYNQMNNYQNALQNKINDANTQIASGLKIRYGYQNSD
                     INNQNLKFQYEENTLDQGIDVAQNAYTSTLNTDKALQEFSKTMETFKTKLIQSANDVH
                     SETSRVAIANDLERLREHMMNVANTSIGGEFLFGGSKVDRPPIDSEGKYHGNGEDLNA
                     LISSDNLVPYNISGQDLFLGADKDKHKLITTNIKLLNQNKLHPDVMDALEHSSLPEEV
                     FIKPGDTLRELIGDNDKDPTNDPKEFFYLQGIRPDGSSFKEKFALDKAYQNKESATKV
                     SDLLDKIGHAYGNTSQNKVVDVSLNNWGQIEIKNLTPGSENLDFHLISSDGDFDDLDA
                     LRSSAKRVTEYVKSAFVTDRSLSQVKAVPNMYNPRVLEIPSVFVTKDNVLANKNTKLS
                     EIFGDSVETLKINARDDTSAIKIPNLPVYLDIPILLNVKNSTIKDLKDAIKERFNNEV
                     DVEIETNGRLRIIDNSSNQSPISFALSALDQKGLEVAGIPTNNASEYQKTYFNKEGAK
                     LESNVAQIAQNGAANGSTKLSEVANGSLENSVFNMKLNDVNGSFLEAQMILDNNGAFL
                     SLPNGIKIPLYDPTSADIQASKPNEVTYRQLMDAMSIALNYSNTDPAIYQQISDNPTS
                     KESKERFIELLKQAKDNLSVNLNEEGKVIIQDNMHSNTKMQFMLFDKDANDFSQNALH
                     SDKPSLKLNANNALIIDKPSVNFFDQLENTITSVRKGIYRPDALGDTYSSDMRNLGIQ
                     NGITLIDHLSDHIEKMIAKNGAHGKTFENIIRRNEVLKTQVQSIRGETTGTDMAETYN
                     KFSNLTNNYNAVLASTNKINNLSLTKYL"
     gene            362588..362902
                     /locus_tag="HPSH112_RS01730"
                     /old_locus_tag="HPSH112_01780"
     CDS             362588..362902
                     /locus_tag="HPSH112_RS01730"
                     /old_locus_tag="HPSH112_01780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="WP_000119318.1"
                     /translation="MSYAIFKHGGKQYKVVEGDIVLLDKMDKEPKALVELVEVLAVSK
                     EGKLSCGKPFVNGAKIEAEVINEGRGKKVITFKKRRRKDSKTKRGFRRDFTRVRITKI
                     VA"
     gene            362917..363183
                     /locus_tag="HPSH112_RS01735"
                     /old_locus_tag="HPSH112_01785"
     CDS             362917..363183
                     /locus_tag="HPSH112_RS01735"
                     /old_locus_tag="HPSH112_01785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="WP_000940618.1"
                     /translation="MAHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTK
                     MHPGNNVGMGKDHTLYALIDGVVKFEHKDRNRKKVSVVSQNFGE"
     gene            363298..364947
                     /locus_tag="HPSH112_RS01740"
                     /old_locus_tag="HPSH112_01790"
     CDS             363298..364947
                     /locus_tag="HPSH112_RS01740"
                     /old_locus_tag="HPSH112_01790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207096.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_001066749.1"
                     /translation="MNNVFVKGLFFFLLLFGFFLKALENPNATLNPSKENVSVEEQKR
                     FGGVLVFARGADGSSMDPALVTDGESYVATGNIYDTLVQFKYGTTEIEPALATSWEIS
                     PDGLVYTFHLRKGVYFHQTKYWNKKVEFSAKDVLFSFERQMDKAKRYYNPGAKSYKYW
                     EGMGMSHIIKSIEALDDYTIRFTLNGPEAPFLANLGMDFLSILSKDYADYLAQNNKKD
                     ELAKKPIGTGPFKFFLWNKDEKIILLKNQDYWGSKAYLDKVVVRTIPNPSTRALALRT
                     GEIMLMTGPNLSEVEQLEKVPNIVVDKSAGLLASWLSLNTQKKYFNNPLVRLAINHAI
                     NVDDYIKVLYEGFAQKMVNPFPPTIWGYNYNIKPYEYDLKKAKELLKQAGYPNGFKTT
                     IFTTATRNPKGAVFIQASLAKIGIDVKIEVYEWGAYLKRTGLGEHEMAFAGWMADIAD
                     PDNFLYTLWSKQAASAIPTQNGSFYKSDAFSDLLLKAKRVSDQKEREALYLKAQEIIH
                     KDAPYVPLAYPYSVVPHLSKVKGYKTTGVSVNRFFKVYLEK"
     gene            364958..365962
                     /locus_tag="HPSH112_RS01745"
                     /old_locus_tag="HPSH112_01795"
     CDS             364958..365962
                     /locus_tag="HPSH112_RS01745"
                     /old_locus_tag="HPSH112_01795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207097.1"
                     /note="transports peptides consisting of two or three
                     amino acids; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_000948028.1"
                     /translation="MLSFIIKRVLWAIPTLFGVSIIVFMMVHLVPGDPALVILGEKAN
                     QAAIDALREQFGLNKPLIEQYFFFINNVLHGNFGTSIMTGEPVMHEFLQRFPATVELA
                     LIALFMALVLGISVGVLAAIKRYSVFDYSSMTFALAGISMPVFWLGLMLIYIFSVQLG
                     WLPVFGRLSDVYYLDGPTGFYLIDSLIARDYGAFVDTIKHLILPSIVLATVSTAVIAR
                     MTRASMAEVSKEDYVRTAKAKGCSSFRVIFVHTLRNALIPVTTIAGLMLAGLLGGSMI
                     TETVFSWPGIGKWIVNALNQRDFPIIQSMSLIIAMMYIGANLLVDILYAFIDPRIRLS
                     "
     gene            365962..366819
                     /locus_tag="HPSH112_RS01750"
                     /old_locus_tag="HPSH112_01800"
     CDS             365962..366819
                     /locus_tag="HPSH112_RS01750"
                     /old_locus_tag="HPSH112_01800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_000443364.1"
                     /translation="MESFREFIQQFKKNKAAVVGAWIVLLLVVCAIFAPLLAPHDPYA
                     QNAQDRLLKPIWEHGGNIKYLLGTDDLGRDILSRLIYGARISLTIGIVSMGIAVFFGT
                     ILGLIAGYFGGKTDAVIMRIMDIMFALPSILLIVIVVAVLGPSLTNAMLAIGFVGIPG
                     FARLVRSSVLGEKEKEYVIASKINGSSHLRLMCKVIFPNCIIPLIVQTTMGFASTVLE
                     AAALSFLGLGAQPPKPEWGAMLMNSMQYIATAPWMLVFPGVMIFLTVMSFNLVGDGIM
                     DALDPKRAS"
     gene            366831..367694
                     /locus_tag="HPSH112_RS01755"
                     /old_locus_tag="HPSH112_01805"
     CDS             366831..367694
                     /locus_tag="HPSH112_RS01755"
                     /old_locus_tag="HPSH112_01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000599913.1"
                     /translation="MILEVKNLKTYFFTDKGVNKAVDGVSFGLKKSQTLCIVGESGSG
                     KSITSLSILGLIEKPGQIVGGNIQFLGQDLLQLKEKQMQKEIRGKKIGMIFQEPMTSL
                     NPSYTVGFQINEVLKIHHPNLNKKERLERVVYELERVGIPHAGDKYHEYPFNLSGGQR
                     QRVMIAMAMVCEPEILIADEPTTALDVTIQAQILELMKELQQKKGTSILFITHDLGVV
                     AQIADEVVVMYKGHVVEQASAKELFADPRHPYTKALLSAIPKPGKEYRKKRLETVDEN
                     IDYLSFQKELR"
     gene            367691..368497
                     /locus_tag="HPSH112_RS01760"
                     /old_locus_tag="HPSH112_01810"
     CDS             367691..368497
                     /locus_tag="HPSH112_RS01760"
                     /old_locus_tag="HPSH112_01810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000770449.1"
                     /translation="MKLLEIKELKKSYAIDRGLFKPKRIIHALNGISFEVEQNEVLSI
                     VGESGCGKSTTAKILAGIERQDSGAIYFNGKRHLHFSKQDWFDYRKKVQMIFQDPYSS
                     LNPRWKVGEIIAEPLLLNSHFSKKEIKTKVLEIMQKVGLKLEWIDRYPHQFSGGQRQR
                     IGIARALILHPSVVICDEPVSALDVSIQAQVLNLLLDLQKEMGLTYIFISHDLGVVEH
                     ISDKIIVMNQGQIVETGDVDSVISAPKHPYTQKLLNAVPHLEKSMQRFAE"
     gene            368517..369599
                     /locus_tag="HPSH112_RS01765"
                     /old_locus_tag="HPSH112_01815"
     CDS             368517..369599
                     /locus_tag="HPSH112_RS01765"
                     /old_locus_tag="HPSH112_01815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase ObgE"
                     /protein_id="WP_000497292.1"
                     /translation="MFVDSVEIIVASGKGGPGMVSFRREKFVIKGGPDGGDGGDGGDV
                     YFEVDNNTDTLASFRGTKHHKAKNGAPGGTRNCTGKKGEDKIIVVPPGTQVFVDDKLW
                     LDLVEPKKRVLALKGGKGGLGNAHFKSAIKQQPTYAQKGLEGVEKCVRLELKLIADIG
                     LVGFPNAGKSTLISTISNAKPKIANYEFTTLVPNLGVVSVDEKSEFLMADIPGIIEGA
                     SEGKGLGISFLKHIERTKVLAFVLDASRLDLGIKEQYQRLRLELEKFSPALANKPFGV
                     LLNKCDVVENIDEMAKDFCAFLNLEAQKLEAFGLEPYLGFLHPHLTSDFENNPNEKSA
                     LFVLPLSALSALNTHALKFVLLEALP"
     gene            369641..370636
                     /locus_tag="HPSH112_RS01770"
                     /old_locus_tag="HPSH112_01820"
     CDS             369641..370636
                     /locus_tag="HPSH112_RS01770"
                     /old_locus_tag="HPSH112_01820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000819997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alginate lyase"
                     /protein_id="WP_000819937.1"
                     /translation="MKRFVLFLLFMCVCVCVQAHAEQDYFFRDFKSTDLPQKLHLDKK
                     LSQTIQPCVQLNASKHYTSAGVREPDACTKSFKKSAIMSYDLALGYLVSKNKQYGLKA
                     IEILNAWAKELQSVDTYQSEDNINFYMPYMNMAYWFVKKAFPSPEYEDFIKRMHQYSQ
                     SALNTNHGAWGILFDVSSAIALDDHALLQNSANRWQEWVFKAIDENGVIPSAITRSDT
                     SDYHGGPTKGIKGIAYTNFALLALTISGELLFENGYDLWGSEAGKRLSVAYNKVATWI
                     LNPETFPYFQPNLIGVHNNAYFIILAKHYSSPSADELLKQGDLHEDGFRLKLRSL"
     gene            370885..371439
                     /locus_tag="HPSH112_RS01775"
                     /old_locus_tag="HPSH112_01825"
     CDS             370885..371439
                     /locus_tag="HPSH112_RS01775"
                     /old_locus_tag="HPSH112_01825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polyisoprenoid-binding protein"
                     /protein_id="WP_000738963.1"
                     /translation="MKKMVLVSVLLAGFLQAVNLDLSSAKLTWTAFKTKAKTPVNGSF
                     ESITYKLGKSQDSLKTLLEGASASMDSLKVNLGDDTKNKNVKEAFFALFKSTNIKVTF
                     RNVIEGDHEGSLTAYVRMNEKLVKVPMQYTVASDKLVVKGVLDLLNFGLKNELASLAK
                     RCESFHEGLTWSQVEIQFESMIKG"
     gene            371449..372741
                     /locus_tag="HPSH112_RS01780"
                     /old_locus_tag="HPSH112_01830"
     CDS             371449..372741
                     /locus_tag="HPSH112_RS01780"
                     /old_locus_tag="HPSH112_01830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde-2,1-aminomutase"
                     /protein_id="WP_000421479.1"
                     /translation="MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGA
                     YLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINVLKKGTSFGAPTELETTLAKEII
                     SCYEGLDKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLLVKAGSGCA
                     TFGSPSSLGVPNDFSKHTLVARYNDLNSTEECFKKGDVGCVIIEPIAGNMGLVPAQKE
                     FLLGLKALCEKYQAVLILDEVMSGFRASLSGSQEFYGVVPDLVTFGKVIGAGLPLACF
                     GGRAEIMDLLSPIGGVYQAGTLSGNPLAVCAGLSALYKIKRDKTLYTRLNALAVRLTQ
                     GLKKSAQNYNIALETLNRGSMFGFFFNENAVRDFDDALKSDTEMFAKFHQKMLFKGVY
                     LACSSFETGFICEPMTEEMIDLAVAKADESFDEIIKGV"
     gene            372734..373003
                     /locus_tag="HPSH112_RS01785"
                     /old_locus_tag="HPSH112_01835"
     CDS             372734..373003
                     /locus_tag="HPSH112_RS01785"
                     /old_locus_tag="HPSH112_01835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000333088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000333084.1"
                     /translation="MCEFLKKPKYYKFIEGANYLSLGLSMVVAILMGVAIGYGLKKLT
                     HISWLFWLGVIWGVLASFLNVYKAYKNMQKDYEELAKDPKHTQNK"
     gene            373019..373423
                     /locus_tag="HPSH112_RS01790"
                     /old_locus_tag="HPSH112_01840"
     CDS             373019..373423
                     /locus_tag="HPSH112_RS01790"
                     /old_locus_tag="HPSH112_01840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000336425.1"
                     /translation="MCQIKCLLILLSINIVSAIIIYFFQAFQGVLNFEGGFLGFFIVA
                     LSSYYGVKKRLDLRKQNSGEKEEKQKFQKFALGLEMSFNVWRLGGYGVLLGILGALLF
                     LHLFNGLIFLIGVFVSSLSSALLRFLNNNGKF"
     gene            373507..374391
                     /locus_tag="HPSH112_RS01795"
                     /old_locus_tag="HPSH112_01845"
     CDS             373507..374391
                     /locus_tag="HPSH112_RS01795"
                     /old_locus_tag="HPSH112_01845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoyl-D-amino acid amidohydrolase"
                     /protein_id="WP_000850687.1"
                     /translation="MKTKNPAKRILKTATIQMQSKPYALNENLQLALNLAKEAHNKGA
                     NLIVLPELFDSGYCVNDKDAEFGIDLKAIEHRKETLKNESLRALSDFAKSNKVHLVAC
                     SIEKTDKKLYDSAYIIPPKGGIVGKHRKVYLWGDEKSRFKRGKKYEVFTLDFGDFSAK
                     VGLQICYEIGFGVGANLLALQGAEILIYPSAFGKARAYNWDLLSKARALENGCFVCAC
                     NHSGEETNAQLKQTLEFAGDSRIIAPNGKIIAQATRLNEAIIAEMDLNEAALQRQKIP
                     YLQDFDTKLTKKGFGKLT"
     gene            374404..375285
                     /locus_tag="HPSH112_RS01800"
                     /old_locus_tag="HPSH112_01850"
     CDS             374404..375285
                     /locus_tag="HPSH112_RS01800"
                     /old_locus_tag="HPSH112_01850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001040381.1"
                     /translation="MAKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIP
                     RLLKLFKKYHLPATWFAPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEE
                     DVLLKSIELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYFVR
                     VGDSWSKIDYSLEAKDWMKPLIRGVETDLVEIPANWYLDDLPPMMFIKKSPNSFGFVS
                     PRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWV
                     TFNEIADDFLKRSPRKK"
     gene            complement(375339..376031)
                     /locus_tag="HPSH112_RS01805"
                     /pseudo
     CDS             complement(375339..376031)
                     /locus_tag="HPSH112_RS01805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000094824.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
     gene            complement(376042..377151)
                     /locus_tag="HPSH112_RS01810"
                     /old_locus_tag="HPSH112_01860"
     CDS             complement(376042..377151)
                     /locus_tag="HPSH112_RS01810"
                     /old_locus_tag="HPSH112_01860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001154470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-specific DNA-methyltransferase"
                     /protein_id="WP_001154467.1"
                     /translation="MQDYRTLTLENIYAPDEITDALSLLQSCGIESIVNPSNITLNFD
                     IVDLKMLESTTQNTLVQKTLEELYKIRSFSSQNGKIVFKSFNKAKKVANKKQNAKARL
                     AYESYKKEFSKETNEIQSCLNQIYCEDSLEFLKKLPNNCIDIVLTSPPYNFGINYSAT
                     QDANLWHEYFNTLFAIFKECIRVLKSGGRIIVNIQPMFSDYIPTHHFISKFFIDEGLI
                     WKGEILWEKNNYNCKYCTWGSWKSPAAPYLKYSWEFIEIFCKNNLKKEGDKDSIDITD
                     DEFKKWVYGKWNFAPERNMKQYGHDAMFPEELVKRCLKLFSYQNDIILDPFNGAGTTT
                     KVAKQLGRRFIGIDISEKYCEVARARLKEVTNLFN"
     gene            377247..377603
                     /locus_tag="HPSH112_RS01815"
                     /old_locus_tag="HPSH112_01865"
     CDS             377247..377603
                     /locus_tag="HPSH112_RS01815"
                     /old_locus_tag="HPSH112_01865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000337973.1"
                     /translation="MCVLCGELISSFHWTDSYENENLKGQNALISANENARERKRARI
                     KRVGLLNQILAFYGLKMDDWQGAKFVLCDKKGQSVIVNDLGDLWDKAQNLAKKEMDAL
                     DSHLLAFLNQNTNAIH"
     gene            377603..378568
                     /locus_tag="HPSH112_RS01820"
                     /old_locus_tag="HPSH112_01870"
     CDS             377603..378568
                     /locus_tag="HPSH112_RS01820"
                     /old_locus_tag="HPSH112_01870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_001124381.1"
                     /translation="MPKIPITLITGFLGSGKTSFLSEYLNQTDHQGVVLIINEIGQAA
                     LDQRILNIQYCGEKMLYLNAGCVCCNKRMDLVESLKATLNNYEWRGEILKRIIIETTG
                     LANPVPILWTILSDTFLGAHFEIQSVVVCVDALNARMHLTNNEAKEQIVFADSVLLTK
                     TDLQNDSVALIKLKERLQSINPSAEIFDKKNIHYESFFSRKNRVRNFMPRMPKDSHSQ
                     GFETLSINFEGAMEWSAFGIWLSLLLHKYGTQILRIKGIIDTGSGFLVSINGVMHIIY
                     PPKHILKDQNGSNLVFIMRHLEREKILNSLKGFKDFLGIKGFETQ"
     gene            complement(378574..379719)
                     /locus_tag="HPSH112_RS01825"
                     /old_locus_tag="HPSH112_01875"
     CDS             complement(378574..379719)
                     /locus_tag="HPSH112_RS01825"
                     /old_locus_tag="HPSH112_01875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001263596.1"
                     /translation="MRVFVCFLGVFVSNGLARFGYVVLIPLLILSGSLTPHQSFQLGI
                     AVLMGYVFGSFLIQFLSPLMSLESIAKISFGLIALSFLICYFDSIPFFWLWIWRFIAG
                     VASSALMILVAPLSLPYVKENKRALVGGLIFSAVGVGSVFSGFVLPWISSYNIKWAWI
                     FLGGSCLIAFILSLIGLKNHSLRKKSVKKEESAFKIPFHLWLLLISCALNAIGFLPHT
                     LFWVDYLIRHLNISPAIAGTSWAFFGFGATLGSLISGPMAQKLGAKNANIFILILKSI
                     ACFLPIFFHQISLLNLSIFIMGAATTANINLFSMMALKIAGAKHFAKASSWVVFSFGI
                     FQALFSYLFTIFLGDLGYLLIFVICGACLVLSFIVLFPIKMQTAINQ"
     gene            complement(380216..380971)
                     /locus_tag="HPSH112_RS01830"
                     /old_locus_tag="HPSH112_01880"
     CDS             complement(380216..380971)
                     /locus_tag="HPSH112_RS01830"
                     /old_locus_tag="HPSH112_01880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HugZ family heme oxygenase"
                     /protein_id="WP_000934604.1"
                     /translation="MLNRIIEHMNAHHVEDMKGLLKKFGQVHHAENVAFKSVDSQGVV
                     IGYNNNQTLRIEFNHEVKDPKDYKNAIIELCQSVEKTHDLKGVEEEVKAFKEGFDSVC
                     LATLHPNGHVVCSYAPLMTDGKQYYIYVSEVAEHFAGLKHNPHNVEVMFLEDESKAKS
                     AILRKRLRYKTNARFIERGAEFDKAFDSFIEKTGGAGGIKTIRTMQDFHLIALDFKEG
                     RFVKGFGQAYDILGDEIAYVGGKGNPHDFAHKK"
     gene            complement(381032..382657)
                     /locus_tag="HPSH112_RS01835"
                     /old_locus_tag="HPSH112_01885"
     CDS             complement(381032..382657)
                     /locus_tag="HPSH112_RS01835"
                     /old_locus_tag="HPSH112_01885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine--tRNA ligase"
                     /protein_id="WP_000557179.1"
                     /translation="MHTLIKGVLEEILEEEVIIEYPKDREHGHYATPIAFNLAKVFKK
                     SPLVIAEELALKISTHEKTQGLFDSVVACKGYINFTLSLDFLERFTQKALELKEKFGS
                     QPKSERSQKIFLEFVSANPTGPLHIGHARGAVFGDSLAKIARFLGHEVLCEYYVNDMG
                     SQIRLLGLSVWLAYREHVLKESVTYPEVFYKGEYIIEIAKKANNDLEPSLFKENEETI
                     IEVLSGYAKDLMLLEIKDNLDALGIHFDSYASEREIFKHKDAVFERLEKANALYEKDS
                     KIWLKSSLYQDESDRVLIKEDKSYTYLAGDIVYHDEKFKQNYTKYINIWGADHHGYIA
                     RVKASLEFLGYDSNKLEVLLAQMVRLLKDNEPYKMSKRAGNFILIKDVIDDVGKDALR
                     FIFLSKRLDTHLEFDVNTLKKQDSSNPIYYIHYANSRIHTMLEKSPFSKEEILQTPLT
                     NLNAEEKYLLFSALSLPKIIESSFEEYGLQKMCEYAKTLASEFHRFYNAGKILDTPKA
                     KELLKICLMVSLSLSNAFKLLGIEIKTKISAKD"
     gene            complement(382660..382899)
                     /locus_tag="HPSH112_RS01840"
                     /old_locus_tag="HPSH112_01890"
     CDS             complement(382660..382899)
                     /locus_tag="HPSH112_RS01840"
                     /old_locus_tag="HPSH112_01890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase TatA/TatE family
                     subunit"
                     /protein_id="WP_000508577.1"
                     /translation="MGGFTSIWHWVIVLLVIVLLFGAKKIPELAKGLGSGIKNFKKAV
                     KDDEEEAKNEPKTLDAQAAQTKVHETSEIKSKQES"
     gene            complement(382969..383589)
                     /locus_tag="HPSH112_RS01845"
                     /old_locus_tag="HPSH112_01895"
     CDS             complement(382969..383589)
                     /locus_tag="HPSH112_RS01845"
                     /old_locus_tag="HPSH112_01895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="WP_000551236.1"
                     /translation="MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPR
                     EGEVDGLHYNFVSEEEFKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDI
                     DVQGHEILKRHYPNACSVFISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLE
                     SFDYLIINEDLEKSKEIILSIAKTLVHRLKAFNFEKICKAWKNESL"
     gene            complement(383582..385258)
                     /locus_tag="HPSH112_RS01850"
                     /old_locus_tag="HPSH112_01900"
     CDS             complement(383582..385258)
                     /locus_tag="HPSH112_RS01850"
                     /old_locus_tag="HPSH112_01900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000782086.1"
                     /translation="MKMILFNQNPMITKLLESVSKKLELSMEDFNRYQELSTRLKEDP
                     EWILIADDECLEKLDQVDWLELKEIISQNKNSVCMYKKGHEAQPFLEGFEMKIKKPFL
                     PTEILKILQKKLGSNMSELEPSQNLDPTQEVLETNWDELENLGDLKALVQEEPNNEEQ
                     LLPTLNAQEEKEEVKEEVKETPQEEEKEEVKETPQEEEKEEVKETPQEEEKPKDDEIQ
                     EGETLKDKEVSKELETQEELEIPKEETQEQAKEQESIKEETQEQAKEQESIKEETQEQ
                     AKEQEPIKEETQEIKEEKQEKTQDSPSAQELEAMQELVKEIQENSNSQEDKKEAQESA
                     ETPQETPQENTETPQETEKQELETPKEEAQENAETPQETPQENTETPQETPQELETPQ
                     ELETPQELETPQELETPQENAETPQETEKQELETPQEEKQELETPQESTETPQKETQE
                     LETQEDHYESIEDIPEPVMAQAMGEALPFLSESVAKTSNNENDTETPKESVIKTPQEK
                     EGSDKTSNPLELRLNLQDLLKSLNQESLKNLLENKTLSIKITLEDKKPDA"
     gene            385400..385942
                     /locus_tag="HPSH112_RS01855"
                     /old_locus_tag="HPSH112_01910"
     CDS             385400..385942
                     /locus_tag="HPSH112_RS01855"
                     /old_locus_tag="HPSH112_01910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207121.1"
                     /note="membrane-associated cation-independent thermostable
                     nuclease; preferentially cleaves ss-DNA; involved in DNA
                     transformation; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_000932469.1"
                     /translation="MLNKFKKIVGAGVLVGCLGVLQAKNSLFVLPYEQKDALNSLVSG
                     ISSARESVKIAIYSFTHRDIARAIKSVASRGIKVQIIYDYESNHNNKQSTIGYLDKYP
                     NTKVCLLKGLKAKNGNYYGIMHQKVAIIDDKIVFLGSANWSKNAFENNYEVLLKTDDT
                     ETILKAKSYYQKMLGSCVGF"
     gene            complement(385950..386714)
                     /locus_tag="HPSH112_RS01860"
                     /old_locus_tag="HPSH112_01915"
     CDS             complement(385950..386714)
                     /locus_tag="HPSH112_RS01860"
                     /old_locus_tag="HPSH112_01915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207122.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000773856.1"
                     /translation="MKLNLQEIKLRTLLKMLVGASLLAHALIAKEESAAPSWTKNLYM
                     GVNYQTGSINLMTNIHEVREITNYQTGYTNIITSVNSVKKLTNMGSNGIGLVMGYNHF
                     FHPDKILGLRYFAFLDWQGYGMRYPKGYYGGNNMITYGVGVDAVWNFFQGSFYQDDIG
                     VDIGVFGGIAIAGNSWYIGSKGKELLGITNSRAVDNTSFQFLFNFGLKALFVDEHEFE
                     IGFKFPTINNKYYTTDALKVQMRRVFAFYVGYNYHF"
     gene            386817..387530
                     /locus_tag="HPSH112_RS01865"
                     /old_locus_tag="HPSH112_01920"
     CDS             386817..387530
                     /locus_tag="HPSH112_RS01865"
                     /old_locus_tag="HPSH112_01920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein"
                     /protein_id="WP_000709991.1"
                     /translation="MKKALYLGAVAFSVAFSMASANEPKIDFNPPNYVEETPSKEFIP
                     ELNKLGSLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPP
                     RLTYNGLDERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKV
                     LENGNYFIYGNKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHL
                     SDSNKKKFAADAMETQMPY"
     gene            387548..388231
                     /locus_tag="HPSH112_RS01870"
                     /old_locus_tag="HPSH112_01925"
     CDS             387548..388231
                     /locus_tag="HPSH112_RS01870"
                     /old_locus_tag="HPSH112_01925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001925231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pseudaminic acid cytidylyltransferase"
                     /protein_id="WP_001201338.1"
                     /translation="MRAIAIVLARSSSKRIKNKNIIDFFNKPMLAYPIEAALNSKLFE
                     KVFISSDSMEYVHLAKNYGASFLNLRPKVLADDRATTLEVMAYHMKELELKDEDIACC
                     LYGTSALLQEKHLKNAFEILKGNTDYVFTCSPFSASPYRSFSLENGVQMAFKEHLNTR
                     TQDLKTLYHDAGLLYMGKAQAFKEMRPIFSQNSIALELSPLEVQDIDTLEDLELAKLK
                     YSRLKNACQ"
     gene            388201..389094
                     /locus_tag="HPSH112_RS01875"
                     /old_locus_tag="HPSH112_01930"
     CDS             388201..389094
                     /locus_tag="HPSH112_RS01875"
                     /old_locus_tag="HPSH112_01930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001144416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CMP-N-acetylneuraminic acid synthetase"
                     /protein_id="WP_080024689.1"
                     /translation="MQPFEKRMPVKILCDCFLTSGLGHVRRCEKILSFIEKLGVKADL
                     YLYKHNNISAFLEGVGNDDFLIIDSYCLNSKDFYLLKEKAKSLMVIEDKEHVKGFYPK
                     NTKIMNFTLNALKHYHYLSKDYQYYLGVGFYPVDIRFVYERPINTENKEVLITLGGSE
                     QKTLKEIVKILENKGMHLHIISPHIPKNPPKNTHYYSPLSPLEFSSLMKFCACAISAA
                     GQTLYELALSQTPSLIIPIASNQIIQSQEFESLGIFKQTSLKTLAKDFEKLQIQKNQA
                     WAKNLAFGSELEGALREFLEI"
     gene            389091..389633
                     /locus_tag="HPSH112_RS01880"
                     /old_locus_tag="HPSH112_01935"
     CDS             389091..389633
                     /locus_tag="HPSH112_RS01880"
                     /old_locus_tag="HPSH112_01935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-4-amino-4,
                     6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase"
                     /protein_id="WP_000742581.1"
                     /translation="MKKNYCYKNIQAIDFAHLNDEEKLLVLEFRNHPNTALWMYSAFI
                     SLKTHLQFIEDLKNSPNHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNR
                     GETILKALERIAFEEFQLNSLHLEVMENNFKAIAFYEKNHYELEGRLKGFVSKEKEFI
                     DVLLYYKDKKGYNDRSVLKL"
     gene            complement(389566..390504)
                     /locus_tag="HPSH112_RS01885"
                     /old_locus_tag="HPSH112_01940"
     CDS             complement(389566..390504)
                     /locus_tag="HPSH112_RS01885"
                     /old_locus_tag="HPSH112_01940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="WP_000833938.1"
                     /translation="MKSDKPFLERYFYDPTLLQKGLIFALYPFSLIYQGIATLKRKTA
                     KKHDFKIPIISVGNLIAGGSGKTPFILETAPRYQEVAVISRGYQRDSKGLVVVSVKGN
                     ILVSQQTAGDEAYLLALNLKQASVIVSEKRELGVLKALELGAKIVFLDDGFRFNFNQF
                     NLLLKPKVPPYYPFCLPSGLYRESIKSYKEAHLVITEDKDYKRITSISHPTKRMLLAT
                     AIANPSRLDAFLPKEVVKKLYFRDHAPFDLKLLEKEFYQNNATSLLVTSKDLVKLQDC
                     NLPLSVLDLKLEICPKVLEQIDRYILSYPCNTKEHL"
     gene            complement(390501..391283)
                     /locus_tag="HPSH112_RS01890"
                     /old_locus_tag="HPSH112_01945"
     CDS             complement(390501..391283)
                     /locus_tag="HPSH112_RS01890"
                     /old_locus_tag="HPSH112_01945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207127.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(+) synthetase"
                     /protein_id="WP_001168078.1"
                     /translation="MQKDHQKLIAYLCDFLEKEAQKRGFKKVVYGLSGGLDSAVVGVL
                     CQKVFKKNAHALLMPSLVSMPESKTDALDLCETFSIPYTEYSIAPYDAIFDSHFKDAS
                     LTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELF
                     KTEVYELACHLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQNKP
                     IDAETLTQLGYDEILVKNIMSRIQKNSFKLELPTIAKRFNPK"
     gene            391368..391444
                     /locus_tag="HPSH112_RS01895"
                     /old_locus_tag="HPSH112_t08200"
     tRNA            391368..391444
                     /locus_tag="HPSH112_RS01895"
                     /old_locus_tag="HPSH112_t08200"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:391402..391404,aa:Arg,seq:gcg)
     gene            391530..392522
                     /locus_tag="HPSH112_RS01900"
                     /old_locus_tag="HPSH112_01950"
     CDS             391530..392522
                     /locus_tag="HPSH112_RS01900"
                     /old_locus_tag="HPSH112_01950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207128.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="WP_001207777.1"
                     /translation="MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVRV
                     RIGLYQGSLSASKAKAEGFEVLEVKELVQQSDVIMALLPDELHKEVLEKEVIPFLKEG
                     QIVGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAIEQESSK
                     NNAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLEAIVRTGFETLIR
                     AGYPEELAYFECVHEVKLVADLLHYKGVEGLRKHISNTAEFGAIKNREPMGNLLEKRM
                     QKILKKIQNGSFAKDFLLEKSLNYPRLNTERKALKETKIEQIGEILRAPFNHKK"
     gene            392541..393347
                     /locus_tag="HPSH112_RS01905"
                     /old_locus_tag="HPSH112_01955"
     CDS             392541..393347
                     /locus_tag="HPSH112_RS01905"
                     /old_locus_tag="HPSH112_01955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinD"
                     /protein_id="WP_001019023.1"
                     /translation="MAIVVTITSGKGGVGKSTTAANLAIGLAESGKKVVAVDFDIGLR
                     NLDMILGLENRIVYDVVDVMEKNCNLSQALITDKKTKNLSFLAASQSKDKNVLDKEKV
                     AILINALRADFDYILIDSPAGIESGFEHAILHADMALVVVTPEVSSLRDSDRVIGIID
                     AKSNRAKKGMEVHKHLIINRLKPELVANGEMISIEEVLKILCLPLIGIIPEDSHIISA
                     TNKGEPVIRTDCESAKAYQRITRRILGEEVEYVEFKAKKGFFSALKGIFS"
     gene            393344..393577
                     /locus_tag="HPSH112_RS01910"
                     /old_locus_tag="HPSH112_01960"
     CDS             393344..393577
                     /locus_tag="HPSH112_RS01910"
                     /old_locus_tag="HPSH112_01960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor"
                     /protein_id="WP_000051411.1"
                     /translation="MSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIA
                     VIQKYTKSSDIHFKTIDGNQSVETIEVEIILPK"
     gene            393589..394389
                     /locus_tag="HPSH112_RS01915"
                     /old_locus_tag="HPSH112_01965"
     CDS             393589..394389
                     /locus_tag="HPSH112_RS01915"
                     /old_locus_tag="HPSH112_01965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000841113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA protecting protein DprA"
                     /protein_id="WP_000840094.1"
                     /translation="MKSNFQYSALENIPKAFDILKDPPKKLYCVGDTKLLDAPLKVAI
                     IGTRRPTPYSKQHTITLAREFAKNGAVIVSGGALGVDIIAQENALPKTIMLSPCSLDF
                     IYPTNNHKVIQEIAQNGLILSEYEKDFMPVKGSFLARNRLVIALSDAVIIPQADLKSG
                     SMSSARLAQKYQKPLFVLPQRLNESDGTNELLEKGQAQGIFNIQNFINTLLKDHHLKE
                     MPEIKDEFLEYCAKNPSYEEAYLKFGDKLLEYELLGKIKRINHIVVLA"
     gene            394386..394790
                     /locus_tag="HPSH112_RS01920"
                     /old_locus_tag="HPSH112_01970"
     CDS             394386..394790
                     /locus_tag="HPSH112_RS01920"
                     /old_locus_tag="HPSH112_01970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000599252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase RuvX"
                     /protein_id="WP_000599165.1"
                     /translation="MILACDVGLKRIGIAALLNGVILPLEAILRHNRNQASRDLSDLL
                     REKNIQVLVVGKPNESYADTNARIEHFIKLLDFKGEIVFINEDRSSIEAYENLGHLGK
                     KNKRLAIKDGRLDSLSACRILERYCQQVLKKC"
     gene            394964..395498
                     /locus_tag="HPSH112_RS08190"
                     /old_locus_tag="HPSH112_01975"
                     /pseudo
     CDS             394964..395498
                     /locus_tag="HPSH112_RS08190"
                     /old_locus_tag="HPSH112_01975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000954139.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            395692..396030
                     /locus_tag="HPSH112_RS01930"
                     /old_locus_tag="HPSH112_01980"
     CDS             395692..396030
                     /locus_tag="HPSH112_RS01930"
                     /old_locus_tag="HPSH112_01980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000699918.1"
                     /translation="MKIMHQVMDFLDSCKQTIQKNSNEALQKTKRALFKEKSQKIREQ
                     AVKIVEKRLKKEGMKLSDFNEEELKIMFEAEEKRLLEQIHAKESEENQEKSVKHFKEV
                     WEKGDNEQER"
     gene            396014..396574
                     /locus_tag="HPSH112_RS01935"
                     /old_locus_tag="HPSH112_01985"
     CDS             396014..396574
                     /locus_tag="HPSH112_RS01935"
                     /old_locus_tag="HPSH112_01985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000037125.1"
                     /translation="MSKKDSFISSVMGFFSEKNERWLLAHRHTRGFVIVAWLFRFKSI
                     AFSILITLLIILVDIWVYSDVRQFLLDTASSPILLLVALLIKWGVIVISVRQCYKFSK
                     KMFALIQKKRQIRESLKKRSHQQEGKTPPKERLSSVTEEIIAKKQEETQRQEAPEDTH
                     ERLSSVTEEIISKKLEELKARNDKGN"
     gene            complement(396731..397612)
                     /locus_tag="HPSH112_RS01940"
                     /old_locus_tag="HPSH112_01990"
     CDS             complement(396731..397612)
                     /locus_tag="HPSH112_RS01940"
                     /old_locus_tag="HPSH112_01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridine synthase"
                     /protein_id="WP_001117116.1"
                     /translation="MPFVEEEFEILKPTKALFFVLDVLKCSLKEAQRHLDKQRLKQNQ
                     QAVRKSQMIQGVVSLIHFKPNEKTQALVFETKDFGVFDKPPQVYTHPKGYFYHESLLD
                     YIQSHFGKNAHPAHRLDYETSGLVLAGKTLQSAKDLKALFMQKKVKKTYLALVHGLVD
                     KNIVIDKPILTLQSIQKDLRIRSKISPLGKPSTTLVEPLSYNPFLDISLLKITPLTGR
                     THQIRLHLSSVGHRIVGEGLYGVIDENAREYLQLKRENNTPLLMLHASSLAFEFKGAI
                     HEITSPMPKRFMPFLKD"
     gene            complement(397612..399162)
                     /locus_tag="HPSH112_RS01945"
                     /old_locus_tag="HPSH112_01995"
     CDS             complement(397612..399162)
                     /locus_tag="HPSH112_RS01945"
                     /old_locus_tag="HPSH112_01995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="WP_000810779.1"
                     /translation="MKQKLKAQIKERVASIAYNEKGFPSPFLFKDLKKAALKIIEAMR
                     ANTEILVVGDYDADGVISSTIMAKFFESLNYKHVRIVIPNRFIDGYGISKKFLEKHHA
                     PLIITVDNGISAFEAARFCKEKNYTLIITDHHCLHHDEVPDAYAVINPKQPDCDFIQK
                     EVCGALVAFYLCYGIHQLLGKEKSHSSELLCLAGVATIADMMPLTFFNRFLVSKALYF
                     LQKESLGAMGFLRQREVFRKRSLKASDISFSIAPLINSAGRMQDAKMALDFLSANNFQ
                     DGYFLYERLKACNMKRKMIQQQVFEEAFKHAMVGEKIIIAFKDDWHEGVLGIVASKLV
                     EATQKPSLVFTFKEGVYKGSGRSSSNIDLIDALNGVSSLLLGYGGHRQACGLSVGKNN
                     IISLFETLENFDFKILPFCEKEPPLTLTLKDIDRELLEIIEAGEPYGQENPEPLFQAQ
                     NLEVIEEKIIKESHQVLRFKDKECIKEAIYFNTERFLKAGEKVNAIFSVELDECSNEP
                     KMFVKSLL"
     gene            complement(399172..400788)
                     /locus_tag="HPSH112_RS01950"
                     /old_locus_tag="HPSH112_02000"
     CDS             complement(399172..400788)
                     /locus_tag="HPSH112_RS01950"
                     /old_locus_tag="HPSH112_02000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthetase"
                     /protein_id="WP_000373227.1"
                     /translation="MDRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDP
                     YINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIE
                     NERKGEYLGKTIQIVPHVTDEIKRRIKSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQ
                     LKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLD
                     KELKNKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNLNKLHPKMAA
                     WNTLVEKIIAPKHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENF
                     NEKTDLEGVDAVLVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIIEFCRNV
                     LGLKGANSTEFNQRCEYPVVYLIEDFIDQNHQKQVRTYNSPLGGTMRLGEYECEIVPN
                     SLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFGANHLIEAIELDDHPFFV
                     GVQFHPEFTSRLQSPNPIILDFIKSALHKS"
     gene            401047..401709
                     /locus_tag="HPSH112_RS01955"
                     /old_locus_tag="HPSH112_02005"
     CDS             401047..401709
                     /locus_tag="HPSH112_RS01955"
                     /old_locus_tag="HPSH112_02005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000829951.1"
                     /translation="MAENSFKNVTIQSKPFFLSQVKTLFLLGGVFSAFFILMVGLVFF
                     DCVNSMDNAIFNLMRSNSSNPILDQTLQRIVFLGSSQFVLPLSLLVGVFLSLYRRNLA
                     LGVWFVLSVILFEALLESLKHLLAHSIQWLSHSANFPNATALSLALFYGLLVLLIPHL
                     ITHQTLKNILSYSLFGLILLIGLALIVLGVSFSSVLGGFCLGALGACFSIGIYLSVFQ
                     KI"
     gene            401753..403456
                     /locus_tag="HPSH112_RS01960"
                     /old_locus_tag="HPSH112_02010"
     CDS             401753..403456
                     /locus_tag="HPSH112_RS01960"
                     /old_locus_tag="HPSH112_02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="WP_000364762.1"
                     /translation="MDLKVLLQRIVDFFIKLNKKQKIALIAAGVLITALLVFLLLYPF
                     KEKDYTQGGYGVLFERLDSSDNALILQHLQQNQIPYKILKDDTILIPKDKVYEERITL
                     ASQGIPKTSKVGFEIFDTKDFGATDFDQNIKLIRAIEGELSRTIESLNPILKANVHIA
                     IPKDSVFVAKEVPPSASVMLKLKPDMKLSPTQILGIKNLIAAAVPKLTTENVKIVNEN
                     GESIGEGDILENSKELALEQLRYKQNFENILENKIVNILAPIVGGKNKVVARVNAEFD
                     FSQRKSTKETFDPNNVVRSEQNLEEKKEGAPKKQVGGVPGVVSNIGPVQGLKDNKEPE
                     KYEKSQNTTNYEVGKTISEIKGEFGTLVRLNAAVVVDGKYKIALKDGANTLEYEPLSD
                     ESLKKINALVKQAIGYNQNRGDDVAVSNFEFNPMAPMLDNATLSEKIMHKTQKILGSF
                     TPLIKYILVFIVLFIFYKKVIVPFSERMLEVVPDEDKEVKSMFEEMDEEEDELNKLGD
                     LRKKVEDQLGLNATFSEEEVRYEIVLEKIRGTLKERPDEIAMLFKLLIKDEISSDSAK
                     G"
     gene            403475..404506
                     /locus_tag="HPSH112_RS01965"
                     /old_locus_tag="HPSH112_02015"
     CDS             403475..404506
                     /locus_tag="HPSH112_RS01965"
                     /old_locus_tag="HPSH112_02015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_000201851.1"
                     /translation="MATKLTPKQKAQLDELSMSEKIAILLIQVGEDTTGEILRHLDID
                     SITEISKQIVQLNGTDKQIGAAVLEEFFAIFQSNQYINTGGLEYARELLTRTLGSEEA
                     KKVMDKLTKSLQTQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSY
                     FPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEVGGLRAVAEIFNRL
                     GQKSAKTTLARIESVDNKLAGAIKEMMFTFEDISKLDNFAIREILKVADKKDLSLALK
                     TSTQDLTDKFLNNMSSRAAEQFIEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQ
                     TGEEEDVIE"
     gene            404493..405269
                     /locus_tag="HPSH112_RS01970"
                     /old_locus_tag="HPSH112_02020"
     CDS             404493..405269
                     /locus_tag="HPSH112_RS01970"
                     /old_locus_tag="HPSH112_02020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliH"
                     /protein_id="WP_000056306.1"
                     /translation="MSLNSRKNLIQKDHLNKHDIQKYEFKSMANLPPTTNPNGASLET
                     PNPEEPLEKKAIENDLIDCLLKKTDELSSHLVKLQMQFEKAQEESKALIENAKNDGYK
                     IGFKEGEEKMRNELTHSVNEEKNQLLHAITALDEKMKKSEDHLMALEKELSAIAIDIA
                     KEVILKEVEDNSQKVALALAEELLKNVLDATDIHLKVNPLDYPYLNERLQNASKIKLE
                     SNEAISKGGVMITSSNGNLDGNLMERFKTLKESVLENFKV"
     gene            405266..407122
                     /locus_tag="HPSH112_RS01975"
                     /old_locus_tag="HPSH112_02025"
     CDS             405266..407122
                     /locus_tag="HPSH112_RS01975"
                     /old_locus_tag="HPSH112_02025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="WP_000603059.1"
                     /translation="MILQNKTFDLNPNDIAGLELVCQTLRSRILEVVSANGGHLSSSL
                     GAVELIVSMHALFDCQKNPFIFDTSHQAYAHKLLTGRFESFSTLRQFKGLSGFTKPSE
                     SAYDYFIAGHSSTSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDR
                     KYPMIMILNDNEMSISTPIGALSKALSQLMKGPFYQSFRSKVKKILNTLPESVNYLAS
                     RFEESFKLITPGVFFEELGINYIGPINGHDLSAIIETLKLAKELKEPVLIHAQTLKGK
                     GYKIAEGRYEKWHGVGPFDLDTGLSKKSKSAILSPTEAYSNTLLELAKKDEKIVGVTA
                     AMPSGTGLDKLIDTYPLRFFDVAIAEQHALTSSSAMAKEGFKPFVSIYSTFLQRAYDS
                     IVHDACISSLPIKLAIDRAGIVGEDGETHQGLLDVSYLRSIPNMVIFAPRDNETLKNA
                     VHFANEHHSSPCAFRYPRGSFALKEGVFEPSGFVLGQSELLKKEGEILLIGYGNGVGR
                     AYLVQLALKEKNIECALLDLRFLKPLDQNLSAIIAPYQKLYVFSDNYKLGGVASAILE
                     FLSEQNILKPVKSFEIIDEFIMHGNTALVEKSLGLDTESLTDAILKDLGQER"
     gene            407119..408927
                     /locus_tag="HPSH112_RS01980"
                     /old_locus_tag="HPSH112_02030"
     CDS             407119..408927
                     /locus_tag="HPSH112_RS01980"
                     /old_locus_tag="HPSH112_02030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor 4"
                     /protein_id="WP_000838000.1"
                     /translation="MKSKVPMKNIRNFSIIAHIDHGKSTLADCLIAECNAISNREMTS
                     QVMDTMDIEKERGITIKAQSVRLNYTLKGEDYVLNLIDTPGHVDFSYEVSRSLCSCEG
                     ALLVVDATQGVEAQTIANVYIALDNHLEILPVINKIDLPNANVLEVKQDIEDTIGIDC
                     SSANEVSAKARLGIKDLLEKIITTIPAPSGDFNAPLKALIYDSWFDNYLGALALVRIM
                     DGSINTEQEILVMGTGKKHGVLGLYYPNPLKKIPTKSLECGEIGIVSLGLKSVTDIAV
                     GDTLTDAKNPTPKPIEGFMPAKPFVFAGLYPIETDRFEDLREALLKLQLNDCALNFEP
                     ESSVALGFGFRVGFLGLLHMEVIKERLEREFGLNLIATAPTVVYEVHLTDNSIKYVQN
                     PSELPPENHIACIKEPFVRATIITPSEFLGNLMQLLNNKRGIQEKMEYLNQSRVMLTY
                     SLPSNEIVMDFYDKLKSCTKGYASFDYEPIENREAHLVKLDVRVAGDVVDALSIIIDK
                     NKAYEKGRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDIT
                     RKRKLLEKQKEGKKRMKAIGKVELPQEAFLAILKID"
     gene            408936..409865
                     /locus_tag="HPSH112_RS01985"
                     /old_locus_tag="HPSH112_02035"
     CDS             408936..409865
                     /locus_tag="HPSH112_RS01985"
                     /old_locus_tag="HPSH112_02035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015643974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="WP_000862787.1"
                     /translation="MKVGSLFAGIGGFECAFLQAGFEIGWANELDKDACNTYRANFKH
                     KLLEQDIKDLNPNELEDVGLISAGFPCQAFSIAGLQKGLNDERGAIVMEMFRIIQAKK
                     PQVLLLENVKNLVSHNKGETLKFILETLKNLGYFVHYKILNTYEYSTVPQNRERIYII
                     GFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYRFYETLKKEITKRDTCYQ
                     WRRHYVRENKNNLCPTLTANMGTGGHNVPLVLDEQGIRKLTPKECLNFQGFAKDYVLP
                     NTAKSKLYKQIGNSVSVPVIKALALEIKKVVYG"
     gene            409858..>410133
                     /locus_tag="HPSH112_RS01990"
                     /pseudo
     CDS             409858..>410133
                     /locus_tag="HPSH112_RS01990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015085540.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            410502..410784
                     /locus_tag="HPSH112_RS08195"
                     /pseudo
     CDS             410502..410784
                     /locus_tag="HPSH112_RS08195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001894186.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(410759..411568)
                     /locus_tag="HPSH112_RS02000"
                     /old_locus_tag="HPSH112_02045"
     CDS             complement(410759..411568)
                     /locus_tag="HPSH112_RS02000"
                     /old_locus_tag="HPSH112_02045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207883.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgG"
                     /protein_id="WP_001179221.1"
                     /translation="MQNGYYAATGAMATQFNRLDLTSNNLANLNTNGFKRDDAITGDF
                     LRLYQQYREQLPLEDQTKASAKYLNRNLNRVPILSEIYTDRSLGAFEETHNPLDFALT
                     SPNLYFAIQTNEGVAYTRDGHFSVDKDGFLVTLNGFRVLSRSGLNEKGGIMLMPNAEI
                     EVNQNGEITFRDNEAPIQAGALALVSFSEPKNLKKIGQNLYTYQGEGVHQISDSGSLR
                     QYMLEKSNVNAVREMSALIGINRFLDMYSKVLKTHQDDMNAEAINKLASKA"
     gene            complement(411623..412909)
                     /locus_tag="HPSH112_RS02005"
                     /old_locus_tag="HPSH112_02050"
     CDS             complement(411623..412909)
                     /locus_tag="HPSH112_RS02005"
                     /old_locus_tag="HPSH112_02050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_001069542.1"
                     /translation="MNPQTQPATKKPLKSLLAASSGNLVEWYDFYAYAFLAPYFAKEF
                     THTNDPTLALISAFLVFMLGFFMRPLGSLFFGKLGDKKGRKTSMVYSIILMALGSFML
                     ALLPTKEIVGEWAFLFLLLARLLQGFSVGGEYGVVATYLSELGKNGKKGFYGSFQYVT
                     LVGGQLLAIFSLFIVENIYTHEQISAFAWRYLFALGGILALLSLFLRNIMEETMDSQT
                     TSKTTIKEETQRGSLKELLNHKKALMIVFGLTMGGSLCFYTFTVYLKIFLTNSSSFSP
                     KESSFIMLLALSYFIFLQPLCGMLADKIKRTQMLMVFAIAGLIVTPVVFYGIKHASGV
                     YEALFYEMLALSAMSFYTCIAGVIKAELFPEHVRALGVGLAYAIANALFGGSASYVAL
                     QFKQHGFEWGFVGYVMFSIVIFMVMVIIFPKKTYLE"
     gene            complement(413072..415608)
                     /locus_tag="HPSH112_RS02010"
                     /pseudo
     CDS             complement(413072..415608)
                     /locus_tag="HPSH112_RS02010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207881.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
     gene            complement(415596..417932)
                     /locus_tag="HPSH112_RS02015"
                     /old_locus_tag="HPSH112_02065"
     CDS             complement(415596..417932)
                     /locus_tag="HPSH112_RS02015"
                     /old_locus_tag="HPSH112_02065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exonuclease"
                     /protein_id="WP_001047495.1"
                     /translation="MNLEKLFSQKNPLFVFSSTRRLKHFYLEQGEGFLPNAMSMGSFF
                     EQAFYIPNKKKIPNSARQILMIDTIKAIAKEKKSILEGLLLFENSFLGYLESTSFLFD
                     LFDELSSACIKLNELSSKDIYLDYEKHLEVLEMIYKRYIKKLEELGFYDKIMQEKPTI
                     LKEFFEHFFSIEWHLDGFMSVFERQCLLEVAELVPITLHLSCDQYNQKFLEFLNLKLE
                     TDCDYSIDFKTQKILSQTPKHQKIEPKLYANSSYLKQSALVLQTIEEYLQKDNDPNKM
                     AIITPNADFLPFLKLLDKNNNLNFAMGLGAKNSPYYIELVKISEDLETSGFDLSASPL
                     LDLENLTLALLEQQSSKEKAPLKEAHSQIMHQFHLLKDTLTNYSLKDLLHLYLQEFEA
                     NFRLDDSSGGKIRVMDTLETRGMQFDKIVIVDFNETCVPSLKDCDLFLNSALRKSLNL
                     PTLSDKKNLQKHYYYQLFKNSKEMALSYIESETSKVSNMLLELDLHIEPIKDAYTLFA
                     PTPLKDYQEEEIQATIPKDFSFSASSLNTFLTCKRRFYYHYIKRFKESPKDESNSTIG
                     SLLHELLKEAYEKDKNPYALEERLIQLLETKGNITPKERLDTLIALKKIQAFYVKEKE
                     RFNAKIKILDLEKSFETTIQGVAFKGRIDRIDKTADNEIILLDYKFKSDLKLDNMSEK
                     QRGSLSPIEIAQISADYQMAIYAFALKNLGYKGPIKAFFYDLRKGKLLEEEEPILQAK
                     MDYLKSSLIPKLKQEIDFEKTLEVKDCEYCSFKDMCNR"
     gene            complement(417929..419854)
                     /locus_tag="HPSH112_RS02020"
                     /old_locus_tag="HPSH112_02070"
     CDS             complement(417929..419854)
                     /locus_tag="HPSH112_RS02020"
                     /old_locus_tag="HPSH112_02070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="WP_001239882.1"
                     /translation="MRLSNADLERLKSMANTLRFLCADMIDKANSGHPGVCLGLADVM
                     VVLSLHLNLNPTNPKWLNRDRLVFSGGHASALAYSLLHLWGFDLSLEDLKRFRQLHSK
                     TPGHPELHHTKGIEITTGPLGQGFANAVGFSMASQYAQNLLDKEAISHKVYCLCGDGD
                     LQEGISYESASLAGHLNLSNLIVIYDSNQISIEGAINISFSEQVKMRFLAQNWEVLEC
                     DGHDYQAIHNALEEAKKSTKPTLLIAHTIIGKGAIGLEGSEKTHGSPLNKEVLKQSKE
                     NAQINPDESFIVSLKNKMHFEEVKVRGVSLEALWEKSLSPKTKEKIHALKDFDFNAIN
                     YPTFKKDESLATRVSNGMILNAIAKECEGFLGGSADLAPSNNTQLKHSGDFPLGQNLH
                     FGIREHAMGAITNALAAYGLFVPFCATFFVFSDYLMPSIRLSALMKLKALFIFTHDSI
                     GVGEDGATHQPVEQLSHLRALPNFYAFRPSDAFENTACMQVALSLSAPSGLILSRQNL
                     PVLDEVSKEQVLKGAYVKYEAKNPAITLVASGSEVSLALESAKMLERENIPTQVVSAP
                     CFDLLVEQDESYLKELFKGKVLVIEASRAIEWYRFADKIIGMDSFGSSAKGNKLFEKF
                     GFSVENITAQAKRLLHA"
     gene            complement(419901..420743)
                     /locus_tag="HPSH112_RS02025"
                     /old_locus_tag="HPSH112_02075"
     CDS             complement(419901..420743)
                     /locus_tag="HPSH112_RS02025"
                     /old_locus_tag="HPSH112_02075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="WP_000931633.1"
                     /translation="MLNFLSISSEPKIKSLAIGKFDGLHLGHQALFKELKDPKALLII
                     EKKHYTKGYLTPLKYRAKLVGMPLFFVYLEEISPLNASEFLDLLKKKFPHLERLVVGY
                     DFRFGHERQNDALFLKERFEKTIIVPEVKIKEISVHSKTIKLALSHGDLSLANKLLGR
                     PYEVCGEVISDQGLGHKELAPTLNIKTKDFILPSFGVYASLVKIKDPIYQKSVSFIGN
                     RLSTDQHFAIECHVLDTIIENPPQEIALRLVQKIRDNMRFSSLKELKNQIQQDILRAK
                     EILR"
     gene            complement(420709..421416)
                     /locus_tag="HPSH112_RS02030"
                     /old_locus_tag="HPSH112_02080"
     CDS             complement(420709..421416)
                     /locus_tag="HPSH112_RS02030"
                     /old_locus_tag="HPSH112_02080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TlyA family rRNA
                     (cytidine-2'-O)-methyltransferase"
                     /protein_id="WP_001235217.1"
                     /translation="MRLDYALFNRHLVGSREKAKALVLKNQVLVNKMVVSKPSFIVKE
                     DDKIELIATNLFVSRAGEKLAAFLETHFVDFKGKVVLDVGASKGGFSEVALLKGAKKV
                     LCVDVGKMQLDESLKQDKRIECHEECDIRGFKTPETIDLALCDVSFISLYCILEAILP
                     LSDEFLTLFKPQFEVGRATKRNKKGVVVDKKAILNALENFKNHLKTKDFQILKIQESL
                     VKGKNGNVEFFIHFKRA"
     gene            complement(421416..421931)
                     /locus_tag="HPSH112_RS02035"
                     /old_locus_tag="HPSH112_02085"
     CDS             complement(421416..421931)
                     /locus_tag="HPSH112_RS02035"
                     /old_locus_tag="HPSH112_02085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207876.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000523555.1"
                     /translation="MGLKNLSTLLVFLFFCLGCVSNFNEDTYTPDLILEKKIQASRKG
                     EITQDNVPIITAIATHLNDVDSGAYYDHEYFLVEIFTQNNNWIDDGYISYELFGTKPI
                     GKEPLWVREITKDEFDGILETTNRWSRAFLLAFDKLDYLAVQEAKLELDAYSLGKIVF
                     NFAYQVPLPQF"
     gene            421998..422921
                     /locus_tag="HPSH112_RS02040"
                     /old_locus_tag="HPSH112_02090"
     CDS             421998..422921
                     /locus_tag="HPSH112_RS02040"
                     /old_locus_tag="HPSH112_02090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207875.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase"
                     /protein_id="WP_001124602.1"
                     /translation="MPKKCRHLLQTSDLSLDEIKLLLKKASVYASDFNAVSLETKEKM
                     QNKIIVALFFENSTRTVSSFEIASLRLGAKIVKLNMQTSSASKGETLTDTFKNIHAMQ
                     PDAIITRHAFSSAPFKLAEFSQCPLINAGSGVSAHPTQALLDLLTLYQHFGGLENLKG
                     KKIAFIGDVKNSRVANSNIKLLQRLGLEIMLCAPSSMLPIASLKTTHNIEEAIEFADI
                     LMSLRTQTERHNAPIFASLKDYGNAYCITQKRLETHAKNKEIIILHPGPVHRDIDIES
                     TVLEDKRSKVLEQVKNGVAMRMAVLEFLLLD"
     gene            423216..424655
                     /locus_tag="HPSH112_RS02045"
                     /old_locus_tag="HPSH112_02095"
     CDS             423216..424655
                     /locus_tag="HPSH112_RS02045"
                     /old_locus_tag="HPSH112_02095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207874.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000798585.1"
                     /translation="MKNSTPLKNKVFCGLYVLSLSASLQAFDYKIEVLAESFSKVGFN
                     KKKIDISRGIYPTETFVTAVGQGNIYADFLSKGLKDQGHVLEGKVGGTLGGVAYDDTK
                     FNQGGSVIYNYIGYWDGYLGGKRALLDGTSIHECALGSDGKVIDSIACGNARANKIRR
                     NYLMNNAFLEYRYKDIFLAKGGRYQSSAPYMSGYTQGFEISAKVKDKSEGIHKLWWFS
                     SWGRAFAYGEWIYDFYSPRTVIKNGRTLNYGIHLVNYTYERKGVSISPFFQFSPGTYY
                     SPGVVVGYDSNPNFDGVGFRSETKAYILLPVHDPLKRDTYRYAIKAGTAGQSLLIRQR
                     FDYNEFNFGGAFYKVWKNANAYIGTTGNPLGIDFWTNSVYDIGQAISHVVTADAISGW
                     VFGGGVHKKWLWGTLWRWTSGTLANEASAAVNVGYKISKSLTASVKLEYFGVMTHSGF
                     TVGSYKPTPGSKALYSDRSHLMTTLSAKF"
     gene            424747..426402
                     /locus_tag="HPSH112_RS02050"
                     /old_locus_tag="HPSH112_02100"
     CDS             424747..426402
                     /locus_tag="HPSH112_RS02050"
                     /old_locus_tag="HPSH112_02100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_000765019.1"
                     /translation="MKLFFRRYSKYLKEHYKSFIVVLFSSLVVALSTAWGTYLVKPTL
                     DEIFINKDTHMLKILPFLVILAYLGKSGGMYLGTYFTNFIGLDIVKKIRNTMLESLLK
                     MEMDFFNRTKKGELIARITNDIGLIRASLSNYLSESIREGLTIVGLVGVVVYQSPKLA
                     LVGLVIMPLAAIPISKIIRKVKKLAKSHQESNAKITSRLSEVFNNVEAIKISNGEKLE
                     HKAFVKENEAFFKIGIKNIAVAEISSPLMEFLGSIAIALVIYLGGNEVIRGHISVGAF
                     FSFITALFMLYTPIKRLTRIVSNFQEALVASDRIHEILEREPAIVDGELTLNDAIHTI
                     EFKKVWLAYTLDNQERYVLSDISLKFQQNEIIALKGESGSGKSSLVNLILRLYEPSKG
                     EIFINDQKIESITQKSLREKISVVTQRVFIFNGSVAENVAYGLEIDEVKIKECLKKAQ
                     ALDFVEKMPHGIESVLDEFGANLSGGQRQRIAIARALYKDAQVLIFDEATSALDNNTE
                     ESVKQSILELKQNRLIILISHNPSTLKLATKHVKLEHGRLIEC"
     gene            426396..427019
                     /locus_tag="HPSH112_RS02055"
                     /old_locus_tag="HPSH112_02105"
     CDS             426396..427019
                     /locus_tag="HPSH112_RS02055"
                     /old_locus_tag="HPSH112_02105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207872.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000946787.1"
                     /translation="MLRVLSVGVVFILLGCQFFNKTTLHLKYKNYPKNSTLKTAVTLT
                     PPKIFFNARFVPPFYQKEFKKAIIQQIAYFLKDKSAFILNVSGNVFFSFEESPKDLKA
                     IKERLKKTIEPNADPKSVMRFLNLQASLILECTPQTTCPFDTLLIPTAFSVPVYYANR
                     LGDNPSLFSQEDKTYHNALIKALNKAYYSLMEGLEKRLNAIENAEWL"
     gene            427023..427592
                     /locus_tag="HPSH112_RS02060"
                     /old_locus_tag="HPSH112_02110"
     CDS             427023..427592
                     /locus_tag="HPSH112_RS02060"
                     /old_locus_tag="HPSH112_02110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207871.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="WP_000724640.1"
                     /translation="MKKIVFFIFVILFSVGIYLAWHVLLEKALELKLVTSANDLLLKL
                     LALLGVFSMLVLFQGVISSYKKRQLKRALQKIDAMNGFEFEEYSKIFFTSKGFEVSIT
                     QKSGDYGADLIIEKDGIKWAVQAKRYSHKVSPKAIQEVVSSKAYYACEKACVITNSYF
                     TQAAQKLAQANEVLLIDRDEWVRFLNEKR"
     gene            427697..428881
                     /locus_tag="HPSH112_RS02065"
                     /old_locus_tag="HPSH112_02115"
     CDS             427697..428881
                     /locus_tag="HPSH112_RS02065"
                     /old_locus_tag="HPSH112_02115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017281336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_000616475.1"
                     /translation="MIQSVRIKNFKNFKDTTIDGFTKLNIITGENNAGKSNLLEALYY
                     LVGKSMHPCANIVEIYDNIRKEPLTSESKSLMFYGLDTKKEIQIVTTLDNNQTLDLQI
                     KFIASEYQNTIESQIIPTVEQAQAFSQLKFIFKKGKEEIYNDYLNIARIPNFPPIPNQ
                     SSYNRQFNNFRPDLSRKLLPFESAAIITPSDVARKRDIMNPNAIHIMDPNIIQAMRKI
                     LDNNQLEKRLNQSLNQFDKSIQAIRFSANNQLKLKVKGIKEKIPLSMFGDGLMKYLHI
                     VSAFIVNNATTIYIDEVENGLHFSRMGLLLEEIIDFINNNKDRNLQVFMTTHSQEFVE
                     ILDQVIREKDFANQTKLFCLEQYNGSIVAEPYYGENLSLYFKNHANLFGGKERFKENN
                     YE"
     gene            428874..429557
                     /locus_tag="HPSH112_RS02070"
                     /old_locus_tag="HPSH112_02120"
     CDS             428874..429557
                     /locus_tag="HPSH112_RS02070"
                     /old_locus_tag="HPSH112_02120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000039507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000039507.1"
                     /translation="MSKKTLIYTEGKSDKNFLGWCLDVWKNEDRFDIIHVEGKDKLFS
                     DEFCERIKNILKNKNQEYRQVCIIFDADIKKENQESDAGFDNKLEYIREKFKEKGIDF
                     PKEQIFLFPNNQDDGDLEDLLLKIAKHDKFFECFEGYLECIKSKEHYKPIKNIRKSKW
                     YAYLEALGLEDLYTKKNIFDIEGKVKNEYEEDYERLKKAIEFESDILIPLKNFLELTK
                     NTKPNKSKK"
     gene            429632..430627
                     /locus_tag="HPSH112_RS02075"
                     /old_locus_tag="HPSH112_02125"
     CDS             429632..430627
                     /locus_tag="HPSH112_RS02075"
                     /old_locus_tag="HPSH112_02125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207868.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel transporter NixA"
                     /protein_id="WP_000780449.1"
                     /translation="MKLWFPYFLAIVFLHALGLALLFMANNASFYAAASMAYMLGAKH
                     AFDADHIACIDNTIRKLTQQGKNAYGVGFYFSMGHSSVVILMTIISAFAIAWAKEHTP
                     MLEEIGGVVGTLVSGLFLLIIGLLNAIILVDLLKIFKKSHSNESLSQQQNEEIERLLT
                     SRGLLNRFFKPLFNFISKSWHIYPIGFLFGLGFDTASEIALLALSSSAIKVSVVGMLS
                     LPILFAAGMSLFDTLDGAFMLKAYDWAFKTPLRKIYYNISITALSVFIALFIGLIELF
                     QVVSEKLHLKFENRLLNALQSLEFTDLGYYLVGLFVIAFLGSFFLWKIKFSKLES"
     gene            complement(430631..431146)
                     /locus_tag="HPSH112_RS02080"
                     /old_locus_tag="HPSH112_02130"
     CDS             complement(430631..431146)
                     /locus_tag="HPSH112_RS02080"
                     /old_locus_tag="HPSH112_02130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207867.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000353415.1"
                     /translation="MDILKTLQKHLGDVETSDFKTNAIEKSQQIAKFSRDMKNINESV
                     GALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAI
                     NDEVFSMVVDNPLDLLENAGEFQAYLEEKLNEIKELLGYLSESLSNPKAFMPSFSNKS
                     LKDLLSDNLRA"
     gene            431279..432595
                     /locus_tag="HPSH112_RS02085"
                     /old_locus_tag="HPSH112_02135"
     CDS             431279..432595
                     /locus_tag="HPSH112_RS02085"
                     /old_locus_tag="HPSH112_02135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="purine-nucleoside phosphorylase"
                     /protein_id="WP_000725415.1"
                     /translation="MKKIWLLVWGLYSLVFVHAIETIEKVPTNVEDKDKAPHLLLLAG
                     IQGDEPGGFNAANLFLMHYSVLKGLVEVVPVLNKPSMLRNHRGLYGDMNRKFAALDKN
                     DPEYPTIQEIKSLIAKPNIDAVLHLHDGGGYYRPVYVDAMLNPKRWGNCFIIDQDEIK
                     GAKFPNLLAFANNTIESINAHLLHPIEEYHLKNTRTAQGDTEMQKALTFYAINQKKSA
                     FANEASKELPLASRVFYHLQAIEGLLNQLNIPFKRDFELNPSSVHALINDKSLWAKIS
                     SLPKMPLFNLRPKLNHFPLPYNTKIPQIPIESNAYIVGLVKNKQEVFLKYGNKLMTRL
                     SPFYIEFDHSLEEVKMQIDNKDQMVKIGSVVEVKESFYIHAMDNIRANVIGFSVSNES
                     KPNEAGYTIKFKDFQKRFSLDKQERIYRIEFYKNNAFSGMILVKFV"
     gene            432621..432875
                     /locus_tag="HPSH112_RS08200"
                     /pseudo
     CDS             432621..432875
                     /locus_tag="HPSH112_RS08200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000348842.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(433053..433253)
                     /locus_tag="HPSH112_RS02090"
                     /old_locus_tag="HPSH112_02140"
     CDS             complement(433053..433253)
                     /locus_tag="HPSH112_RS02090"
                     /old_locus_tag="HPSH112_02140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="COP-associated protein"
                     /protein_id="WP_000648264.1"
                     /translation="MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVE
                     FDAPATQDLIKEALLDAGQEVM"
     gene            complement(433254..435479)
                     /locus_tag="HPSH112_RS02095"
                     /old_locus_tag="HPSH112_02145"
     CDS             complement(433254..435479)
                     /locus_tag="HPSH112_RS02095"
                     /old_locus_tag="HPSH112_02145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207863.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper-translocating P-type ATPase"
                     /protein_id="WP_000664953.1"
                     /translation="MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIE
                     FDENQTNLDEIFKLIEKLGYSPKKTLAKEKKGFFSPNVKLALAVVFTLFVVYLSMGAM
                     LSPSLLPESLLTIDNHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
                     AIGTSAALISSLWPLYLVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAM
                     QALMKNAPKTALKMQNNQQIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESM
                     LSGEALPVYKKVGDKVFSGTLNSHTSFLMKATQNNKNSTLSQIIEMIHNAQSSKAEIS
                     RLADKVSSVFVPSVIAIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALG
                     LATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKI
                     ELLELLSLAGSIEKSSEHVIAKGIVEYAKENNAPLKEMSEVKVKTGFGISAKTDYQGT
                     KEIIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGVFVLEDLPKKGVKEHI
                     AQIKKLGINTLLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMM
                     VGDGLNDAPSLAMSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIQLSRATIKNIK
                     ENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMSLSSVSVVLNSQRLRNFKIKD
                     H"
     gene            complement(435476..436189)
                     /locus_tag="HPSH112_RS02100"
                     /old_locus_tag="HPSH112_02150"
     CDS             complement(435476..436189)
                     /locus_tag="HPSH112_RS02100"
                     /old_locus_tag="HPSH112_02150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001122186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase"
                     /protein_id="WP_001122209.1"
                     /translation="MPINPLYLFPNLFTASSIFLGMMSIFYASSYQFVMACWLVVASL
                     ILDGLDGRVARLTNTTSKFGIEFDSLADVVAFGVAPSLITYFYVGYNFGRIGMAVSAL
                     FVIFGAIRLARFNISTNTSDPYSFIGIPIPAAAVLVVLCVLLDNKYHFLEGNTEKLFL
                     GFIALLGVLMVSNIRYPNFKKVKWNLKLFILVLIFLSLVFVRPLETLSVFMGLYLIYG
                     IIRWLFLMVKIIFNKNKST"
     gene            complement(436179..436433)
                     /locus_tag="HPSH112_RS02105"
                     /old_locus_tag="HPSH112_02155"
     CDS             complement(436179..436433)
                     /locus_tag="HPSH112_RS02105"
                     /old_locus_tag="HPSH112_02155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001203143.1"
                     /translation="MRAYKRIFDKGLKPYYKHSVCLEFFFRLCFLKTHAYQQRYKAFA
                     LTLFPCKFFNACEVFIPTMDFKIVFIPILKAKLKRASNAY"
     gene            complement(436436..438334)
                     /locus_tag="HPSH112_RS02110"
                     /old_locus_tag="HPSH112_02160"
     CDS             complement(436436..438334)
                     /locus_tag="HPSH112_RS02110"
                     /old_locus_tag="HPSH112_02160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent zinc metalloprotease FtsH"
                     /protein_id="WP_000805279.1"
                     /translation="MKPTNEPKKPFFQSPIILAVLGGILLIFFLRSFNSDGSFSDNFL
                     ASSTKNVSYHEIKQLISNNEVENVSIGQTLIKASHKEGNNRVIYIAKRVPDLTLVPLL
                     DEKKINYSGFSESNFFTDMLGWLMPILVILGLWMFMANRMQKNMGGGIFGMGSAKKLI
                     NAEKPNVRFNDMAGNEEAKEEVVEIVDFLKYPERYANLGAKIPKGVLLVGPPGTGKTL
                     LAKAVAGEAHVPFFSMGGSSFIEMFVGLGASRVRDLFETAKKQAPSIIFIDEIDAIGK
                     SRAAGGVVSGNDEREQTLNQLLAEMDGFGSENAPVIVLAATNRPEILDPALMRPGRFD
                     RQVLVDKPDFNGRVEILKVHIKGVKLANDVNLQEVAKLTAGLAGADLANIINEAALLA
                     GRNNQKEVRQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYHESGHAVISEMTKGSAR
                     VNKVSIIPRGMAALGYTLNTPEENKYLMQKHELIAEIDVLLGGRAAEDVFLEEISTGA
                     SNDLERATDIIKGMVSYYGMSSVSGLMVLEKQRNAFLGGGYGSSREFSEKTAEEMDLF
                     IKNLLEERYKHVKQTLSDYREAIEIMVKELFDKEVITGERVREIISEYEAANNLESRL
                     IPLEEQAS"
     gene            complement(438343..439332)
                     /locus_tag="HPSH112_RS02115"
                     /old_locus_tag="HPSH112_02165"
     CDS             complement(438343..439332)
                     /locus_tag="HPSH112_RS02115"
                     /old_locus_tag="HPSH112_02165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="WP_000917374.1"
                     /translation="MLKPMYYEFFFIFPKEQELFESFLLDTTHLALEESSLENLKAFD
                     DKETIEFISQSSWHYFATHDPLKENLKEKPPHLKNFVILRSQKDLNDLLIPALEAFCL
                     SLQQNLQSGFDFFYLSRNLASKDWLEAYKQAILPVQCAKFYIYSSWHQKPSHVATDDS
                     IMIDPALAFGSGHHESTSMCLELLSNLDLKRKNALDVGCGSGILSIALKKQGVSALSA
                     CDTDSLAVEETLKNFSLNQITLLAQDKVIHGSTQKIEGRFDIIVANIVADVIKSLYSE
                     FVRLCNHTLILSGILETHLNSVLQIYYNGFEVLEQRQRNEWVALKLLKKQSIN"
     gene            complement(439333..439707)
                     /locus_tag="HPSH112_RS02120"
                     /old_locus_tag="HPSH112_02170"
     CDS             complement(439333..439707)
                     /locus_tag="HPSH112_RS02120"
                     /old_locus_tag="HPSH112_02170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207858.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_000772153.1"
                     /translation="MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLNAN
                     ADTKVLITDWNMPEMNGLDLVIKVRADERFKEIPIIMITTEGGKAEVITALKAGVNNY
                     IVKPFTPQVLKEKLEVVLGTND"
     gene            439998..440600
                     /locus_tag="HPSH112_RS02125"
                     /old_locus_tag="HPSH112_02175"
     CDS             439998..440600
                     /locus_tag="HPSH112_RS02125"
                     /old_locus_tag="HPSH112_02175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207857.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000291641.1"
                     /translation="MYYLRILILSISFLNILNAENLSYMSSSYQVGMVFMRPLNTNKL
                     LQGASILQGYEVNPKNDWAYSRYYFFIDYGNVLFNNDSTLQANMFTYGVGGDFMVAYA
                     KNPINRWAFFFGLQLAANTWILNNKVKDLVVNTWDSLKDFNFRNTYFRAIGKFGVQFR
                     TIVLYHKVDVEIGMKIFLTPERRSLFERSFLFFVSHSWHF"
     gene            complement(440602..440689)
                     /locus_tag="HPSH112_RS02130"
                     /old_locus_tag="HPSH112_t08202"
     tRNA            complement(440602..440689)
                     /locus_tag="HPSH112_RS02130"
                     /old_locus_tag="HPSH112_t08202"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(440653..440655),aa:Ser,seq:gga)
     gene            complement(440732..441139)
                     /locus_tag="HPSH112_RS02135"
                     /old_locus_tag="HPSH112_02180"
     CDS             complement(440732..441139)
                     /locus_tag="HPSH112_RS02135"
                     /old_locus_tag="HPSH112_02180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000906076.1"
                     /translation="MLILGHPLIPSDRFIFIKNTDGVHSSTNNDIVCFEAHPKNLELA
                     KYCCENSVHFSVIFLSHKIETDTFFLFNAFKPLYCIFKDIKQAILAQQHATNYLLDSK
                     ILFSMDLNDTELWEICAKNQVDGVISKDSLLLK"
     gene            complement(441142..441423)
                     /locus_tag="HPSH112_RS02140"
                     /old_locus_tag="HPSH112_02185"
     CDS             complement(441142..441423)
                     /locus_tag="HPSH112_RS02140"
                     /old_locus_tag="HPSH112_02185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207855.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prokaryotic metallothionein family protein"
                     /protein_id="WP_078260094.1"
                     /translation="MLYASKAYLFLQIKGKFMLRILIPLLIIVWVLWRLFLRQKPLKD
                     NHSYTQQTPKELEDHMIVCSKCQTYVSSKDAIYSGAVAYCSETCLKDKR"
     gene            complement(441366..441902)
                     /locus_tag="HPSH112_RS02145"
                     /old_locus_tag="HPSH112_02190"
     CDS             complement(441366..441902)
                     /locus_tag="HPSH112_RS02145"
                     /old_locus_tag="HPSH112_02190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase G"
                     /protein_id="WP_001068816.1"
                     /translation="MNPLLQDYARILLEWNQTHNLSGAKHLSELEPQITDALKPLEFI
                     KDFKSCLDIGSGAGLPAIPLALEKPEVKFILLEPRIKRAAFLSYLKSVLPLRNIEIVK
                     KRLEDYQNLLQVDLITSRAVASSSFLIEKSQRFLKDKGYFLFYKGEQLKDEIACKDTE
                     CFMHQRRIYFYKSKESLC"
     gene            complement(441899..442936)
                     /locus_tag="HPSH112_RS02150"
                     /old_locus_tag="HPSH112_02195"
     CDS             complement(441899..442936)
                     /locus_tag="HPSH112_RS02150"
                     /old_locus_tag="HPSH112_02195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA preQ1(34) S-adenosylmethionine
                     ribosyltransferase-isomerase QueA"
                     /protein_id="WP_000657327.1"
                     /translation="MKEFDLESYDYDLPKELIANYPILPKEKAKLLVYERRSQKITHT
                     TFEHVLDFFPKNALVVLNDTKVIKARLFGSKHAFLPSKTTEVFFHRFFKDNTALTQIK
                     GKIKVGDKIFFDANYHAEVLELLHNGQRLIAFYGNKTPLNQANILKLLEQYGHMPLPP
                     YIKRADESLDTHEYQSVFAKHMGAVAAPTASLHFSQNTLEKLLKDFKHAFLTLHVGAG
                     TFLGVETKDIREHQIHTEVLRIPKKSQEILQKTQEILCIGTTALRSVEYFKRLENPNQ
                     EAFECDIFLHLANPILHVNYLLTNFHLPKSSLLMLVSAMIGLEKTKEIYQIAIEKKYR
                     FYSYGDGMLIL"
     gene            complement(442937..443734)
                     /locus_tag="HPSH112_RS02155"
                     /old_locus_tag="HPSH112_02200"
     CDS             complement(442937..443734)
                     /locus_tag="HPSH112_RS02155"
                     /old_locus_tag="HPSH112_02200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207852.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatC"
                     /protein_id="WP_000461252.1"
                     /translation="MFEDLKPHLQELRKRLMVSVGTILVAFLGCFHFWKSIFEFVKNS
                     YKGTLIQLSPIEGVMVAVKISFSAAIVISMPIIFWQLWLFIAPGLYKNEKKVILPFVF
                     FGSGMFLIGAAFSYYVVFPFIIEYLATFGSDVFAANISASSYVSFFTRLILGFGVAFE
                     LPVLAYFLAKVGLITDASLKAYFKYAIVVIFIVAAIITPPDVVSQIFMALPLVGLYGL
                     SILIAKMVNPAPKDSENDNENDNENDNENDNAKDSENNAKENEKSES"
     gene            complement(443727..444209)
                     /locus_tag="HPSH112_RS02160"
                     /old_locus_tag="HPSH112_02205"
     CDS             complement(443727..444209)
                     /locus_tag="HPSH112_RS02160"
                     /old_locus_tag="HPSH112_02205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207851.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twin-arginine translocase subunit TatB"
                     /protein_id="WP_000467596.1"
                     /translation="MFGMGFFEILVVLVVAIIFLGPEKFPQAVVDMVKFFRAVKKTLN
                     DAKDTLDKEINIEEIKKETLEYQKLFENKVESLKGVKIEELEDAKVTAENEIKSIQDL
                     MQDYQRSLETNTTPNHLSEEVSNEEALNKEVSSDESPKEVKLATDNNTKEHDKEKEHV
                     "
     gene            complement(444477..446591)
                     /locus_tag="HPSH112_RS02165"
                     /old_locus_tag="HPSH112_02210"
     CDS             complement(444477..446591)
                     /locus_tag="HPSH112_RS02165"
                     /old_locus_tag="HPSH112_02210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000958896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA cytosine methyltransferase"
                     /protein_id="WP_000958896.1"
                     /translation="MLTYADLFAGIGGFRLALDSLGLKCVFSAENNPHAIAMYQANFD
                     DDSTCDITLLNPNTMPNFDILCAGFPCQAFSVCGKQKGFEDTTRGTLFFDICRILKNK
                     KPKIFILENVKNLLKHNKGNTLFVMLQALSNLGYSVSYQILNAKNFSVPQNRERIIIV
                     GYLGSQVFDFNPIKTNPITDMQNFLDKSGHFEILEPYEYTLLDNQLLKRQNSGLIFCG
                     YRNKKIRTKGTRENTEHLSRVHKQPNRIYHVKGIHPTIASQEQSGRYFIYTDNLVRKL
                     TLNECFSFMGFPKDFKKIGTNSQLYERIGNSVCVPMIKAIMKEVLNQFYKQPLKENNM
                     QNKILEFLEKIYKECVSLKNLDSLNLSKTQLQKAQMIVEKEETFKGVYTVLITSLVYK
                     SNYHEQDIRFHQANMKNGYSGRSFDTKFITPFLKQKQFLGAMKESGWLTRSLEQNLPY
                     TIDYPGKISSVSIKKAFLEILDDVEKNPNLSTPYLKALFYLSIREKTRKAIILVKPII
                     KESSYSIDFIINTLQKHFNYAYKSRGASILPVVALFSIYECLILELGRFTNKSLKPLD
                     SHYSCDRSSGNAGDIVILDEQKQLFEVIEIKFNIAIDSIMLQDAYKKIAQTPIKRYYI
                     LSTLPIQNKTELQKIIDKIEHEHGCQVIVNGIYDTLKYYLRLIKNTEHFINNYLKNIS
                     QNTEINEEHKLAWNNIIDSKIN"
     gene            complement(446749..448578)
                     /locus_tag="HPSH112_RS08205"
                     /pseudo
     CDS             complement(446749..448578)
                     /locus_tag="HPSH112_RS08205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004088103.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            448727..449449
                     /locus_tag="HPSH112_RS02180"
                     /old_locus_tag="HPSH112_02225"
     CDS             448727..449449
                     /locus_tag="HPSH112_RS02180"
                     /old_locus_tag="HPSH112_02225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207848.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000523345.1"
                     /translation="MGLKKYVILWFLMGFYSGLNALDYDTLDPKYYKYIKYYKAYEDK
                     EVEELIKDLKRANAKSGLILGINTGFFYNHEIMVRTNSSSITGNILNYLFAYGLRFGY
                     QTFRPSFFARLVKPNIIGRRIYIQYYGGAPKKAGFGSVGFQSVMLNGDFLLDIPLPFV
                     GKYLYMGGYMGLGLGVVAHGVNYTAEWGMSFNAGLALTVLEKNRIELEFKILNNFPFL
                     QSNSSKETWWGAIASIGYQYVF"
     gene            449427..450293
                     /locus_tag="HPSH112_RS02185"
                     /old_locus_tag="HPSH112_02230"
     CDS             449427..450293
                     /locus_tag="HPSH112_RS02185"
                     /old_locus_tag="HPSH112_02230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000512479.1"
                     /translation="MGINMCSKKIKNLILCFGFILGLNAEENTAQENMTEENTPKDAP
                     VLLEEKRTQTLEFEENKEAKKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQM
                     AKNKSGFFIGVILGDIGINAHPNARSYESFEPSSNIQASPLLYGLRSGYQKYFANGIS
                     ALRFYGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWN
                     GMYQNLKEIKGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKEASQTFLYYFKS
                     TNIYYISYNYLL"
     gene            450302..451246
                     /locus_tag="HPSH112_RS02190"
                     /old_locus_tag="HPSH112_02235"
     CDS             450302..451246
                     /locus_tag="HPSH112_RS02190"
                     /old_locus_tag="HPSH112_02235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207846.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000911212.1"
                     /translation="MLKFKYCLIYIALILGLQATDYDNLEEENQQLDEKINHLKQQLT
                     EKGVSPKEINKDKFEEEYIDRSYPKISSKKKEKLLKSFSIADDKSGVFLGGGYAYGEL
                     NLSYQGEMLDRYGTNAPSAFKNNISLNAPVSMISTKFGYQKYFVPYFGTRFYGDLLLG
                     GGVLKENALKQPVGSFIYVLGAMNTDLLFDMPLDFKTKKHFLGVYAGFGIGLMLYQDK
                     PNQNGRNLVVGGYSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMG
                     VEEGAVYQNKEDDERLLVSANNQFKRSSFLLVNYAFIF"
     gene            451310..452578
                     /locus_tag="HPSH112_RS02195"
                     /old_locus_tag="HPSH112_02240"
     CDS             451310..452578
                     /locus_tag="HPSH112_RS02195"
                     /old_locus_tag="HPSH112_02240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207845.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024741.1"
                     /translation="MIFNALITKPKALSFSLNSKEGALNSNDEALFWDLKKPIKIKIV
                     APKGIKRYELKVTTQDDLILYEKENLVLDKPKSLEVPLIKPEIMGLEDKCLLYEIQAN
                     DWSYANFFNGNKASFKQEVCVDTIKPSITILSRSPSIAYGGSAIVVFEALDKNLSQAF
                     VRVKKKDFEAFRLLEFKQRNVFIALVPWSYKNKDFKAFIVAKDKAYNSNTIPILFKRK
                     THRLREKDIDLSALKDKIAKQEKSQNHTEQTLLERFSNARPKDLEKIHKIVLEQGDFY
                     KDFSHFQALKPLNGPFKMASNFLENRRILRDNQVLFQFLHLGVDLIPGKDLSLAFDSS
                     VKRVFKGELDFYGNSLINCYGLGLCVFLAHLKDDESVGSSGLKLGSGLHLGTLLQGVF
                     VRPNEWLNEQWIKTNIIAPIEQAKWLLMKG"
     gene            452515..453168
                     /locus_tag="HPSH112_RS02200"
                     /old_locus_tag="HPSH112_02245"
     CDS             452515..453168
                     /locus_tag="HPSH112_RS02200"
                     /old_locus_tag="HPSH112_02245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207844.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum site-determining protein MinC"
                     /protein_id="WP_080024690.1"
                     /translation="MDKNQYHRPHRASQVAFNERIVMLKTNQKNVHAFEIEKQEPEAV
                     IGFLEKNHALLQYFLIIFKYDIEPEVKAILRKHQLLFLETNRPLNGRHIKTMSIKEET
                     NHPAPNHSKTEPKTTIYERHIRSGEEIYSANHLIFLGNIHNGAKIISEGCVSVYGVCE
                     GAIVCFGECLILKEVKSVQIVFQNKILSLKEIERLLVNKNIKIITKNDDILDIKEVL"
     gene            453165..454052
                     /locus_tag="HPSH112_RS02205"
                     /old_locus_tag="HPSH112_02250"
     CDS             453165..454052
                     /locus_tag="HPSH112_RS02205"
                     /old_locus_tag="HPSH112_02250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase"
                     /protein_id="WP_000815187.1"
                     /translation="MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLG
                     VKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDG
                     SALAYCMLLDEAGIKELDAPKKVMEIKQAIEVREGDKFVKIEPDSQLSLNFAIDFNHP
                     VIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSIL
                     NKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNY
                     EVLIATDPAKEFALQKAFA"
     gene            454125..454547
                     /locus_tag="HPSH112_RS02210"
                     /old_locus_tag="HPSH112_02255"
     CDS             454125..454547
                     /locus_tag="HPSH112_RS02210"
                     /old_locus_tag="HPSH112_02255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207842.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024740.1"
                     /translation="MYQNNFLCASYTSKAKTSEALVEVFSQLFEDFKNPTLPAIKGVY
                     YAKGPGSFTSLKLTHVFLHTLALIHDFELYSTTGFDFNGNTPILAYANKYFVSKEMES
                     LSDFKDLKIAPKDFMLPPFLEKDKFTQLNTPFYILPPI"
     gene            454602..455483
                     /locus_tag="HPSH112_RS02215"
                     /old_locus_tag="HPSH112_02260"
     CDS             454602..455483
                     /locus_tag="HPSH112_RS02215"
                     /old_locus_tag="HPSH112_02260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="WP_000261717.1"
                     /translation="MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSSFHAVKLVGE
                     GEGIPKFLTNNIFTKVFYEILKKHGNDGSFKFLLHNKVPITRGMGSSSAMIVGAVASA
                     FAFLGFAFDRENIVNTALIYENHPDNITPAVFGGYNAAFVEKKKVISLKTTIPSFLKA
                     VMVIPNRAISTKQSRHLLPKRYSVQESVFNLSHASLMTMAIVQGKWDLLRCCSKDRMH
                     QYKRMQTYPVLFAIQKLALENNALMSTLSGSGSSFFNMCYEEDAPKLKQVLSKKFPKF
                     RVAVLDFDNDGVLVEKD"
     gene            455455..455724
                     /locus_tag="HPSH112_RS02220"
                     /old_locus_tag="HPSH112_02265"
     CDS             455455..455724
                     /locus_tag="HPSH112_RS02220"
                     /old_locus_tag="HPSH112_02265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024692.1"
                     /translation="MMESLLRKTEIKIRMCVACRMRQPQKDLLRLKSFENQIMEFDGK
                     GRSFYVCENCLKNGEKKLLKAVSKIKNAPKDTKNIITWIKERSIA"
     gene            455721..458576
                     /locus_tag="HPSH112_RS02225"
                     /old_locus_tag="HPSH112_02270"
     CDS             455721..458576
                     /locus_tag="HPSH112_RS02225"
                     /old_locus_tag="HPSH112_02270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="WP_001293398.1"
                     /translation="MSEMVDLKKFLTELGKTQKELKNVIEQAKDIGLELKTNSKMTPE
                     QAGKLYKYIVDGIKEQIQANKPTKNPEQDNKDDLNITATPKPLNKKVSKTPKKEETKS
                     QPKPKKTKEKKKEAPVPIAKKKGGIEIVNTFEDQTLENTPKVVSHSQIEKAKQKLQEI
                     QKSREALSKLTQSNANSANNANNVNNANNVNNAKKEISEVKKQEQEIKRHENIKRRTG
                     FRVIKRNDETENETENSVAESKRPTQSAAAIFEDIKKEWQEKDKQEAKKAKKPSKPKA
                     TPTAKNNKSHKIDFSDARDFKGNDIYDDETDEILLFDLHEQDNFNKEEEEKEIRQNIN
                     DRVRVQRKNPWMNESGIKRQSKKKHAFRNDNSQKVIQSAISIPEEVRVYEFAQKANLN
                     LADVIKTLFNLGLMVTKNDFLDKDSIEILAEEFHLEISVQNTLEEFEVEEVLEGVKKE
                     RPPVVTIMGHVDHGKTSLLDKIRDKRVAHTEAGGITQHIGAYMVEKNDKWVSFIDTPG
                     HEAFSQMRNRGAQVTDIAVIVIAADDGVKQQTIEALEHAKAANVPVIFAMNKMDKPNV
                     NPDKLKAECAELGYNPVDWGGEYEFIPVSAKTGDGIDNLLETILIQADIMELKAIEEG
                     SARAVVLEGSVEKGRGAVATVIVQSGTLSVGDSFFAETAFGKVRTMTDDQGKSIQNLK
                     PSMVALITGLSEVPPAGSVLIGVENDSIARLQAQKRATYLRQKALSKSTKVSFDELSE
                     MVANKELKNIPVVIKADTQGSLEAIKNSLLELNNEEVAIQVIHSGVGGITENDLSLVS
                     SSDHAVILGFNIRPTGNVKNKAKEYNVSIKTYTVIYALIEEMRSLLLGLMSPIIEEEH
                     TGQAEVRETFNIPKVGTIAGCVVSDGVIARGIKARLIRDGVVIHTGEILSLKRFKDDV
                     KEVSKGYECGIMLDNYNEIKVGDVFETYKEIHKKRTL"
     gene            458576..458911
                     /locus_tag="HPSH112_RS02230"
                     /old_locus_tag="HPSH112_02275"
     CDS             458576..458911
                     /locus_tag="HPSH112_RS02230"
                     /old_locus_tag="HPSH112_02275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207838.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="WP_000991174.1"
                     /translation="MNAHKERLESNLLELLQEALASLNDSELNSLSVTKVECSKGKHH
                     AFVFVLSQDHKILSKLKKAEGLIRQFVLQASGWFKCPKLSFVLDNSLEKQLRLDAIFN
                     EIAKGKDND"
     gene            458904..459344
                     /locus_tag="HPSH112_RS02235"
                     /old_locus_tag="HPSH112_02280"
     CDS             458904..459344
                     /locus_tag="HPSH112_RS02235"
                     /old_locus_tag="HPSH112_02280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome maturation factor"
                     /protein_id="WP_000162229.1"
                     /translation="MTKKIEEKIEGVIESLGYLLYDVSLIKENEQHVLRVSLKNPNGA
                     VSLDICQQVSEIISPLLDVCDFIQDAYILEVSSMGLERTLKTPKHFKLSLGEKVGVKL
                     TNKESFQAVLKDANDLSADFELEDHAIKSVEYKDLKKVKTLFEW"
     gene            complement(459452..461440)
                     /locus_tag="HPSH112_RS02240"
                     /old_locus_tag="HPSH112_02285"
     CDS             complement(459452..461440)
                     /locus_tag="HPSH112_RS02240"
                     /old_locus_tag="HPSH112_02285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-coenzyme A synthetase"
                     /protein_id="WP_001190264.1"
                     /translation="MQSDDDLEFAKKVFNPNRAFAKQARIKNMCEYKDLVHEANEDYE
                     HFWGELAKQKLTWFKPFDKVLNSDNTPFFKWFENGKINVSYNCIDRHLKDKKNKVAII
                     FEGEMGDYNVITYRKLHSEVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACAR
                     IGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACP
                     SVEKVLIVIRNAKEIDYVRGRDFVYNEMVNYQSGKCQPEMMDSEDPLFLLYTSGSTGK
                     PKGVQHSSAGYLLWAQMTMEWVFDIRDNDNFWCTADIGWITGHTYVVYGPLACGATTL
                     ILEGTMSYPDYGRWWRMIEEYRVDKFYTSPTAIRMLHAKGENEPLKYNLDSLKVLGTV
                     GEPINPTAWKWFYEKIGNSKCSIVDTWWQTETGGHIISPLPGATPIRASCATLPLPGI
                     HAEVLNEDGTQTKPGEQGFLCITKPWPSMIRNVWGDEKRYIDSYFSQIKLNGEYVYLS
                     GDGAIVDENGYITIIGRTDDIVNVSGHRIGTAEVESAISKHEMVAECAVVGIPDTIKG
                     EGLFAFVVLCDGAKCNLGESLELLKEMNHILSIEIGKIAKLDNVMYVPGLPKTRSGKI
                     MRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQMEE"
     gene            461640..462752
                     /locus_tag="HPSH112_RS02245"
                     /old_locus_tag="HPSH112_02290"
     CDS             461640..462752
                     /locus_tag="HPSH112_RS02245"
                     /old_locus_tag="HPSH112_02290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001868760.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_000908689.1"
                     /translation="MLISIAFLLVLCLLNYSSFRMLKSFLTLKKISQYAYLGFFILLS
                     VGEAAFAFYRNIMPSHLFVLTSACSFVSFIVFIFSLSFYGFSYSIEKIDFLHSRRKSL
                     KNFLKLGFYLALLGYFWRGFYEGLARPKIKETPIYLDKLDKELKIILLTDMHVGSLLQ
                     KDFVDYIVEEVNQKEVDMVLIGGDLVDENIEKVKSFLLPLNNLKSAHGTFYVPGNHEY
                     YHGIEPILSFLDTLNLTILGNECVHLGGINLCGVYDYFARKHQNFAPDIDKALKKCNE
                     SKPTILLAHQPKQIRSLKESHSVDLVLSGHTHAGQIFPFSLLVKLAQTYLYGLYKHSD
                     TTQIYVSSGAGYWGVPLRFLAPSEIAYLRLLPKNQA"
     gene            complement(462736..462923)
                     /locus_tag="HPSH112_RS08210"
                     /pseudo
     CDS             complement(462736..462923)
                     /locus_tag="HPSH112_RS08210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000913103.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            463093..463764
                     /locus_tag="HPSH112_RS02250"
                     /old_locus_tag="HPSH112_02295"
     CDS             463093..463764
                     /locus_tag="HPSH112_RS02250"
                     /old_locus_tag="HPSH112_02295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding response regulator"
                     /protein_id="WP_001264965.1"
                     /translation="MRVLLIEKNSVLGGEIEKGLNAKGFMADVTESLEDGEYLMDIRN
                     YDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEIHAFEQGADDYIAKPYRSI
                     KALVARIEARLRFWGSNVIEIGDLIISPDEEKIIYKGREVEVKGKPFEVLTHLARHRD
                     QIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPK
                     PACEE"
     gene            complement(464090..465136)
                     /locus_tag="HPSH112_RS02255"
                     /old_locus_tag="HPSH112_02300"
     CDS             complement(464090..465136)
                     /locus_tag="HPSH112_RS02255"
                     /old_locus_tag="HPSH112_02300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207832.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000984066.1"
                     /translation="MMQVYHLSHIDLDGYACQLVSKQFFKNIQCYNANYGREVSARIY
                     EILNAIAQSKESKFLILISDLNLNLNEAQYLQDKIQEHRLQNRNIQIQLLDHHISGKE
                     VAESFHWYFLDTNRCATKIVYEFLKKHYAILEPKNTAWLEPLVEMVNSVDIWDTQGYG
                     FELGKVCMRMINQSSELNRFMFDDENRNYKLKLLEEVKNYLFLENASVAYDNDLFKLK
                     KIALGGDPDTETMDNISSNAQTHLLSLKKHDCSVYYQDKKGFLSYSMGGISVLANLFL
                     TQNPDFDFYMDVNAKGNVSLRANGNCDVCELSQMCFNGGGHRNASGGKIDGFRESFNY
                     RDIKEQIEEIFNNA"
     gene            complement(465164..467365)
                     /locus_tag="HPSH112_RS02260"
                     /old_locus_tag="HPSH112_02305"
     CDS             complement(465164..467365)
                     /locus_tag="HPSH112_RS02260"
                     /old_locus_tag="HPSH112_02305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207831.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="WP_001262838.1"
                     /translation="MANERSKLAFKKTFPVFKRFLQSKDLALVVFVIAILAIIIVPLP
                     PFVLDFLLTISIALSVLIILIGLYIDKPTDFSAFPTLLLIVTLYRLALNVATTRMILT
                     QGYKGPSAVSDIITAFGEFNVSGNYVIGAIIFSILVLVNLLVVTNGSTRVTEVRARFA
                     LDAMPGKQMAIDADLNSGLIDDKEAKKRRAALSQEADFYGAMDGASKFVKGDAIASII
                     ITLINIIGGFLVGVFQRDMSLSFSASTFTILTIGDGLVGQIPALIIATATGIVATRTT
                     QNEEEDFASKLITQLTNKSKTLVIVGAILLLFATIPGLPTFSLAFVGTLFLFIAWLIS
                     REGKDGLLTKLENYLSQKFGLDLSEKPHSSKIKPHTQTTRAKTQEELKREEEQAIDEV
                     LKIEFLELALGYQLISLADMKQGGDLLERIRGIRKKIASDYGFLMPQIRIRDNLQLPP
                     THYEIKLKGIVIGEGMVMPDKFLAMNTGFVNKEIEGIPTKEPAFGMDALWIETKNKEE
                     AIIQGYTIIDPSTVIATHTSELVKKYAEDFITKDEVKSLLERLAKDYPTIVEESKKIP
                     TGAIRSVLQALLHEKVPIKDMLTILETITDIAPLVQNDVNILTEQVRARLSRVITNAF
                     KSEDGRLKFLTFSTDSEQFLLNKLRENGTSKSLLLNVGELQKLIEVVSEEAMKVLQKG
                     IAPVILIVEPNLRKALSNQMEQARIDVIVLSHAELDPNSNFEALGTIHINF"
     gene            467504..467776
                     /locus_tag="HPSH112_RS02265"
                     /old_locus_tag="HPSH112_02310"
     CDS             467504..467776
                     /locus_tag="HPSH112_RS02265"
                     /old_locus_tag="HPSH112_02310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207830.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="WP_001207116.1"
                     /translation="MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLK
                     ANPKDHSSRLGLLKLVAQRRNLLKYIKRTDHARYVVLIEKLGIKDR"
     gene            467807..469096
                     /locus_tag="HPSH112_RS02270"
                     /old_locus_tag="HPSH112_02315"
     CDS             467807..469096
                     /locus_tag="HPSH112_RS02270"
                     /old_locus_tag="HPSH112_02315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polymerase"
                     /protein_id="WP_000910782.1"
                     /translation="MLKERLKAFFSADSVFTLIFALFFLTSFKKPLTQVLLIVLMVFL
                     FFRCCFQASLKEIFGINHLKTMPFKWLTLAFLGVFLSIFPNMFNMHDSQTFRYNLFAL
                     NMSLTYACGALCLLFASCLRIKLNQKILFYSMAVANFINGLLSLVQKIYFNMPRAQGF
                     STVKEYVVLVSVSILGCYIYALYSRNQKEKLFFTLSVFVGFLVVILSATRSATIAFIM
                     TFLILSCFILYAKKSLKPLGYMVVVSLILSALYMGSNALEKKGAIEQSRVQNQSFEED
                     LKRYAKKDADSSIGWRLERWKEALTVLRLRPFFGMAASEKCQRLEEILSLSHSYRAKD
                     LILCYERYDNQIIHVLATRGIIGFLIWLFFLLVIVKIFWSGIKQNSLISLFILTTITF
                     YLIFGIGFDPFDFFITGSFFVGMVMMAVFLKKDKSAF"
     gene            469225..469728
                     /locus_tag="HPSH112_RS02275"
                     /old_locus_tag="HPSH112_02320"
     CDS             469225..469728
                     /locus_tag="HPSH112_RS02275"
                     /old_locus_tag="HPSH112_02320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207828.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="WP_000699289.1"
                     /translation="MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLD
                     VELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVH
                     LTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQQNNPN
                     NPINNQK"
     gene            469742..470815
                     /locus_tag="HPSH112_RS02280"
                     /old_locus_tag="HPSH112_02325"
     CDS             469742..470815
                     /locus_tag="HPSH112_RS02280"
                     /old_locus_tag="HPSH112_02325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207827.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24 family protein"
                     /protein_id="WP_001208574.1"
                     /translation="MRELERDAHFTLDENAMFFECAYSCDNALFLQLEDRSFFITDSR
                     YTQEAKESIQPKNGVLAEVVESSDLVQSAIDLIAKSSLKKLFFDPNQVNLQTYKRLNS
                     ALGDKVTLEGVPGYHRQKRIIKNDHEIQLLKKSQALNVEAFENFAEYVKKVFDEKESL
                     SERYLQHKVKDFLTKEGVYDLSFEPILALNANASKPHALPSAKDFLKAEHSILLDMGI
                     KYERYCSDRTRTAFFDPKDFVFTREQSFKDKERQKIYDIVKEAQEKAISGIRAGMTGK
                     EADSLARGVISDHGYGQYFTHSTGHGIGLDIHELPYISSRSETILEEGMVFSVEPGIY
                     IPGFFGVRIEDLVVIKNSRAELL"
     gene            470812..471303
                     /locus_tag="HPSH112_RS02285"
                     /old_locus_tag="HPSH112_02330"
     CDS             470812..471303
                     /locus_tag="HPSH112_RS02285"
                     /old_locus_tag="HPSH112_02330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine diphosphokinase"
                     /protein_id="WP_000984331.1"
                     /translation="MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCF
                     LYFKNHSKIGKIFSSPVYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRF
                     GRQRKRDFKDAPRTLDIDIIAFNQVILRQNDLTLPHPKWNERDSVLVPLALQQILFKK
                     GEW"
     gene            471297..472676
                     /locus_tag="HPSH112_RS02290"
                     /old_locus_tag="HPSH112_02335"
     CDS             471297..472676
                     /locus_tag="HPSH112_RS02290"
                     /old_locus_tag="HPSH112_02335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="WP_000238364.1"
                     /translation="MVKFYTYSGETAAEALKIAQSHHGVDTLVFKTQEIRKKTLTSSG
                     LYEIVVAVEEESENKPPKAPLIPESLYDEELNEEDVVMQLSSTVEEMRKLAGVSSSQR
                     NYSFSKNKTLLEKDAPLEDAPLEANQQDALLQALKDEANHKKEREKREVKQEEEIKGI
                     NLQLSKIRDSLKLIQNMFWDEKNPNSINIPQEFAEIYKLAKQSGMKSSHSDEIMQLSL
                     ELMPLRMRENSVTIKRYFREVLRKMILCRPEDLNLRQKRILMLVGPTGVGKTTTLAKL
                     AARYSRMLAKKYKVGIITLDNYRIGALEQLSWYANKMKMSIEAVIDAKDFAKEIEALE
                     YCDFILVDTTGHSQYDKEKIAGLKEFIDGGYNIDVSLVLSVTTKYEDMKDIYDSFGVL
                     GIDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQEVPMDLKVATNEYLVDCMLDG
                     FSNPNKEQA"
     gene            472673..473557
                     /locus_tag="HPSH112_RS02295"
                     /old_locus_tag="HPSH112_02340"
     CDS             472673..473557
                     /locus_tag="HPSH112_RS02295"
                     /old_locus_tag="HPSH112_02340"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207824.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_001064440.1"
                     /translation="MNNQASRLDNLINIKNPKSFFDNKGNTKFIAITSGKGGVGKSNI
                     SANLAYALYKKGYKVGVFDADIGLANLDVIFGVKTHKNIFHALKGEAKLQEIICEIEP
                     GLCLIPGDSGEEILKYISGAEALDQFVDEEGVLSSLDYIVVDTGAGIGTTTQAFLNAS
                     DCVVIVTTPDPSAITDAYACIKINSKNKDELFLIANMVAQPKEGRATYERLLKVAKNN
                     IASLELHYLGAIENSSLLKRYVRERKILRKIAPNDLFSQSIDQIAGLLVSKLETGALE
                     IPKEGFKSFFKRLLSYLG"
     gene            473562..473876
                     /locus_tag="HPSH112_RS02300"
                     /old_locus_tag="HPSH112_02345"
     CDS             473562..473876
                     /locus_tag="HPSH112_RS02300"
                     /old_locus_tag="HPSH112_02345"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000867997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000868006.1"
                     /translation="MKVQNFIHFSVVVGFFLGLVVSVLKFNEPESILLWTVLSTLGGY
                     LIALLFASIFIACTDLDICLFDKKGTEESLLRFNHEFKNREKEVASILEYIRSYDFDD
                     GK"
     gene            473854..474630
                     /locus_tag="HPSH112_RS02305"
                     /old_locus_tag="HPSH112_02350"
     CDS             473854..474630
                     /locus_tag="HPSH112_RS02305"
                     /old_locus_tag="HPSH112_02350"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207822.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor FliA"
                     /protein_id="WP_000602374.1"
                     /translation="MILMMENRMPKEIQKTQTSETNEKNIEKVLNAYDKQQHHHQDAL
                     AIQYLPAVRAMAFRLKERLPSSIDFNDLVSIGTEELIKLARRYESALNDSFWGYAKTR
                     VNGAMLDYLRSLDVISRSNRKLIKSIDNEITKHLNEHGKEPSDAYLAEVLGENIEKIK
                     EAKTASDIYALVPIDEQFNAIEQDEITKKIEAEELLEHVQKALNQMSEREQILIQLYY
                     FEELNLSEIKEILGITESRISQIIKEVIKKVRKSLGVDHG"
     gene            474623..475687
                     /locus_tag="HPSH112_RS02310"
                     /old_locus_tag="HPSH112_02355"
     CDS             474623..475687
                     /locus_tag="HPSH112_RS02310"
                     /old_locus_tag="HPSH112_02355"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207821.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_000763580.1"
                     /translation="MADILSQEEIDALLEVVDENVDIQNVQKKDIIPQRSVTLYDFKR
                     PNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPT
                     SFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQNREFSDIELNLLDTILRQ
                     VMQILKEVWSPVVEMFPTIDAKESSANVVQIVAQNEISIMVVLEIIIGHSRGMMNICY
                     PVISIESILSKMGSRDLMLSETNSKKSRNKELQALLSGVSVDMMVFLGAVELSLKEML
                     DLDVGDTIRLNKIANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVYSEKERTKEIL
                     EMLEEQRRDKVGDIMKIEEE"
     gene            475691..476581
                     /locus_tag="HPSH112_RS02315"
                     /old_locus_tag="HPSH112_02360"
     CDS             475691..476581
                     /locus_tag="HPSH112_RS02315"
                     /old_locus_tag="HPSH112_02360"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207820.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliY"
                     /protein_id="WP_001150673.1"
                     /translation="MQDFIKIFIQEVVSTLEGLVGKAPSVGLEKEVSNSEEAWESLIS
                     APYARVVISAIEKEESSIELLAPVVLVTALSDLMLGGEGASKEEMDNDDLDAFKEMAS
                     NIFGAIATSLKSQELLPKLNFTTINAEIAKELPKKEDYAKMMVFSFKMEALKESQIIL
                     LTTAAFERQFEKTHQEEKEEKEEKEEKEETTKSATEEVKTHDASLENIEIRNISMLLD
                     VKLNVKVRIGQKKMILKDVVSMDIGSVVELDQLVNDPLEILVDDKVIAKGEVVIVDGN
                     FGIQITDIGTKKERLEQLKH"
     gene            476610..477146
                     /locus_tag="HPSH112_RS02320"
                     /old_locus_tag="HPSH112_02365"
     CDS             476610..477146
                     /locus_tag="HPSH112_RS02320"
                     /old_locus_tag="HPSH112_02365"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207819.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000964052.1"
                     /translation="MAIFGELSSLGHLFKKTQELEILYEYLKDVMQKGSKANQRVLNL
                     ASSTEFQVPLGHGMFSIEQSYCLEHAKESAKGFFESHKKYVDFQLIVKGVEGAKVVGI
                     NQAAIKNPYNEKKDLIVYEPVSEASFLRLDAGMLAIFFESDAHALRFYGESFEKYREE
                     PIFKAVVKAPKGLIKLKL"
     gene            477143..477643
                     /locus_tag="HPSH112_RS02325"
                     /old_locus_tag="HPSH112_02370"
     CDS             477143..477643
                     /locus_tag="HPSH112_RS02325"
                     /old_locus_tag="HPSH112_02370"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207818.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000780267.1"
                     /translation="MKLVSLVIVFCCFLGAVELPGIYQTQEFLYMKSSFVEFFEHNGK
                     FYAYGISDADGSKAKKDKFNPNPKLRNRSDKGVVFLSDLIKVGERSYKGGKAYNFYDG
                     KTYYVRVTQNSNGDLEFTSSYDKWGYVGKTFTWKRLSDEEIKNLKLKRFDLDEVLKTI
                     KDSRPI"
     gene            complement(477663..478115)
                     /locus_tag="HPSH112_RS02330"
                     /old_locus_tag="HPSH112_02375"
     CDS             complement(477663..478115)
                     /locus_tag="HPSH112_RS02330"
                     /old_locus_tag="HPSH112_02375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000824989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor"
                     /protein_id="WP_000824987.1"
                     /translation="MKRLETLESILERLRMSIKKNGLKNSKQREEVVSVLYRSGTHLS
                     PEEITHSIRQKDKNTSISSVYRILNFLEKENFICVLETSKSGRRYEIAAKEHHDHIIC
                     LHCGKIIEFADPEIEHRQNEVVKKYQAKLISHDMKMFVWCKECQESAY"
     gene            complement(478275..479450)
                     /locus_tag="HPSH112_RS02335"
                     /old_locus_tag="HPSH112_02380"
     CDS             complement(478275..479450)
                     /locus_tag="HPSH112_RS02335"
                     /old_locus_tag="HPSH112_02380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RarA"
                     /protein_id="WP_000060221.1"
                     /translation="MSLTSLLNPKSLEDFLGQEHLIGKDAPLFKALQSKHFPHAFFYG
                     PPGVGKTSLAQIIARMLERPILLFNATDFKLEDLRLKLKNYQNTLLKPVVFIDETHRL
                     NKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFIFELTPLNKSDLDKLCAK
                     ALTLLKKQIEPSAKTYLLNNSAGDARALLNLLDLSAKIEDPITLETLQSLRPHSLNDG
                     SYSDDTHYNLTSALIKSLRGSDENASIYYLARLIAGGENPEFIARRLVIFASEDIGNA
                     NPNALNLAASCLLSVKQIGYPEARIILSQCVIYLACSPKSNTAYRAINQALDCVQKGS
                     LYPIPKHLLPNAKDYLYPHDYNGYVKQDYLEKPLDLVSSQGIGFEKTLLEWLDKIRN"
     gene            complement(479447..479818)
                     /locus_tag="HPSH112_RS02340"
                     /old_locus_tag="HPSH112_02385"
     CDS             complement(479447..479818)
                     /locus_tag="HPSH112_RS02340"
                     /old_locus_tag="HPSH112_02385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207815.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="WP_000333000.1"
                     /translation="MCDYDEPLYLISVVAKILGVHPQTLRQYEKEGLIEPSRTDGKMR
                     LYSQRDMDKIKTILRLTRDMGVNLAGVDIILRLKEKLDELDSLNKELQDALHKHSKNN
                     KTPTKNLNTPTNFYELILFKK"
     gene            complement(479828..480694)
                     /locus_tag="HPSH112_RS02345"
                     /old_locus_tag="HPSH112_02390"
     CDS             complement(479828..480694)
                     /locus_tag="HPSH112_RS02345"
                     /old_locus_tag="HPSH112_02390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207814.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ family protein"
                     /protein_id="WP_000045803.1"
                     /translation="MSKSLYQTLNVSENANQDEIKKSYRRLARQYHPDLNKTKEAEEK
                     FKEINAAYEILSDEEKRRQYDQFGDNMFGGQNFSDFARSRSTSEDLDDILSSIFGRGG
                     FSQRFSQNSQGFSGFNFSNFAHEDLDMTTTLNVSVLDTLLGNKKQVSINNETFSLKIP
                     IGVEEGEKIRVRNKGKMGRTGRGDLLLQIHIEEDEIYKREKDDIIQIFDLPLKTALFG
                     GKIEIATWHKTLTLTIPPNTKAMQKFRIKDKGIKNRKTSHVGDLYLQARLILPKTETL
                     SSELKALLEKEL"
     gene            480862..482112
                     /locus_tag="HPSH112_RS02350"
                     /old_locus_tag="HPSH112_02395"
     CDS             480862..482112
                     /locus_tag="HPSH112_RS02350"
                     /old_locus_tag="HPSH112_02395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001199604.1"
                     /translation="MQYKKNKKRYYYLALWILFLNGLSLKALEIAVKPFGYLGLLYNQ
                     GAQKNPHSYVGALARLGVDFSYSNGWSFGIGAIGAWNIYNKQRLANLYISLGNFFGSS
                     KNVKPYLSAGDVSDAYIQYTNQRFKIALGRFNTDFVDFDWIGGNIQGVSVAFKQNSMR
                     YFGIFMDSMLYNGHQINKEQGNRIATSLNALASYDPVSKRLYVGGEVFVLGAEYRHEN
                     LKVLPFILTDTRLPLPTQNVLVQVGGKLEYDASLAKGFTSRTLVHGMYQYGNTDATTN
                     AKNAGLFLIDQTFKYKIFNFGTGFYIVPARNNKGYLWTFNDRTKFYGRGINAPGVPAI
                     YFANSSISGYVFLGLKTKRVRLDAMVAFGDYQEYSLMSSFKVWTYRSLSFDMGGGYVY
                     AYNSKATRKSLGNSSFVFFGKFLF"
     gene            complement(482177..483043)
                     /locus_tag="HPSH112_RS02355"
                     /old_locus_tag="HPSH112_02400"
     CDS             complement(482177..483043)
                     /locus_tag="HPSH112_RS02355"
                     /old_locus_tag="HPSH112_02400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014537315.1"
                     /note="similar to DNA polymerase I; lacks 3'-5' exonucleas
                     and polymerase domains; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-3' exonuclease"
                     /protein_id="WP_080024693.1"
                     /translation="MRQAFNKARFAHSKTLLLDIDCVIPNIVRRLLSNKTLPKRFAAC
                     SLQEVGIIFLTTQILSIMRKARCSKTLFFITRGRESFRYQLCDHYKQKRHQFDEDFRS
                     LLKALKIALVEKYPLKKGARIQGEHCFEYEADDIISFYKKKDPKNYVIASMDKDILYS
                     NRGSHFNLKTNAFFNVSQKEAHFFAYYQCVVGDKGDNIKGVKGIGGFNYKDFLNKDAK
                     EHELWEQIIQAFKIKEDLSDSEAKEKALLNMRLVNMHQMTHHGVIKLWEPEFKKTFFP
                     KKPQRPDFKRIS"
     gene            complement(483039..483225)
                     /locus_tag="HPSH112_RS08215"
                     /pseudo
     CDS             complement(483039..483225)
                     /locus_tag="HPSH112_RS08215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001123491.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(483279..484175)
                     /locus_tag="HPSH112_RS02360"
                     /old_locus_tag="HPSH112_02405"
     CDS             complement(483279..484175)
                     /locus_tag="HPSH112_RS02360"
                     /old_locus_tag="HPSH112_02405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="WP_000697556.1"
                     /translation="MKILIIEDDLALARSISHNLHDLGHFCEIISSISEENKEPYDVI
                     LVSSKVCTQGRCEHFVRYNSKQIIIMMASHVNEDGVNKPIQAGARDYILKPFKMDELL
                     RKIQYHKAYQEMTARLGFYENYLDFIHAELPLPKDFSYRPPFIIHTPSQELANAYLLQ
                     YAKERQMDFSFFSLKDTTWKELYKNKDKLERPFYIMHLEELKKDEQLKLLELARSCPI
                     VLSYTHKEPLEFPKIVSIECGDKPLFLFSNHTTFLSIQEYEREAIRHFSSTCTDTELA
                     NKLGISRKSLWEKRRKYNLPRK"
     gene            complement(484207..485427)
                     /locus_tag="HPSH112_RS02365"
                     /old_locus_tag="HPSH112_02410"
     CDS             complement(484207..485427)
                     /locus_tag="HPSH112_RS02365"
                     /old_locus_tag="HPSH112_02410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase/2-C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase"
                     /protein_id="WP_000052976.1"
                     /translation="MSLIRVNGEAFKLSLESLEEDPFETKETLETLVKQTSVVLLAAG
                     ESRRFSQTIKKQWLRSNHTPLWLSVYESFKEALDFKEILLVVSELDYIYIKRHHPEIK
                     LVKGGASRQESVRNALKIIDSAYTLTSDVARGLANIETLKSLFLTLQQTNHYCIAPYL
                     PCYDTAIYYNEVLDREAIKLIQTPQLSHTKTLQSALNQGDFKDESSAILQAFPDLVSY
                     IEGSKDLHKLTTSSDLKHFSFFFNPAKDTFIGMGFDTHAFIKDKPMVLGGVVLDCEFG
                     LKAHSDGDALLHAVIDAILGAIKGGDIGEWFPDNDPQYKNASSKELLKIVLDFSQSIG
                     FELLEMGATIFSEIPKITPYKPAILENLSQLLGLEKSQISLKATTMEKMGFIGKQEGL
                     LVQAHVSMRYKQKL"
     gene            complement(485449..486879)
                     /locus_tag="HPSH112_RS02370"
                     /old_locus_tag="HPSH112_02415"
     CDS             complement(485449..486879)
                     /locus_tag="HPSH112_RS02370"
                     /old_locus_tag="HPSH112_02415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001936943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine endoprotease DegQ"
                     /protein_id="WP_000976659.1"
                     /translation="MMKKTLFISLALALSLNAGNIQIQSMPKVKERVSVPSKDDTIYS
                     YHDSIKDSIKAVVNISTEKKIKNNFMGSGMFNDPFFQQFFGDLGGMIPKERMERALGS
                     GVIISKDGYIVTNNHVIDGADKIKVTIPGSNKEYSATLVGTDSESDLAVIRITKDNLP
                     TIKFSDSNDILVGDLVFAIGNPFGVGESVTQGIVSALNKSGIGINSYENFIQTDASIN
                     PGNSGGALIDSRGGLVGINTAIISKTGGNHGIGFAIPSNMVKDIVTQLIKTGKIERGY
                     LGVGLQDLSSDLQNSYDNKEGAVVISVEKDSPAKKAGILVWDLITEVNGKKIKNTNEL
                     RNLIGSMLPNQRVTLKVIRDKKERTFTLTLAERKNPNKKETISAQNGAQGQLNGLQVE
                     DLTQKTKRSMRLSDDVQGVLVSQVNENSPAEQAGFRQGNIITKIEEVEVKSVADFNHA
                     LEKYKGKPKRFLVLDLNQGYRIILVK"
     gene            complement(486924..488366)
                     /locus_tag="HPSH112_RS02375"
                     /old_locus_tag="HPSH112_02420"
     CDS             complement(486924..488366)
                     /locus_tag="HPSH112_RS02375"
                     /old_locus_tag="HPSH112_02420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000369906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-methylmethionine transporter"
                     /protein_id="WP_000369889.1"
                     /translation="MDNQEIAHQNITQKQGELKRDMKMRHLLMIAFGGAIGTGLFVGT
                     GGNIASAGPLGTLIAYCFGGLVVYCIMLSLGELASVYPTTGSFGDYAAKFIGPGTGYM
                     VFWMYWLGWVITVALEYIAIGMLMQRWFVGIPIHYWVILCIALVFLLNFFSVKIFAEG
                     EFFFSLIKVLAVIAFIGIGAIGIIYQIYLHGFSSIFDNFHFGDKGFFPNGSAAVFSAM
                     LAVIFAFTGTEVIGVAVGETKNASEVMPKAIKATLWRIVFFFLGSVFVISVFLPMSNS
                     SITQSPFVSVLERINLPFIGMGIPYVSDIMNAVIITAMFSTANSGLYGASRMIYGLSK
                     QKMFFKVFSKLNRQGTPTYAMFFSLSFSLIGLLVQIYAKENVVEALINVISFTVIIVW
                     VSVSVSQYSFRKQYLKAGHSLEDLPYKAPFLPFLQLIGITGCVIGVIGSAMDKDQRIG
                     MILTIVFAVICYIGYYFTQKANENNKKDLI"
     gene            complement(488560..489162)
                     /locus_tag="HPSH112_RS02380"
                     /old_locus_tag="HPSH112_02425"
     CDS             complement(488560..489162)
                     /locus_tag="HPSH112_RS02380"
                     /old_locus_tag="HPSH112_02425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="WP_000333776.1"
                     /translation="MCGAWLFRARVFEFFTSLFESMKVLKLLPNFLTILRIVLSLFLL
                     FLLLNTHTYFSFLTPFHINMISSLVFLFAALTDLLDGYIARNYKAKSRFGEIFDPLAD
                     KILILSAFLGLVHLDRVNAWIPFVILGREFFISGLRVLAANEKKDIPVNALGKYKTVS
                     QVVAISALLADVTYSYTLVAIAIFLTLYSGIDYTIKYYKS"
     gene            complement(489096..489647)
                     /locus_tag="HPSH112_RS02385"
                     /old_locus_tag="HPSH112_02430"
     CDS             complement(489096..489647)
                     /locus_tag="HPSH112_RS02385"
                     /old_locus_tag="HPSH112_02430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207805.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024743.1"
                     /translation="MLCYFFAPLCGAILLALFLVSSGAKSFEVSNLFSNQLAYIVLLS
                     LFLCALGFIAGAIGFYRLSKITRHLSFFENFAFSFLAVILCALLSYLIPNASNALSLI
                     GNGVSIFYLHKLYRELSLYTQERFFLSGFRLLLFSFMLALLGILVQALVILFLTIAVI
                     LMCVALGFLGRAFLNFSQVFLKA"
     gene            complement(489714..490502)
                     /locus_tag="HPSH112_RS02390"
                     /old_locus_tag="HPSH112_02435"
     CDS             complement(489714..490502)
                     /locus_tag="HPSH112_RS02390"
                     /old_locus_tag="HPSH112_02435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207804.1"
                     /note="Acts on the hydroxyl group at position 7 of the
                     steroid frame; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-alpha-hydroxysteroid dehydrogenase"
                     /protein_id="WP_001065844.1"
                     /translation="MNNSNHMKNKTLVISGATRGIGKAILYRFAQSGVNIAFTYNKNV
                     EEANKIIEDVEQKYSIKAKAYPLNVLEPEQYTELFKQIDADFDRVDFFISNAIIYGRS
                     VVGGFAPFMRLKPKGLNNIYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYM
                     PNYAGHGNSKNAVETMVKYAAVDLGEFNIRVNAVSGGPIDTDALKAFPDYVEIKEKVE
                     EQSPLKRMGNPNDLAGAAYFLCDETQSGWLTGQTIVVDGGTTFK"
     gene            complement(490499..491401)
                     /locus_tag="HPSH112_RS02395"
                     /old_locus_tag="HPSH112_02440"
     CDS             complement(490499..491401)
                     /locus_tag="HPSH112_RS02395"
                     /old_locus_tag="HPSH112_02440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-tetrahydrodipicolinate synthase"
                     /protein_id="WP_001159503.1"
                     /translation="MQFHSSSALITPFKKDLSVDEAAYEALIKRQIFQGMDACVPVGT
                     TGESATLTHQEHMRCIEIAVETCKNTKTPSNSRMKVLAGVGSNATSESLSLAKFAQKI
                     GADAILCVSPYYNRPTQQGLFEHYKTIAQSVEIPVMLYDVPSRTGVSIEVSTALKLFR
                     EVPNIKAIKEASGSLKRVTELHYYEKDFKIFSGEDSLNHSIMFSGGCGVISVTGNLMP
                     NLISQMVNCALKLEYQQALEIQNKLFHLHQALFVETNPIPIKMAMHLAGLIENPSYRL
                     PLVAPSKETIQLLEKTLQQYEVIA"
     gene            complement(491416..492750)
                     /locus_tag="HPSH112_RS02400"
                     /old_locus_tag="HPSH112_02445"
     CDS             complement(491416..492750)
                     /locus_tag="HPSH112_RS02400"
                     /old_locus_tag="HPSH112_02445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207802.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_001268796.1"
                     /translation="MRYFSVKRLLRLSSVLLVTLGASMHAQSYLPKHESVTLKNGLQV
                     VSVPLENKTGVIEVDVLYKVGSRNETMGKSGIAHMLEHLNFKSTKNLKAGEFDKIVKR
                     FGGVSNASTSFDITRYFIKTSQANLDKSLELFAETMGSLNLKEDEFLPERQVVAEERR
                     WRTDNSPIGMLYFRFFNTAYVYHPYHWTPIGFMDDIQNWTLKDIKKFHSLYYQPKNAI
                     ILVVGDVNSQKVFELSKKHFESLKNLDGKAIPTPYMKEPKQDGARTAVVHKDGVHLEW
                     VALGYKVPAFKHKDQVALDALSKLLGEGKSSWLQSELVDKKRLASQAFSHNMQLQDES
                     VFLFIAGGNPNVKAEALQKEIVALLEKLKKGEITQAELDKLKINQKADFISNLESSSD
                     VAGLFADYLVQNDIQGLTDYQQQFLDLKVSDLVRVANEYFKDTQSTTVFLKP"
     gene            complement(492747..493802)
                     /locus_tag="HPSH112_RS02405"
                     /old_locus_tag="HPSH112_02450"
     CDS             complement(492747..493802)
                     /locus_tag="HPSH112_RS02405"
                     /old_locus_tag="HPSH112_02450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase (quinone)"
                     /protein_id="WP_000967023.1"
                     /translation="MLYSLLKKYLFSLDAEDAHEKVCKILKMLSSSPFLCGLIDSQWG
                     YKNPKLENEILGLHFPNPLGLAAGFDKNISMLRALIAFGFGYLEAGTLTNEAQTGNEK
                     PRLFRHIEEESLQNAMGFNNHGAILAARSFNRFAPYKTPIGINLGKNKRIEQAHALED
                     YKAVLNKCLNIGDYYTFNLSSPNTPNLRDLQNKAFVNELFCMAKEMTHKPLFLKIAPD
                     LETDNMLEMVNSAIEAGAHGIIATNTTIDKSLVFAPKEMGGLSGKCLTKKSREIFKEL
                     AKAFFNKSVLVSVGGISGAKDAYERIKMGASLLQIYSAFIYNGPNLCQNILKDLVKLL
                     QKDGFLSVKEAIGADLR"
     gene            complement(493839..495866)
                     /locus_tag="HPSH112_RS02410"
                     /old_locus_tag="HPSH112_02455"
     CDS             complement(493839..495866)
                     /locus_tag="HPSH112_RS02410"
                     /old_locus_tag="HPSH112_02455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207800.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA degradosome polyphosphate kinase"
                     /protein_id="WP_001078627.1"
                     /translation="MNRFFNRELSWLAFNTRVLNEAKDESLPLLERLKFLAIYDTNLD
                     EFYMIRVAGLKQLYEHKIASKGIDGANPEEQLEKIKHYLAHEIEERELEFQKIQALLF
                     KKGLCITPYNELNLEQKAKAKTYFKEQLYALALPFKLDSSHTFPPLGNLTFALFARIK
                     DKETQTTSYALIKLPSFIFRFVELEKGLFVLAEEIVEAHLEELFLEHEILDCMAFRVT
                     CDADIAITEDEAHDYADLMSKSLRKRNQGEIVRLQTQKGSQELLKTLLASLRSFQTHS
                     YKKRKLTGMHAYKSAIMLNLGDLWELVSHSDFKALKSPNFTPKIHPHFNENDLFKSIE
                     KQDLLLFHPYESFEPVVDLIEQAASDPTTLSIKMTLYRVGKHSPIVKALIEAASKIQV
                     SVLVELKARFDEESNLHWAKALERAGALVVYGVFKLKVHAKMLVITKKTDNQLRHFTH
                     LSTGNYNPLSAKIYTDVSFFSAKNEIANDTIKLFHSLLTSSATNSALETLFMAPKQIK
                     PKIIELIQNEMNHQQEGYIILKANALVDSEIIEWLYQASQKGVKIDLIIRGICCLKPQ
                     VKGLSENIRVYSIVGKYLEHARIYYFKHENIYFSSADLMPRNLERRVELLVPATNPKI
                     ANKLLHILEIQLKDTLKRYELNSKGRYIKVSNPNDPLNSQDYFEKQTLKTF"
     gene            complement(495959..496036)
                     /locus_tag="HPSH112_RS02415"
                     /old_locus_tag="HPSH112_t08204"
     tRNA            complement(495959..496036)
                     /locus_tag="HPSH112_RS02415"
                     /old_locus_tag="HPSH112_t08204"
                     /product="tRNA-Pro"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(495999..496001),aa:Pro,seq:ggg)
     gene            496225..496405
                     /locus_tag="HPSH112_RS08220"
                     /pseudo
     CDS             496225..496405
                     /locus_tag="HPSH112_RS08220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001976487.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(496511..497551)
                     /locus_tag="HPSH112_RS02420"
                     /old_locus_tag="HPSH112_02465"
     CDS             complement(496511..497551)
                     /locus_tag="HPSH112_RS02420"
                     /old_locus_tag="HPSH112_02465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000047709.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit S"
                     /protein_id="WP_000047722.1"
                     /translation="MSKTLQDYATLINDTIQSNEINHYITTDNMCQNLGGIDTLKNIN
                     IPQGKVRSFQKDDVLLSNIRLYFRKVYRAKQKGGCSSDVLVFRAKHIDSATLFAILSS
                     QIFTDYACSGSQGSKMPRGNKTHMMDFKIPTINFTIAKIFNSIQNKIENNHKINELLH
                     TLAYKVYEYYFKYKPKNAKLEQIIIENPKSSIMVKNAQKTQDKYPFFTSGDNILSYPK
                     AIIDGRNCFLNTGGNAGIKFYVGKASYSTDTWCICANEFSDYLYLLLSSIKTHINQSF
                     FQGTSLKHLQKNLLKKYPIYMPSVHEIKKFNQIIMPLLTLISINTRTSKKLEQIRDFL
                     LPLLLKQQVKPQ"
     gene            complement(497544..499175)
                     /locus_tag="HPSH112_RS02425"
                     /old_locus_tag="HPSH112_02470"
     CDS             complement(497544..499175)
                     /locus_tag="HPSH112_RS02425"
                     /old_locus_tag="HPSH112_02470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017281289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-6 DNA methylase"
                     /protein_id="WP_001133462.1"
                     /translation="MPNNALLQIKQSTLNLIDDLKVVCASFGLGNDGNEYKIITQCFL
                     YKFLCDKFEFLFEQEFPNQTIQDYKDFNEEEKEDFLITLIDKRLPKLAYDDLLSYLFE
                     KHFNDNDLHLKLDTIFNRISSNNAELFNTKSTDETTIALFESISQYINEESKRANFTR
                     ILLDKLKNFDFKQAFLNLQNQQGYDFFAPIFEYLLKDYNNAGTGKYAEYYTPLSIARI
                     IAKLLINEPTKSVKIYDPSAGTGTLLMALAHQIGTDSCTLYAQDISQKSLKMLKLNLI
                     LNDLTHSLKYAIEGNTLTNPYHSKDLKGKMDYIVSNPPFKLDFSNEHAEISQNKNDFF
                     LGVPNIPKNDKSKMPIYTLFFQHCLNMLSDKGKGAIIVPTGFISAKSGVENKIVRHLV
                     DEKLVYWVICMPSQVFANTGTNVSIIFFKKTPSANEVVLIDASKLGEEYTENKNKKTR
                     LRGSDIDLILETFQNKTQKADFCALVSFNEITEKNYSLNPGQYFTIEDTSEKISQAEF
                     ENLMQQYSSKLTSLFDESQSLQQEILETLKGVRFE"
     gene            complement(499168..502271)
                     /locus_tag="HPSH112_RS02430"
                     /pseudo
     CDS             complement(499168..502271)
                     /locus_tag="HPSH112_RS02430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001120343.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit R"
     gene            complement(502320..504215)
                     /locus_tag="HPSH112_RS02435"
                     /old_locus_tag="HPSH112_02485"
     CDS             complement(502320..504215)
                     /locus_tag="HPSH112_RS02435"
                     /old_locus_tag="HPSH112_02485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001116302.1"
                     /translation="MPFLKALESFDAPFLEKEISKRFRDNLVFFKSYNPHLFNALNTP
                     FKNYRLLFEKNHFNLLHTPTNALSYPKNQMVEIAFNMASNPLNNPRWSLDNNHLSLNY
                     LKTQNNPKLPLTLKATHAISNFLDDYQTPCSLKKFLPPTMIYGVLDGLFLAILQAQNY
                     RFHSLYLFEENLDLFKISCYFARYEDLITKGAKLFIQGFFNPNELKMDFLKRPITHSF
                     LKLEIMPYKSAFNSRMRENIQSYYKQALRGWGSFEDELLGLKNTLKNLPLYQTLKTKP
                     KKINAPICVVGNGPSLDLLLDFLKENEDRFIIFSCGTALKPLKTHGIKVDFQIEVERI
                     DYLKEVLEKAPLEDTPLIGANMLNPNAFNIAKEALMFMRGGSACAYISPLSIEYAAPF
                     VGNAGVALAGLMSDEIYLCALDCAYIKGFKKHAQNSYYENEKEIDPSSLISVEGNFKG
                     YETFSDSLFLLSKERIEEALNYYQPKKVYNLSYGAKIKHAVSLNHSQVKLKHSNKQKA
                     TARIKSMFSPKSNHAKDLKNLQKNLISFKEDFFMHLNTPCKTKQEIFEWVDSLNGFCQ
                     TTSAKTPTIGILFEGSIAHILQSVLIVSLHLNENELTHFTNHSQNTLKQFLKKACLLL
                     QMRLKQP"
     gene            complement(504241..505008)
                     /locus_tag="HPSH112_RS02440"
                     /old_locus_tag="HPSH112_02490"
     CDS             complement(504241..505008)
                     /locus_tag="HPSH112_RS02440"
                     /old_locus_tag="HPSH112_02490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000402722.1"
                     /translation="MEIILLIVAAIVLFYFYNTLKEYLKNPLNPKTKTEEYDLKNDPY
                     LLVQSSPLEKFKQTQIGAYMRLLKFLDIQKNALDNALRTLFINELEQPLNSEQQNLAK
                     ELLNEPVDKKENFESLCQEIADHTHGEYTKRLKLVEFLMLLAYADGILDSKEKELFLD
                     VGAFLQIDNQDFNELYDNFERFNSIEIPMSLEEAKNLFEIQTNITKQDLEEKALNLSA
                     LYYHKMNDNKRYSEQDFISLKKIALASQLLENALKNS"
     gene            complement(505018..505365)
                     /locus_tag="HPSH112_RS02445"
                     /old_locus_tag="HPSH112_02495"
     CDS             complement(505018..505365)
                     /locus_tag="HPSH112_RS02445"
                     /old_locus_tag="HPSH112_02495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001220150.1"
                     /translation="MRIIIRLLSFKMNAFLKLALASLMGGLWYAFNGEGSEIVAIGIF
                     LLILFVFFIRPVSFQDPEKREEYIERLKKNHERKMILQDKQKEEQMRLYQAKKERESR
                     QKQDLKEQMKKYS"
     gene            complement(505334..506821)
                     /locus_tag="HPSH112_RS02450"
                     /old_locus_tag="HPSH112_02500"
     CDS             complement(505334..506821)
                     /locus_tag="HPSH112_RS02450"
                     /old_locus_tag="HPSH112_02500"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000114762.1"
                     /translation="MSVLKLHVKVFRFETNKDYNPAYESYFLEYQEDQYLLDLLKQLK
                     GVSYNENIALKINQIAVFEDAKVSDLVASFSKEWVLDPLSKRYALKDLVIDEKAVLKN
                     YEDFFKQVPYITKGEKEELEKFIQINFINPQTNPKYLGDGFFLYVKWLMKRYPTERNR
                     LLEMISQPESGVMNFLSVAHYLYKNDDNIDHEIYELQEILTNSKIKPWKDFSKNLLSL
                     FQYNSNPPKTPNPPKTCALFNAYAKHLNAQPLLKSAKLYLEKMGQKTIDLPFCYDGGY
                     YGKIISTHDFLTACAYNLALAKANGVSLIFCEEDAYLNILHAKEVLDNNPEIIDSINE
                     KLKKYQLVYEKGVEIVYLNEWVNEFLAWELKGPFDAFLGAEFSRIKQSDHFFNKIHLK
                     APHFLESFQNYAPLLEVNEISGLLQCAHLRYLGIDLGADFLIAHSLGLFHAFENLSLK
                     ASKIYKRDNDNTPTLFLPQIALMAMGEKNTQALGLDAHYHKVTFI"
     gene            complement(506833..507321)
                     /locus_tag="HPSH112_RS02455"
                     /old_locus_tag="HPSH112_02505"
     CDS             complement(506833..507321)
                     /locus_tag="HPSH112_RS02455"
                     /old_locus_tag="HPSH112_02505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001188581.1"
                     /translation="MQRELRLLNNKHCIEYLQFLSKNHLSFNLLCERDAIDFSPKLPK
                     EIHEKFGALVLFVLAGYTLESLMVDAKSVQFEAGFGPNNIGSVVQVELPGIIQILIKE
                     KNENAVLFNRCDSLELFQKEEPLFQEPKKDERESKEWLDSKEALFSNSKNRAILENLH
                     KS"
     gene            complement(507306..509042)
                     /locus_tag="HPSH112_RS02460"
                     /old_locus_tag="HPSH112_02510"
     CDS             complement(507306..509042)
                     /locus_tag="HPSH112_RS02460"
                     /old_locus_tag="HPSH112_02510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_000662878.1"
                     /translation="MKEQEWDLSALFENKESTEEFLKTLQTEVQEFESAYQNNLKNLD
                     ATGFSNALKYYEDLSEKISKAMTYAQLLFAKNTKEAKFYSQCEMACTNIQQHLLFFEI
                     EFKNLDAKKQLAFIKKCKDHAFYLNNLIEKKKHTLNLDEEKIALALSPVGVGAFSRLF
                     DEHFSSLKIPFEEQHLSEEEILALLHNPKRKIRKKSQKAFSKALEKSRPLLTYILNMV
                     RKDLLIETRLRKYDKKESFRHIDNQISQESVDSMIEIVNANFSLVHRYYHQKAQILGH
                     KLKDYDRYAPLSDENTTMTYSQALEEVLNTLKAFSPEFYKIASKAIKEGWVDSHPKDF
                     KQGGAFSHGGVPSVHPYVLLNYTGNRRDAFTIAHEFGHMIHQELSKKQGVLNMDTPLT
                     TAETASVFSEMLFFEHLKKGLKSDELLFMLAGKLEDIFSTLFRQVVMTNFERRIHEID
                     EELDTKDFDRIWFEENQRMFEKSVKLTKNYHLWWSYIPHFIHSPFYCYAYSYGQLLTL
                     ALYGLYKKSDAKEFVKTYTEFLSLGGSKSPKELVSMFGFDIDSKEFWEIGMQEVRHLL
                     EEFERLLACKEN"
     gene            complement(509139..510389)
                     /locus_tag="HPSH112_RS02465"
                     /old_locus_tag="HPSH112_02515"
     CDS             complement(509139..510389)
                     /locus_tag="HPSH112_RS02465"
                     /old_locus_tag="HPSH112_02515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_000431973.1"
                     /translation="MENSTLYIVIAGLWLAVGFGIFLKKLDMPVIIGYICTGTVLAAF
                     FKINDFNLLSDIGEFGIVFLMFMIGIEFNFDKLKSIKQEVLVFGLLQVVLCALIAFLL
                     GYFVLGLSPIFSLVLGMGLSLSSTAIVLKFFEDSKQLSTPMGKSAVGILIFQDIAAIP
                     MLLILTILGSKDSNVNLLILKTFISAGIILVLLLLPGKKGANLILEQAKDTRLPEIFI
                     GTILVIVCSAAGLSHFFGFSMSLGAFIAGMAISKSRYKINVQEEFVQLKNLFLALFFI
                     TIGMQINVSFFIEKFFVVIFLLILVMGFKTAIIYALLRFFRDSKTAIKTALSLAQIGE
                     FSFVIFLNSGSHQLFNLQEKKGILGFLHQKNILSIAQNDIHQLLILMVVFSMLATPFI
                     LKYLESIAQFILHQKSQENEPAKK"
     gene            complement(510540..510722)
                     /locus_tag="HPSH112_RS08225"
     CDS             complement(510540..510722)
                     /locus_tag="HPSH112_RS08225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001873817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024744.1"
                     /translation="MSSLSNPFFHSLFFIKLNPSRLLKGWGSKIFFINRKFALVQYNP
                     SVLIFILLNRAFGVCV"
     gene            complement(510706..511266)
                     /locus_tag="HPSH112_RS02470"
                     /old_locus_tag="HPSH112_02520"
     CDS             complement(510706..511266)
                     /locus_tag="HPSH112_RS02470"
                     /old_locus_tag="HPSH112_02520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000595790.1"
                     /translation="MIKRIACILSLSTSLALAGEVNGFFMGAGYQQGRYGPYNSNYSD
                     WRHGNDLYGLNFKLGFVGFANKWFGARVYGFLDWFNTSGTEHTKTNLLTYGGGGDLIV
                     NLIPLDKFALGLIGGVQLAGNTWMFPYDVNQTRFQFLWNLGGRMRVGDRSAFEAGVKF
                     PMVNQGSKDVGLIRYYSWYVDYVFTF"
     gene            complement(511310..511462)
                     /locus_tag="HPSH112_RS02475"
                     /old_locus_tag="HPSH112_02525"
     CDS             complement(511310..511462)
                     /locus_tag="HPSH112_RS02475"
                     /old_locus_tag="HPSH112_02525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000234785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000234785.1"
                     /translation="MVIISNLYLKNLYFKSLRWFCGCVPLIHDLINIFTLKPSIFDKK
                     LNLLEK"
     gene            511491..512231
                     /locus_tag="HPSH112_RS02480"
                     /old_locus_tag="HPSH112_02530"
     CDS             511491..512231
                     /locus_tag="HPSH112_RS02480"
                     /old_locus_tag="HPSH112_02530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_000798918.1"
                     /translation="MKNTFKAFAFLIVFFSSALLAQDLKIAAAANLTRALKALVKEFQ
                     KEHPKDAISISFNSSGKLYAQIIQNAPFDLFISADIARPKKLYDEKITPFKEEVYAKG
                     VLVLWSENLKIDSLEILKDPKIKRIAMANPKLAPYGKASMEVLDHLKLTSSLKSKIVY
                     GASISQAHQFVATKNAQIGFGALSLIDKKDKNLSYFIINKALYSPIEQALITTKNGAN
                     NPLAKVFKDFLFNPKARAIFKEYGYIVD"
     gene            512253..512924
                     /locus_tag="HPSH112_RS02485"
                     /old_locus_tag="HPSH112_02535"
     CDS             512253..512924
                     /locus_tag="HPSH112_RS02485"
                     /old_locus_tag="HPSH112_02535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter permease subunit"
                     /protein_id="WP_000349383.1"
                     /translation="MDHEFLITMRLSFSLAFITTLILLPIGICLGYFLSLKRNLLTSL
                     TETLVYMPLVLPPSVLGFYLLLIFSPSSFLGAFLQDALNVKLVFSFQGLILGSVIFSL
                     PFMVSPIKSALISLPTSLKEASYSLGKGEYYTLFFVLLPNIKPSLLMAIITTFTHTIG
                     EFGVVMMLGGDILGETRVASIAIFNETEALNYPKAHQYALTLTLISFGLLFVTLFLNK
                     KQSSF"
     gene            512924..513721
                     /locus_tag="HPSH112_RS02490"
                     /old_locus_tag="HPSH112_02540"
     CDS             512924..513721
                     /locus_tag="HPSH112_RS02490"
                     /old_locus_tag="HPSH112_02540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum ABC transporter ATP-binding protein"
                     /protein_id="WP_000588348.1"
                     /translation="MIKARFKKHLLGSRGAFDLNIDLEIKEAEVVALLGESGAGKSTI
                     LRILAGLEAVDSGYIEVNHSVWLDTQKKIFLKPQQRKIGFVFQDYALFPHLNVYQNIA
                     FAHPKDKNKIHEVLRLMRLENLSHQKILKLSGGQAQRVALARALIAAKNLLLLDEPLN
                     ALDNALKNEVQQGLLDFIKRENLSVLLVSHNPNEITKLARTSLFLNNGVINPNQENLL
                     FSNRLLIKPLFEDENYCHYEVIPQTISLPKDCLNPTFKLDFNQGKKF"
     gene            complement(513803..515194)
                     /locus_tag="HPSH112_RS02495"
                     /old_locus_tag="HPSH112_02545"
     CDS             complement(513803..515194)
                     /locus_tag="HPSH112_RS02495"
                     /old_locus_tag="HPSH112_02545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="WP_000053266.1"
                     /translation="MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIED
                     TDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFGIYKEYIQKLLDEDKAYYCYMS
                     KDELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEIIGFNDGVKGE
                     VKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKAL
                     NFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEMGYLKEALVNFLARLGWSYHDKE
                     VFSMQELLEWFDPKDLNSSPSCFSWHKLNWLNAHYLKNQSAQRLLELLKPFSFSDLSH
                     LNPTQLDRLLDALKERSQTLKELALKIDEVLIAPVEYEEKVFKKLNQALVMPLLEKFK
                     LELNKANFNDESTLENAMHKIIEEEKIKAGSFMQPLRLALLGKGGGIGLKEALFILGK
                     TESLKRIEEFLKN"
     gene            515313..516409
                     /locus_tag="HPSH112_RS08230"
                     /pseudo
     CDS             515313..516409
                     /locus_tag="HPSH112_RS08230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207275.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            516418..518055
                     /locus_tag="HPSH112_RS02510"
                     /old_locus_tag="HPSH112_02560"
     CDS             516418..518055
                     /locus_tag="HPSH112_RS02510"
                     /old_locus_tag="HPSH112_02560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_001139731.1"
                     /translation="MPSNALSIEEIARLINVSHSSVHNWIKTNLLEKLEIDHKIYVKI
                     SSFLDFCRNHLGKSKLNKYANKSLKSTHNHQELVLKYLKILENSSDLEKLGSYYEEEL
                     SNTTRNLEGIYYTPNKIVEWLFTLPKDFDASQAIFCDPAVGSGNFIMHALKLGFKVEN
                     IYGYDTDAFAIALTKKRIKERYHLDCPNIVQKDFLNLKHTPQFDCIFTNPPWGKKYNQ
                     NQKENFKQRFNLSQSLDSASLFFIASLNCLKENAHLGLLLPESCLNIDAFSKMREMAL
                     KFQIRSLIDFNKPFKTLMTKAVGLVLKKAPNKDQKISCFYQNSEFKRSPSSFLNNPKK
                     IFNIHCSSKENKILDHLFSLPHITLKNNAHFALGIVTGNNKEKLHSKQEKNTIPIFRG
                     SDILKDRLKAPSQFINADLKNCQQVAPLSLYQSREKIVYKFISSKLVFFYDNKQRLFL
                     NSANMFVLKENFPINANALKELLNSDLMQFIFESLFKTHKILRKDLECLPLFVQFINN
                     SFDEKFYLKNLGIEKKDPKHFTIRKNHAHRLSFGFRG"
     gene            518021..518869
                     /locus_tag="HPSH112_RS02515"
                     /old_locus_tag="HPSH112_02565"
     CDS             518021..518869
                     /locus_tag="HPSH112_RS02515"
                     /old_locus_tag="HPSH112_02565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000546655.1"
                     /translation="MHIACLLALGDNLITLSLLKEIASKQQQPLKILGTHLTLKIAKL
                     LECEKHFEIIPLFENVPAFYDLKKQGVFWAMKDFLLLLKAIKKHQIKHLILEKQDFRS
                     ALLATFVPINAPNKDIKNVYQNRQELFSQIYGHAFDHSPYLMNLKNPKKILINPFTRS
                     TERSIPLEHLQIVLKLLKPFCVTLLDFEERYAFLKDRVTHYRAKTSLEEVKNLILESD
                     LYIGGDSFLIHLAYYLKKNYFIFFYRDNDDFMPPNGKNENFLKAHKSHSIEQDLAKKF
                     RHLGLL"
     gene            518915..520714
                     /locus_tag="HPSH112_RS02520"
                     /old_locus_tag="HPSH112_02570"
     CDS             518915..520714
                     /locus_tag="HPSH112_RS02520"
                     /old_locus_tag="HPSH112_02570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translational GTPase TypA"
                     /protein_id="WP_000790221.1"
                     /translation="MKNIRNIAVIAHVDHGKTTLVDGLLSQSGTFSEREKVDERVMDS
                     NDLERERGITILSKNTAIYYKDTKINIIDTPGHADFGGEVERVLKMVDGVLLLVDAQE
                     GVMPQTKFVVKKALSFGICPIVVVNKIDKPAAEPDRVVDEVFDLFVAMGASDKQLDFP
                     VVYAAARDGYAMKSLDDEKKNLEPLFETILEHVPSPSGSVDEPLQMQIFTLDYDNYVG
                     KIGIARVFNGSVKKNESVLLMKSDGSKENGRITKLIGFLGLARTEIENAYAGDIVAIA
                     GFNAMDVGDSVVDPANPMPLDPMHLEEPTMSVYFAVNDSPLAGLEGKHVTANKLKDRL
                     LKEMQTNIAMKCEEMGEGKFKVSGRGELQITILAENLRREGFEFSISRPEVIIKEENG
                     VKCEPFEHLVIDTPQDFSGAIIERLGKRKAEMKAMNPMSDGYTRLEFEIPARGLIGYR
                     SEFLTDTKGEGVMNHSFLEFRPFSGSVESRKNGALISMENGEATAFSLFNIQERGTLF
                     INPQTKVYVGMVIGEHSRDNDLDVNPIKSKHLTNMRASGSDDAIKLTPPRTMVLERAL
                     EWIEEDEILEVTPLNLRIRKKILDPNMRKRAKK"
     gene            520718..521284
                     /locus_tag="HPSH112_RS02525"
                     /old_locus_tag="HPSH112_02575"
     CDS             520718..521284
                     /locus_tag="HPSH112_RS02525"
                     /old_locus_tag="HPSH112_02575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction endonuclease"
                     /protein_id="WP_014662213.1"
                     /translation="MYKVADIFCGAGGLSYGFSMHPYFELIWANDIDKDAILSYQANH
                     KETQTILCDIMQLNCHNLPCVSIDILLGGPPCQSYSTLGKRKMDEKANLFKEYLRLLD
                     LVKPKMFVFENVVGLMSMQKGQLFKRICNAFKERGYILEHAILNALDYGVPQIRERVI
                     LVGALKSFKQKSHSHKPIKTHFFNQLIF"
     gene            complement(521300..522244)
                     /locus_tag="HPSH112_RS02530"
                     /old_locus_tag="HPSH112_02580"
     CDS             complement(521300..522244)
                     /locus_tag="HPSH112_RS02530"
                     /old_locus_tag="HPSH112_02580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_000719630.1"
                     /translation="MKKIGLSLCVVFSLGFLKAHEVSAEKIADIFYKLNAKEPKMKIN
                     HTKGFCAKGVFLPNPQVRKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLE
                     NQNASWTMVMLNTEINFAKNPNEFAQFFEMRIPKNGKVDEARIKKLYEEVPSYRNFAA
                     YTKTIGISSSVANTPYYSVHAFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKDSN
                     YLLSSFQQHLKTKPIEYQMYLVFANKNDATNDTTALWKGKHKELLVGTLKVEKYEGMG
                     CNKDVYFPADLPKGVEAPTDPLFQIRNEVYGITFNRRQ"
     gene            522530..524116
                     /locus_tag="HPSH112_RS02535"
                     /old_locus_tag="HPSH112_02585"
     CDS             522530..524116
                     /locus_tag="HPSH112_RS02535"
                     /old_locus_tag="HPSH112_02585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000768630.1"
                     /translation="MKLKKRKVAATLLKRFTLPLLFTTGSLGAVTYEVHGDFINFSKV
                     GFNHSPINPVKGIYPTETFVNLTGKLEGSVHLGRGWTVNLGGVLGGQVYDSTRYDRWA
                     KDFTPPSYWDKTSCGTDSMSLCMNATKMWQQQGPGGVINPRGIGWEYMGEWNGLFPNY
                     YPANAYLPGHSRRYEVYKANLTYDSDRVHMVMGRFDVTEQEQMDWVYQLFQGFYGTFK
                     LTNKMKFLLFSSWGRGIADGQWLFPIYREKPWGIHKAGIIYRPTKNLMIHPYVYLIPE
                     VETDPGVKIEYDTNPEFSGRGIRNRTTFYALYSYRWNNAEYGRYAPARYNTWDPFLDN
                     GKWRGLQGPGGATLLLRHHIDINNYFVVGGAYLNIGNPNMNLGTWGNPVAVDGIEQWV
                     GGIYSLGFAGIDNITDADAFTEYVKGGGKHGKFSWSLYQRFTTAPRALEYGIGMYLDY
                     QFSKHVKAGLKLVWLEFQIRAGYNPGTGFLGPNGQPLNLNNGLFESSAFAEGPQDMGG
                     IKKSITQDRSHLMTHISYSF"
     gene            524138..525583
                     /locus_tag="HPSH112_RS02540"
                     /old_locus_tag="HPSH112_02590"
     CDS             524138..525583
                     /locus_tag="HPSH112_RS02540"
                     /old_locus_tag="HPSH112_02590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017282634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024695.1"
                     /translation="MCLFCIFILISLGVRVLEIKKYFSYSLFFLLFSSLFLSKLQAYK
                     FNMSIVGKVSSYTKFGFNNQRYQPSKDIYPTGSYTSLLGELNLSMGLYKGLRAEVGAM
                     MAALPYDSTAYQGNNIPNGQPGSRTDPFGAGIFWQYIGWYAGHSGLQVQKPRLAMVHN
                     AFLSYNYKKDKFSFGVKGGRYDAEEYDWFTSYTQGVEGFVKYKDTRLRVMYSDARASA
                     SSDWFWYFGRYYTSGKALMIADLKYEKDNLKINPYFYAIFQRMYAPGINITYDTNPNF
                     NNKGFRFVGTFVGFFPIFATPANQNDIILFQQVPLGKSGQTYFFRTRFYYNKWQFGGS
                     VYKNIGNANGDIGIYGDPLGYNIWTNSIYDAEINNIVGADVINGFLYVGSQYRGFSWK
                     ILGRWTDSPRADERSLALFLSYFSNKYNIRMDLKLEYYGNITKKGYCIGYCGMYVPVD
                     PNGPGTQPLTHNVYSDRSHIMFNITYGFRIY"
     gene            complement(525813..526013)
                     /locus_tag="HPSH112_RS08235"
                     /pseudo
     CDS             complement(525813..526013)
                     /locus_tag="HPSH112_RS08235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014536777.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            525982..527718
                     /locus_tag="HPSH112_RS08065"
                     /old_locus_tag="HPSH112_02595"
     CDS             525982..527718
                     /locus_tag="HPSH112_RS08065"
                     /old_locus_tag="HPSH112_02595"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662215.1"
                     /translation="MKLPKALNEATAGAALKYHIKRALERSHTISDFSKQLELSAKNS
                     QFTNNTLKIIEELNNGVKQASDELKEATKPSNLVKSIREQDARPFEVIKDKEAFFKDL
                     NQNLNDNATALPKGMSVEEFKQTLESVENKERFLEHLQTRENSDERLKALNLVEPTLR
                     EPHIEIFTKDKNNATDKKEYIKAFKDENQARLYMLITQDNDTILRTFIPDTPERYVRN
                     HVRNADIIHSFIQPNRTANSDDLEAVVVYGENTTKKPLTSQEDLLKTQENAPKNTQDL
                     SPLELAKAEKLAKLESDRIESEKEFLKAKEQEQARKAALKKKLEHERGNAGNIESQTK
                     IEVGEDIPAHTQAQIPKSRVRLNEREIYDLDYAIVKAKDLKPSFTTGGTQKRTDMNEE
                     QIKSISENFDPKKIFGSGGFEDLPIILHDGQVIAGNHRIQGMLNFTPKSRFSYEKAIK
                     EYYHIDLKPDELLVRLPSKRLNNTEINNLAASSNQGRFNSESDHAIAVLSHYESKLKE
                     LESQLNADSVYSLKNIVAKNLNFDKATHPNVTDSNLSLLMYNMPRTKTQGIELLNRWQ
                     KEFSNDIKSYEK"
     gene            527708..528283
                     /locus_tag="HPSH112_RS08240"
     CDS             527708..528283
                     /locus_tag="HPSH112_RS08240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024696.1"
                     /translation="MKNKKMFVDNAGSFHNLIHDMNFPNVSLNAYLSDIMDRSFANLK
                     NYQSTSESLKDLSEKFYKTNSLEMFEKSDQGISDISEILGGAIARFARFDDPSKALFE
                     ALRSDNIKKGLKEFKIADVAKDMFDPNSKEFKDIDIYDFTHYLLMVNREPNETNPALN
                     RLIEAVKDMQKESKNAKEASKKSAKETKKGI"
     gene            528337..528777
                     /locus_tag="HPSH112_RS08245"
                     /pseudo
     CDS             528337..528777
                     /locus_tag="HPSH112_RS08245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001920747.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(529183..529914)
                     /locus_tag="HPSH112_RS02550"
                     /old_locus_tag="HPSH112_02615"
     CDS             complement(529183..529914)
                     /locus_tag="HPSH112_RS02550"
                     /old_locus_tag="HPSH112_02615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001938774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease"
                     /protein_id="WP_000646758.1"
                     /translation="MKANTIILVDWENFRRDIKQTKCVNYNIALDVIVTIRAFLLDDE
                     RISRIYFYTTPPFDFEHALWDKRNDTLQNEKNPGTEMKIFTSNDIEEILQSSEATKWE
                     KIYSDVENFQHDLASLDQVELRLGRTKLNAIRVEFDGSYKALLEQKQVDMLMGLDIQR
                     IAFKKIADRILIFSKDTDLIPALKLARDEGLRVDIADLSNRLSLLSQDLKYNSDKVRK
                     LSSNEVKDKLFSIRENLTKTNWALS"
     gene            529895..530076
                     /locus_tag="HPSH112_RS08250"
                     /pseudo
     CDS             529895..530076
                     /locus_tag="HPSH112_RS08250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001937598.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            530045..530518
                     /locus_tag="HPSH112_RS02555"
                     /old_locus_tag="HPSH112_02620"
     CDS             530045..530518
                     /locus_tag="HPSH112_RS02555"
                     /old_locus_tag="HPSH112_02620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="WP_001221189.1"
                     /translation="MRILGIDPGSRKCGYAIVSHTSNKLSLITAGFINITTTRLQEQI
                     LDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQFRGALSLKILERIGNFSEYT
                     PLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKPLDISDAIAVAITHAQRLKPH"
     gene            complement(530519..532894)
                     /locus_tag="HPSH112_RS02560"
                     /old_locus_tag="HPSH112_02625"
     CDS             complement(530519..532894)
                     /locus_tag="HPSH112_RS02560"
                     /old_locus_tag="HPSH112_02625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041199825.1"
                     /translation="MFLRSYPKLRYALCFPLLADTCYSEERTLNKVTTQAKRIFTYNN
                     EFKVTSKELDQRQSNEVKDLFRTNPDVNVGGGSVMGQKIYVRGIEDRLLRVTVDGAAQ
                     NGNIYHHQGNTVIDPGMLKSVEVTKGSANASAGPGAIAGVIKMETKGAADFIPRGKNY
                     AASGAVSFYTNFGDRETFRSAYQSAHFDIIAYYTHQNIFYYRSGATAMKNLFNPTQAD
                     KEPGTPSEQNNALVKMNGYLSDRDTLTFSWNMTRDNATRPLRSNAIGLAYPCEAPFSP
                     DSDQGCPNVLDSFTRYMYHSINSANNLSLQYKREAGNSFGDPRLDFTLYTSIRNAQFD
                     PLFDPNGVYAKFPTSQASAWEKENYPCVEGGYCTPSFSDVDKPSSQPRDLFLNNTGLN
                     LKVAHVIDEATDSLFEYGFNYQNLSVFDARIPKSELYRPNQVYTDDKGQKQIACSLVD
                     NNPNDPTLCQRGKANGNIYGGYVQANYSPHKIITFGAGVRWDAYTLYDKDWNHRYTQG
                     FSPSAALVISPIEPLSLKITYSQVTRGVMPGDGVYMRQNDLRYAKNIKPEVGSNAEFN
                     IDYSGQYFSGRAAAFYQALDNFISQYAQSLIVTNLSQAIRIYGYEVGGTFKYKGVSLN
                     VGISRTWPTTRGYLMADSYELAASTGNVFIIKLDYTIPKTGINLAWLSRFVTGLDYCG
                     FDIYLPDYGTAEKPKTPTDLAKCGSQLGLVHMHKPGYGVSNFYINWSPKTKSRWKGLL
                     LSAVFNNVFNKFYVDQTSPYVMSPDMPGTDAVKRAIAEPGFNARFEVAYKW"
     gene            533218..534744
                     /locus_tag="HPSH112_RS02565"
                     /old_locus_tag="HPSH112_02630"
     CDS             533218..534744
                     /locus_tag="HPSH112_RS02565"
                     /old_locus_tag="HPSH112_02630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase"
                     /protein_id="WP_000247325.1"
                     /translation="MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAA
                     FDRERIPERVVHAKGSGAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGEKG
                     SADAVRDPRGFAMKYYTEEGNWDLVGNNTPVFFIRDGIKFPDFIHTQKRDPQTNLPNH
                     DMVWDFWSNVPESLYQVTWVMSDRGIPKSFRHMDGFGSHTFSLINAKDERFWVKFHFH
                     TMQGVKHLTNEEAAEIRKHDPDSNQRDLFNAIARGDFPKWKLSIQVMPEEDAKKYRFH
                     PFDVTKIWYLKDYPLMEVGIVELNKNPENYFAEVEQAAFAPSNVVPGIGYSPDRMLQA
                     RLFSYTDTQRYRLGVNYPQIPVNKPRCPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYK
                     EDKSARDPKFNLAHIEKEFEVWNWDYRADDSDYYTQPGDYYRSLPADEKERLHDTIGE
                     SLAHVTHKEIVDKQLEHFKKADPKYAEGVKKALEKHQKMMKDMHDMHGKDMHHMKKKK
                     "
     gene            534895..535770
                     /locus_tag="HPSH112_RS02570"
                     /old_locus_tag="HPSH112_02635"
     CDS             534895..535770
                     /locus_tag="HPSH112_RS02570"
                     /old_locus_tag="HPSH112_02635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tat pathway signal protein"
                     /protein_id="WP_000828989.1"
                     /translation="MKRRDFIKTTALGATSAVLGAQILQAEESKGSVAKYKIEAQYSI
                     DFDSAEHTSLFIPMPSVVASNVHLQGNHASYKSMLNFGVPYLQVDFLKSAQKKQVHLS
                     YEIASYQLNERLFETSDFVAMGRYERDDASVANIANQLKGTTPKESVRNFYAFIKHEM
                     PKRQKALEGKENLPKRESLPWFATISKESMFVSLCHACGIKSAEVQGLKLAQNSVVKN
                     ASKVEVYLKDSFLAFDFQNNHKEVFIPLNRHKDMQLDSALLATFGDAFALVDGRDLGN
                     YESKLFEKRVSYTIV"
     gene            535851..536066
                     /locus_tag="HPSH112_RS02575"
                     /old_locus_tag="HPSH112_02640"
     CDS             535851..536066
                     /locus_tag="HPSH112_RS02575"
                     /old_locus_tag="HPSH112_02640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207667.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001206520.1"
                     /translation="MREFFKKLGTEYASKLFLVYWLRWMLSALVMLPFMEIFYYFNFP
                     LWLNLFLGQTIGAVIFFKLDKLIFSKK"
     gene            complement(536124..536453)
                     /locus_tag="HPSH112_RS02580"
                     /old_locus_tag="HPSH112_02645"
     CDS             complement(536124..536453)
                     /locus_tag="HPSH112_RS02580"
                     /old_locus_tag="HPSH112_02645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001153411.1"
                     /translation="MQDLPPCPKCNDAYTYHDGVQLVCSSCLHEWNENEANDEELIVK
                     DCHNNLLQNGDSVILIKDLKVKGSSLALKKGTKIKNIKLVNGDHNVDCKVEGQSLSLK
                     SEFLKKA"
     gene            536641..536808
                     /locus_tag="HPSH112_RS08255"
     CDS             536641..536808
                     /locus_tag="HPSH112_RS08255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001913119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar fermentation stimulation protein"
                     /protein_id="WP_079990334.1"
                     /translation="MVSIQKALFRNRLLKVTNKLKFVKIIIIIKDFNHYCRKITRGFV
                     KTPIKNKEQKR"
     gene            536805..537539
                     /locus_tag="HPSH112_RS02585"
                     /old_locus_tag="HPSH112_02650"
     CDS             536805..537539
                     /locus_tag="HPSH112_RS02585"
                     /old_locus_tag="HPSH112_02650"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000708937.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol diphosphatase"
                     /protein_id="WP_000708933.1"
                     /translation="MKKAGFLFLAMIAIVVMSLNAKDPNVLRKIVFEKCLPNYEKNQN
                     PSPCIEVKPDAGYVVLKDINGPLQYLLMPTTHISGIESPLLLDPSTPNFFYLSWQVRD
                     FMSKKYAKPIPDSAISLTINSHKGRSQNHFHIHISCISLEARKQLDNNLKKINSRWSP
                     LSGGLNGHKYLARRVTESELAQKSPFIMLTKEVPNARKRMGDYGLAVVQQSDNSFVLL
                     ATRFNPLTSNRASAEEIQDHECAILR"
     gene            537742..539898
                     /locus_tag="HPSH112_RS02590"
                     /old_locus_tag="HPSH112_02655"
     CDS             537742..539898
                     /locus_tag="HPSH112_RS02590"
                     /old_locus_tag="HPSH112_02655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207664.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="WP_000946422.1"
                     /translation="MLRSLWSGVNGMQAHQIALDIESNNIANVNTTGFKYSRASFVDM
                     LSQVKLIATAPYKNGLAGQNDFSVGLGVGVDATTKIFSQGNIQNTDVKTDLAIQGDGF
                     FIISPDRGITRNFTRDGEFLFDSQGSLVTTGGLVVQGWVRNGSDTGNKGSDTDALKVD
                     NTGPLENIRIDPGMVMPARASNRISMRANLNAGRHADQTAAIFALDSSAKTPSDGINP
                     VYDSSTNLTQVAEDMGSLYNEDGDALLLNENQGIWVSYKSAKMVKDILPSAENSTLEL
                     NGVKISFTNDSAVSRTSSLVAAKNAINAVKSQTGIEAYLDGKQLRLENTNELDGDEKL
                     KNIVVTQAGTGAFANFLDGDKDVTAFKYSYTHSISPNADIGQFRTTEDLRALIQHDAN
                     IVKDPSLADNYQDSAASIGVSVNQYGMFEINNKDNKNVIKENLNIFVSGYSSDSVTNN
                     VLFKNAMKGLNTASLIEGGASASSSKFTHATHATSIDVIDSLGTKHAMRIEFYRSGGA
                     EWNFRVIVPEPGELVGGSAARPNVFEGGRLRFNNDGSLAGMNPPLLQFDPKNGADAPQ
                     RINLAFGSSGSFDGLTSVDKISETYAIEQNGYQAGDLMDVRFDSDGVLLGAFSNGRTL
                     ALAQVALANFANDAGLQALGGNVFSQTGNSGQALIGAANTGRRGSISGSKLESSNVDL
                     SRSLTNLIVVQRGFQANSKAVTTSDQILNTLLNLKQ"
     gene            539957..540310
                     /locus_tag="HPSH112_RS02595"
                     /old_locus_tag="HPSH112_02660"
     CDS             539957..540310
                     /locus_tag="HPSH112_RS02595"
                     /old_locus_tag="HPSH112_02660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207663.1"
                     /note="plays a role in hydrogenase nickel cofactor
                     insertion; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation nickel metallochaperone
                     HypA"
                     /protein_id="WP_000545277.1"
                     /translation="MHEYSVVSSLIALCEEHAKKNQAHKIERVVVGIGERSAMDKSLF
                     VSAFETFREESLVCKDAILDIVDEKVELECKDCSHVFKPNALDYGACEKCHSKNVVIT
                     QGNEMRLLSLEMLAE"
     gene            540314..540775
                     /locus_tag="HPSH112_RS02600"
                     /old_locus_tag="HPSH112_02665"
     CDS             540314..540775
                     /locus_tag="HPSH112_RS02600"
                     /old_locus_tag="HPSH112_02665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207662.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001154766.1"
                     /translation="MQEELNAYQQEIKDTREVLKKIRLELKQVQEILRKKKSALKGLK
                     QEIYQKKLEKENSRLNKETQNTQEDVIFPKALEEVEIYTKDNQVIIAKPSKRVFDEGL
                     YLQYRSVLRENRFLKNHLSKKDFENSLLKIELRDLHKEIKLYQVQNLLKDK"
     gene            540775..541857
                     /locus_tag="HPSH112_RS02605"
                     /old_locus_tag="HPSH112_02670"
     CDS             540775..541857
                     /locus_tag="HPSH112_RS02605"
                     /old_locus_tag="HPSH112_02670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipid-A-disaccharide synthase"
                     /protein_id="WP_001142281.1"
                     /translation="MPTILVSALEASSNVHLEELRRNLPKDYRFIGVFEGKEALYSPR
                     EFSIMGFRDVIGRLGFLLKAHKEMVQLAKQADMVLLMDSSSFNIPLAKKIKKQDPHKK
                     IMYYILPQVWAWKKWRAKSLEKYCDFLGAILPFEVGYYQKKAQYVGHPLLDEIKYYKK
                     DIKGETLVFMPGSRKSEIAKIFPLFVKVAQILEQNEGFKRRVLVVPSFFKGLDLKALY
                     GEDIKLFEISYDAHKSLFEAEFAFICSGTATLEAALIGTPFVLAYRAKTMDFLIARMF
                     VNLHYIGLANIFYNALNNETPGLGESQLHPELIQHFLSVEGLLKAYEEMDRERYFKES
                     LRLREYLASGSARKIANGMAFLLNLT"
     gene            541898..542392
                     /locus_tag="HPSH112_RS02610"
                     /old_locus_tag="HPSH112_02675"
     CDS             541898..542392
                     /locus_tag="HPSH112_RS02610"
                     /old_locus_tag="HPSH112_02675"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor GreA"
                     /protein_id="WP_001031330.1"
                     /translation="MNKEPMSMHGYNKICAELKQLKEVERPNIVKEIDIARGHGDLKE
                     NAEYHAAKEKQRFIEARIVDLSEIIANAQVIDPSVLAHNKVSFGSTIKILNLDNDKEF
                     SYTIVGSVESDPSKGLISFGSPIAKSLIGKSKGDAVSIQLPNGESDFEILDIYYKEIC
                     FDEN"
     gene            542382..542819
                     /locus_tag="HPSH112_RS02615"
                     /old_locus_tag="HPSH112_02680"
     CDS             542382..542819
                     /locus_tag="HPSH112_RS02615"
                     /old_locus_tag="HPSH112_02680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="WP_000694157.1"
                     /translation="MKIKIQKIHPNALIPKYQTEGSSGFDLHAVEEVMIKPHSVGLVK
                     IGICLSLEVGYELQVRTRSGLALNHQVVVLNSPGTVDNDYRGEIKVILANLSDKDFKV
                     QVGDRIAQGVVQKTYKAEFIECEQLDETSRGSGGFGSTGVSKA"
     gene            542816..543472
                     /locus_tag="HPSH112_RS02620"
                     /old_locus_tag="HPSH112_02685"
     CDS             542816..543472
                     /locus_tag="HPSH112_RS02620"
                     /old_locus_tag="HPSH112_02685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000022985.1"
                     /translation="MSIKENLEQVKNEFKSDEKLLEGAFRLEKFFKRYKWVLLFIVVA
                     FIAYLGDTKLQDYKHEQTRERITQIYNEVLESPNNIALQKRLKEVAPELYDLYQFARA
                     SERNDANEFKRLSQSSNEVVKAFAKYSYASLSRDKNLLEKSPILKEMSALQEVNLLYE
                     ENSKDAIIKAHQSLSTIPISSSLYAIISVLKHYGMLEDIQQNPSKPTNLKKETIQGTH
                     "
     gene            543477..545108
                     /locus_tag="HPSH112_RS02625"
                     /old_locus_tag="HPSH112_02690"
     CDS             543477..545108
                     /locus_tag="HPSH112_RS02625"
                     /old_locus_tag="HPSH112_02690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001039570.1"
                     /translation="MNKPFLILLIALIVFSGCNMRKYFKPAKHQIKGEAYFPNHLQES
                     IVSSNRYGAILKNGAVIGDKGLTQLRIGKNFNYESSFLNESQGFFILAQDCLNKIDKK
                     TSKSKVAKTEETELKLKGVEAEVQDKVCHQVELISNNPNASQQSIIIPLETFALSASV
                     KGNLLAVVLADNSANLYDITSQKLLFSEKGSPSTTINSLMAMPIFMDTVVVFPMLDGR
                     LLVVDYVHGNPTPIRNIVISSDKFFNNITYLIVDGNNMIASTGKRILSVVSGQEFNYD
                     GDIIDLLYDKGTLYVLTLDGQILQMDKSLRELNSVKLPFASLNTIVLNHNKLYSLEKR
                     GYVIEVDLNDFNSYNVYKTPTIGSFKFFSSNRLDKGVFYDKNRVYYDRYYLDYNNFKP
                     KLYPVVEKPASEKSQKGEKGNAPIYLQERHKAKEKPLEENKVKPRNSGFEEDEVKANQ
                     RGMEPINNQNNAIQRGVKENQENKNTPASKEGNAFKEAPKLSPKEEKRRLKEEKKKAK
                     AEQRAREFEQRAREHQERDEKELEERKKALEMNKK"
     gene            545113..545784
                     /locus_tag="HPSH112_RS02630"
                     /old_locus_tag="HPSH112_02695"
     CDS             545113..545784
                     /locus_tag="HPSH112_RS02630"
                     /old_locus_tag="HPSH112_02695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III pantothenate kinase"
                     /protein_id="WP_001111528.1"
                     /translation="MPARQSFADLKNLVLCDIGNTRIHFVQNYQLFSSAKEDLKRLGI
                     QKEIFYISVNEENEKALLNCYPNAKNIAGFFHLETDYVGLGIDRQMACLAVNNGVIVD
                     AGSAITIDLIQEGKHLGGCILPGLAQYIHAYQKSAKILEQPFKALDSLEVLPKNTRDA
                     VNYGMILSVISCIQHLAKNQKIYLCGGDAKYLSAFLPHSVCKERLVFDGMEIALKKAG
                     VLECK"
     gene            545775..546512
                     /locus_tag="HPSH112_RS02635"
                     /old_locus_tag="HPSH112_02700"
     CDS             545775..546512
                     /locus_tag="HPSH112_RS02635"
                     /old_locus_tag="HPSH112_02700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001178486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001178190.1"
                     /translation="MQMMHNLSFLGMFLAALSMSLGHCVGMCGGIVSAFSQIRFSKVT
                     SFSYQLACHALYNVGRISTYMLLGAIAAGLGHSLSVSMGFRGVLFISMGIILIGLALL
                     GAKVEKLSFQIPFISFLMKKTLQSQNILGLYFLGVLNGFLPCMMVYSFLASVILSHSA
                     FMGAMLGLSFGLGTSVPLFLMGFFLSKISVSYRKFFNLLSKGLMGVFGLYILYMGIML
                     INHQNPHAIHHSSETTQHDHKGMHERH"
     gene            546499..547023
                     /locus_tag="HPSH112_RS02640"
                     /old_locus_tag="HPSH112_02705"
     CDS             546499..547023
                     /locus_tag="HPSH112_RS02640"
                     /old_locus_tag="HPSH112_02705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001276974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-glycero-beta-D-manno-heptose 1,7-bisphosphate
                     7-phosphatase"
                     /protein_id="WP_001276972.1"
                     /translation="MSATNKALFLDRDGIINIDKGYVSQKEDFEFQKGIFELLNHAKS
                     LGYKLLLITNQSGINRGYYTLKDFETLTEYLQESLLKELGFNLDGVYFCRHAPEENCA
                     CRKPKPSLILQAAKEHQICLEQSFMIGDKESDMLAGLNAKVKNNLLLTTNVLKTSHSW
                     IQCKDFKEMIDLIK"
     gene            547032..548024
                     /locus_tag="HPSH112_RS02645"
                     /old_locus_tag="HPSH112_02710"
     CDS             547032..548024
                     /locus_tag="HPSH112_RS02645"
                     /old_locus_tag="HPSH112_02710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-glyceromanno-heptose 6-epimerase"
                     /protein_id="WP_001268966.1"
                     /translation="MRYIDDELENQTILITGGAGFVGSNLAFYFQENHPKAKVVVLDK
                     FRSNTLFSNKHPSSLGHFKNLIGFKGEVVIADINNPLDLRRLEKLHFDYLFHQAAISD
                     TTMLDQELVMKTNYQAFLNLLEIARPKKTKVIYASSAGVYGNTKAPNVVGKNESPENV
                     YGFSKLCMDEFVLSHSNDNIQVGLRYFNVYGPREFYKEKTASMVLQLALGIMAFKEVK
                     LFEFGEQLRDFVYIEDVIQANVKAMKAQKSGVYNVGYSQARSYNEIVSILKEHLGDFK
                     VTYIKNPYAFFQNHTQAHIEPTILDLDYTPLYDLESGIKDYLPHIHAIFKEQRA"
     gene            548021..549412
                     /locus_tag="HPSH112_RS02650"
                     /old_locus_tag="HPSH112_02715"
     CDS             548021..549412
                     /locus_tag="HPSH112_RS02650"
                     /old_locus_tag="HPSH112_02715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207652.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional heptose 7-phosphate kinase/heptose
                     1-phosphate adenyltransferase"
                     /protein_id="WP_000809666.1"
                     /translation="MKQILVVGDLIADYYLWGRSERLSPEAPVPVLEVQRESKNLGGA
                     ANVANNLTSLKAKVFLCGVVGDDLEGEHFINALKARNIDTSGILTDKTRCTTLKTRII
                     AQNQQIARVDKEIKDPLNADLRKKLLDFFTEKIQEIDGVILSDYNKGVLDFELTQKMI
                     ALANKHHKLILCDPKGKDYSKYAHASLITPNRIELEQALHLKLDSHANLSKALRILKE
                     TYHIAMPLVTLSEQGIAFLEKGELVNCPTIAKEVYDVTGAGDTVIASLTLSLLESMSL
                     KEACEFANAAAAVVVGKMGSALASLEEIALILNQTHPKILPLEKLLETLERHQQKIVF
                     TNGCFDILHKGHASYLQKAKALGDILIVGLNSDASVKRLKGDKRPIVSEKDRAFLLAS
                     LSCVDYVVVFEEDTPIKLIQALKPDILVKGADYLNKEVIGSEFAKETRLMEFEEGYST
                     SAIIEKIKRTCND"
     gene            549405..549983
                     /locus_tag="HPSH112_RS02655"
                     /old_locus_tag="HPSH112_02720"
     CDS             549405..549983
                     /locus_tag="HPSH112_RS02655"
                     /old_locus_tag="HPSH112_02720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoheptose isomerase"
                     /protein_id="WP_000565148.1"
                     /translation="MIDGLIKKEFLAHKEALEKSLESLQEALKESVHLLIETLENQGK
                     ILICGNGGSASDAQHFAAELTGRYKLERKGLSALSLSTDTSALTAIANDYGYEEVFAR
                     QVEALGVKNDVLIGISTSGNSKNVLKAYEKAKDLGVKTLSLAGRDGGKMKPLSDMALI
                     VPSDDTPRIQEMHILMIHILCDCIERHFANKN"
     gene            complement(550082..551065)
                     /locus_tag="HPSH112_RS02660"
                     /old_locus_tag="HPSH112_02725"
     CDS             complement(550082..551065)
                     /locus_tag="HPSH112_RS02660"
                     /old_locus_tag="HPSH112_02725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GMP reductase"
                     /protein_id="WP_080024698.1"
                     /translation="MSLKIFDYENIQLIPNKCIVNSRSECDTTVTLGKHAFKMPVVPA
                     NMQTIINDSIAEFLAENGYFYIMHRFDGAARIPFVKKMKGRQWISSISVGVKKEEYLF
                     IEELAKQKLASDYITIDIAHGHSNSVIEMIQHIKTHFPETFVIAGNVGTPEAVRELEN
                     AGADATKVGIGPGKACITKIKTGFGTGGWQLAALIWCAKAARKPIIADGGIRTHGDIA
                     KSIRFGATMVMIGSLFAGHEESSGETKIENGIAYKEYFGSASEFQKGEKKNIEGKKIW
                     IQHKGSLKDTLIEMHQDLQSSISYAGGRDLEAIRKVDYVIVKNSIFNGDAI"
     gene            551308..552909
                     /locus_tag="HPSH112_RS02665"
                     /old_locus_tag="HPSH112_02730"
     CDS             551308..552909
                     /locus_tag="HPSH112_RS02665"
                     /old_locus_tag="HPSH112_02730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207647.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000942161.1"
                     /translation="MLQTINLTQRYATKKLFENVNIKLDKNKRYGLIGANGAGKSTFL
                     KILSKSIDCSSGEVIITSGMRMGVLGQDQYAFEDLSLKDAVLIGNKRLYDAIKEKERL
                     YTEGDLSDDKVNARLGELETICVEEDPMYECEVVIEKILEDLGIPSSRHNDLMKTLPS
                     SDKFKILLAQVLFPKPDILLLDEPTNNLDLNAIEWLENNLKRHEGTMVVISHDRHFLN
                     AVCTHILDLDFHSVREFSGNYDDWYIASTLMIKQQEAERNKKLKEKEELEKFIARFSA
                     NASKAKQATSRQKQLDKLDIQSLAVSSRRDPSIIFKPKRTIGNEALECENISKSYDGQ
                     IVLNQVSLKVMPKDKIALIGPNGVGKSTLCKILVEELKPDTGVVKWGATVSKGYFPQN
                     VSEEISGEETLYQWLFNFNKKIESAEVRNALGRMLFNGEEQEKCVNALSGGEKHRMVL
                     SKLMLEGGNFLVLDEPTNHLDLEAIIALGEALFKFDGALICISHDRELIDAYANRIIE
                     LVPSPKGASIIDFKGSYEEYLASKK"
     gene            552906..553838
                     /locus_tag="HPSH112_RS02670"
                     /old_locus_tag="HPSH112_02735"
     CDS             552906..553838
                     /locus_tag="HPSH112_RS02670"
                     /old_locus_tag="HPSH112_02735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000804222.1"
                     /translation="MKPQDIGIIQSVLEIIKEPIKVTEVYDKTQELFEKGEIENMFDY
                     GGNTPDQSVSAAIYTALNKGEELPFLKTQEKPVLIALKDAAKEPVLNAQKSSVPGVKI
                     VHERDLHPFLTYMACYNENLKCYTKTIFHEGSSKSPKGMDRWLYPDMVGVRFLHAELS
                     NENLIAFSKKFDTLPVKLVSFELKKEISVNNCRECYFQAISNSSWANEGYLVGHHIDT
                     HNPKLMDLLKRLHASFGIGVIDLRTNEDKSAILLNAKYKEKIDYTVALELSEKNEEFS
                     GFLKSVVDYDPNHQHRYKDEFDEIKKKEELYPNA"
     gene            complement(553867..554544)
                     /locus_tag="HPSH112_RS02675"
                     /old_locus_tag="HPSH112_02740"
     CDS             complement(553867..554544)
                     /locus_tag="HPSH112_RS02675"
                     /old_locus_tag="HPSH112_02740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase PAP2 family protein"
                     /protein_id="WP_000230847.1"
                     /translation="MVFDRTISVREKKAAKTLGIVGVVFFILFGIVISGVAFQKEWVQ
                     QLDLFFIDLIRNPAPIQGSAWLSFVFLSTWFAQSKLTTSIALLISLWFGFQKRIALAL
                     WFFPSILLGEITLKLLKHLVARPRPVTNGELAFAHNFSFPSGHALASALFYGSLALLL
                     CYSNANARIKTIGAIILFFWIFLMAYDRVYLGVHYPSDVLGGFLLGIAWSCCSLALYL
                     GFLKRPY"
     gene            complement(554711..555664)
                     /locus_tag="HPSH112_RS02680"
                     /old_locus_tag="HPSH112_02745"
     CDS             complement(554711..555664)
                     /locus_tag="HPSH112_RS02680"
                     /old_locus_tag="HPSH112_02745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017282352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction endonuclease"
                     /protein_id="WP_001281076.1"
                     /translation="MSDKSNNQGRAYEYAWCLALEQKLSVFKKVIVDKQNGFNACYRA
                     YESLEKSLQDRYLESAKQGVLLLLDCEPLLNEVIESSQNEITLSLQKDKLGEIGDIRD
                     ILIYFDRFCIGLSIKHNHDAVKHSRLSKDLDFGKKWLGVGVSQNYKDTIKPLFERLEN
                     AKKEGMLWRDFPNKEQEIYAPLLQAFKKEVLRIDENKKNKVPQKMVEYLLGKYDFYKA
                     ILLEREQKTKLEAYHFNNTLNRSVKNKPKRIIPLSKLPTRMIYFDFKPKSFNTLELVL
                     DEGWSFSLRIHNASSRVEPSLKFDIKLLSKPESVAVFIVGF"
     gene            complement(555661..556644)
                     /locus_tag="HPSH112_RS02685"
                     /old_locus_tag="HPSH112_02750"
     CDS             complement(555661..556644)
                     /locus_tag="HPSH112_RS02685"
                     /old_locus_tag="HPSH112_02750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001050906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA (cytosine-5-)-methyltransferase"
                     /protein_id="WP_001050902.1"
                     /translation="MNLLSLFAGAGGLDLGFEKAGFKIVVANEYDKNITPTYRLNHKN
                     TRLLEKDIKNLQTSEINFSVDGIIGGPPCQSWSEAGNLKGIDDARGQLFYEYLRLLRE
                     LKPKFFLAENVRGMLAQRHETSVKNILNAFKECGYEVNTHLVNAKDYGVAQERLRVFY
                     IGFRKDLKINYIFPKGSTHLKKLTLKDVIWDLKDSVVCALAKNKRNPNAINNHEYFIG
                     SYSPIFMSRNRVKNWDEQAFTIQASGRQCQLHPQAPKMAKFGKNDCRFIENYQHLYRR
                     LSVRECARIQGFDDDFYFVYENLNDAYKMIGNAVPVSLAKEIAVSIYKALY"
     gene            556828..557193
                     /locus_tag="HPSH112_RS02690"
                     /old_locus_tag="HPSH112_02755"
     CDS             556828..557193
                     /locus_tag="HPSH112_RS02690"
                     /old_locus_tag="HPSH112_02755"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000428574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease subunit M"
                     /protein_id="WP_000428574.1"
                     /translation="MENKNTQADKSSSLERNELHNTIWKVANELRGSVDGWDFKQYVL
                     GILFYRYISENMAHYINKEERKRDPSFDYAKLSDEEAESAKEGLIEEKGFFIPPSALA
                     AFFSLTLMSNTIQTPKNDL"
     gene            557372..558151
                     /locus_tag="HPSH112_RS02700"
                     /old_locus_tag="HPSH112_02760"
     CDS             557372..558151
                     /locus_tag="HPSH112_RS02700"
                     /old_locus_tag="HPSH112_02760"
                     /EC_number="2.7.1.50"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000910648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxyethylthiazole kinase"
                     /protein_id="WP_014662217.1"
                     /translation="MLKELRQKRPLVHNITNYVVAQFVANGLLALGASPLMSDAIAEM
                     QDLAKISDALAINIGTLNERTILCAKEAIKHYKALNKPIVLDPVGCSASALRHGTSLE
                     LLESEGISVLRGNAAELGSLVGISCGSKGLDSHYATTPIEIVKLAAQKYFVIAVMTGK
                     TDYVSDGKKVFSITGGSEYLALITGAGCLHTAACASFLSLKKDPLDSMVQLCALYKQA
                     AFNAQKKVSENNGSNGSFLFYFLDALSLPIKLENSLIKEEL"
     gene            558148..558957
                     /locus_tag="HPSH112_RS02705"
                     /old_locus_tag="HPSH112_02765"
     CDS             558148..558957
                     /locus_tag="HPSH112_RS02705"
                     /old_locus_tag="HPSH112_02765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000708560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylpyrimidine/phosphomethylpyrimidine
                     kinase"
                     /protein_id="WP_000708610.1"
                     /translation="MKIYPQVLSIAGSDSGGGAGIQADLKAFQTLGVFGTSVITCITA
                     QNTQGVHGVYPLSVESVRAQILAIRDDFSIKAFKMGALCNAQIIECVADTLKTCDFGL
                     CVLDPVMVAKNGALLLEEEAILSLKKRLLPKTHLLTPNLPEVYALTGVQVRDNKSASK
                     AMGILRDLGVKNAVIKGGHTEHFQGEFSNDWVFLEDAEFILNAKRFNTKNTHGTGCVL
                     SSLIVGLLAQGLDLKNAISKAKELLTIIIQNPLNIGHGHGPLNLWSIKELV"
     gene            558950..559609
                     /locus_tag="HPSH112_RS02710"
                     /old_locus_tag="HPSH112_02770"
     CDS             558950..559609
                     /locus_tag="HPSH112_RS02710"
                     /old_locus_tag="HPSH112_02770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine phosphate synthase"
                     /protein_id="WP_000458999.1"
                     /translation="MFDANCLKLMFVAGSQDFYHIKGGKNDRINALLDALELALQSKI
                     TAFQFRQKGDLSLQDPIEIKQLALKCQKLCQKYGAPFIVNDEVQLALELKADGVHVGQ
                     EDMAIEEVMTLCKKCLFIGLSVNTLEQALKARHLDGVAYFGVGPIFPTQSKKDKQVVG
                     VELLKKIKDRGIKKPLIAIGGITTHNASKLREYGGIAVISAITQAKDKALAVGKLLND
                     A"
     gene            complement(559664..560401)
                     /locus_tag="HPSH112_RS02715"
                     /old_locus_tag="HPSH112_02775"
     CDS             complement(559664..560401)
                     /locus_tag="HPSH112_RS02715"
                     /old_locus_tag="HPSH112_02775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000888370.1"
                     /translation="MLEALNAINQLNALHSKNAVHHFNATLPILLKVLEKQDKDLFLL
                     QVGNRIIPTKSEQELKINQPYFATMQRNQLGDIVLKNLVPAPKILDALDDLSALEMKK
                     IKEILSAKDNTPLKEYKELLSEKLIHAKNPQEFLNTANMLLSLQSQVLSFVIENERKK
                     AFLQVKAKKQSVDFYALYPNLGEIGGVIYLKEKEKQLFLKTSLQRTKEILKEAQNTLL
                     GFSSVEIACEKTPMLFAFEERLLDTIG"
     gene            complement(560401..561678)
                     /locus_tag="HPSH112_RS02720"
                     /old_locus_tag="HPSH112_02780"
     CDS             complement(560401..561678)
                     /locus_tag="HPSH112_RS02720"
                     /old_locus_tag="HPSH112_02780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantothenate synthase"
                     /protein_id="WP_001010002.1"
                     /translation="MNFLEDLFYPLRLLENKRVLLLVSGSIAAYKSLELVRLLFKSGA
                     SVQVVMSEGAKKFVTPLSFEALSHHKVLHDHNEKWYYNHQNALHHNHIACAANADLLI
                     FAPLSANSLSKIAHALADNIISATFLACASPKILAPSMNTNMLNSPIIQSHLKRLKDS
                     NHIILDTQNGLLACDTKGDGAMAEPLEILFKATQTLLKDAYFENREVIIMGGASVEKI
                     DSVRTISNLSSGIQASALALALYFKGAKVTLIASNFPTPLPKEIASVPVSDTKSYENA
                     LNNAANNMQKHALKPLLFNLAAISDYVPKTSFNHKLKKSELGETLNIECVQNKDLLAS
                     INPNQFVKIGFKAEDDQQNAIKNAQNLLKPSQDNGKDCSMVALNLIKDSRPFGSLENE
                     LWLFSHHKTQKIPSMNKLEASFKILDFIKDNAL"
     gene            complement(561675..562658)
                     /locus_tag="HPSH112_RS02725"
                     /old_locus_tag="HPSH112_02785"
     CDS             complement(561675..562658)
                     /locus_tag="HPSH112_RS02725"
                     /old_locus_tag="HPSH112_02785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000886525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase
                     (inverting)"
                     /protein_id="WP_000886571.1"
                     /translation="MLDNQTILITGGTGSFGKRFARKVLDTTNAKKIIVYSRDELKQS
                     EMAMEFNDPRMRFFIGDVRDLERLNYALEGVDICIHAAALKHVPIAEYNPLECIKTNI
                     MGASNVINACLKNEVSQVIALSTDKAANPINLYGATKLCSDKLFVSANNFKGSSQTQF
                     GVVRYGNVVGSRGSVVPFFKKLIQNKASEIPITDIRMTRFWITLDEGVSFVLKSLKRM
                     HGGEIFVPKIPSMKMTDLAKALAPNTPIKIIGIRPGEKLHEVMIPKDESHLALEFEDF
                     FIIQPTISFQTPKDYTLTKLHEKGHKVAPDFEYSSHNNSKWLEPDDLLKLL"
     gene            complement(562662..564425)
                     /locus_tag="HPSH112_RS02730"
                     /old_locus_tag="HPSH112_02790"
     CDS             complement(562662..564425)
                     /locus_tag="HPSH112_RS02730"
                     /old_locus_tag="HPSH112_02790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207632.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000788073.1"
                     /translation="MKNFSPLYFLKKFKKRHLIAWSLPLLSYANGFKIQEQSLNGTAL
                     GSAYVAGARGADASFYNPANMGFTNDWGENRSEFEMTTTVINIPAFSFKVPTTNQGLY
                     SVTSLEIDKSQQNILGIINTIGLGNILKALGNTAATNGLQQAFNRIQGLMNLTNQKVV
                     TLASSPDTQIVNGWTGTTNFVLPKFFYKTRTHNGFTFGGSFSAPSGLGMKWNGKGGEF
                     LHDVFIMMVELAPSMSYTVNKRFSVGVGLRGLYATGSFNNTVYVPLEGASVLSAEQIL
                     NLPNNVFADQVPSNMMALLGNIGYQPALNCQKAGGDMSDQSCQEFYNGLKKIMGYSGL
                     VKASANLYGTTQVVQKSNGQGVSGGYRVGSSLRIFDHGMFSVVYNSSVTFNMKGDLVA
                     ITELGPSLGSVLTKGSLNINVSLPQTLSLAYAHQFFKDHLRIEGVFERTFWSQGNKFL
                     VTPDFANATYKGLSGTVASLDSETLKKMVGLANFKSVMNMGAGWRDTNTFRLGVTYMG
                     KSLRLMGAIDYDQAPSPQDAIGIPDSNGYTVAFGTKYNFRGFDLGVAGSFTFKSNRSS
                     LYQSPNIGQLRIFSASLGYRW"
     gene            complement(564422..565039)
                     /locus_tag="HPSH112_RS02735"
                     /old_locus_tag="HPSH112_02795"
     CDS             complement(564422..565039)
                     /locus_tag="HPSH112_RS02735"
                     /old_locus_tag="HPSH112_02795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001268753.1"
                     /translation="MRYFRSVFSLFFMTLFFISCSKHPFHKQTPKTREQIRQEEARKK
                     REETLNALRQFRLIYINTPVFRFYDYGTIKTDKDHNIEITLYKLSQRVGDIYMTKRNI
                     CFSQKCSAKWIVARDLFGKVSYGDLFDDIVLGRDIFKGLGKRHLTPEYVIQRFQKSGE
                     IILYERKNGLISFQNLTQKIAIRIEPYEPSLQDLEDNENADSELQ"
     gene            complement(565058..565663)
                     /locus_tag="HPSH112_RS02740"
                     /old_locus_tag="HPSH112_02800"
     CDS             complement(565058..565663)
                     /locus_tag="HPSH112_RS02740"
                     /old_locus_tag="HPSH112_02800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001236579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001236594.1"
                     /translation="MRLHTAFFGINSLLVAALLISGCSLFKKRNTNAQLIPPSANGLQ
                     APIYPPTNFTPRKSIQPLPSPRLENNDQPIISSNPTNAIPNTPILTPNNVIELNAVGM
                     GVAPESTISPSQALALAKRAAIVDGYRQLGEKMYGIRVNAQDTVKDMVLQNSVIKTRV
                     NALIRNAEITETIYKDGLCQVSMELKLDGRIWYRILSGARG"
     gene            complement(566201..566277)
                     /locus_tag="HPSH112_RS02745"
                     /old_locus_tag="HPSH112_t08206"
     tRNA            complement(566201..566277)
                     /locus_tag="HPSH112_RS02745"
                     /old_locus_tag="HPSH112_t08206"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(566241..566243),aa:Arg,seq:cct)
     gene            complement(566335..566619)
                     /locus_tag="HPSH112_RS02750"
                     /old_locus_tag="HPSH112_02810"
     CDS             complement(566335..566619)
                     /locus_tag="HPSH112_RS02750"
                     /old_locus_tag="HPSH112_02810"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_001029061.1"
                     /translation="MNKAEFIDLVKEAGKYNSKREAEEAINAFTLAVETALSKGESVE
                     LIGFGKFETAEQKGKEGKVPGSDKTYKTEDKRVPKFKPGKILKQKVEEGK"
     gene            complement(566760..568145)
                     /locus_tag="HPSH112_RS02755"
                     /old_locus_tag="HPSH112_02815"
     CDS             complement(566760..568145)
                     /locus_tag="HPSH112_RS02755"
                     /old_locus_tag="HPSH112_02815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207627.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase Der"
                     /protein_id="WP_001097836.1"
                     /translation="MNTSHKTLKTIAILGQPNVGKSSLFNRLARERIAITSDFAGTTR
                     DINKRKIALNGHEVELLDTGGMAKDALLSKEIKALNLKAAQMSDLILYVVDGKSIPSD
                     EDLKLFREVFKTNPNCFLVINKIDNDKEKERAYAFSSFGMPKSFNISVSHNRGIGALI
                     DAILSALDLNQIIEQDLDADILESLENNAPKEETKEEEIIQVGIIGRVNVGKSSLLNA
                     LTKKERSLVSSVAGTTIDPIDETILIGDQKICFVDTAGIRHRGKILGIEKYALERTQK
                     ALEKSHITLLVLDVSAPFVELDEKISSLADKHSLGIILILNKWDIRYAPYEEIMATLK
                     RKFRFLEYAPVITTSCLKARHIDEIKHKIIEVYECFSKRIPTSLLNSVINQATQKHPL
                     PSDGGKLVKVYYATQFATKPPQISLIMNRPKALHFSYKRYLINTLRKEFNFLGTPLIL
                     NAKDKKSAQQN"
     gene            568222..569106
                     /locus_tag="HPSH112_RS02760"
                     /old_locus_tag="HPSH112_02820"
     CDS             568222..569106
                     /locus_tag="HPSH112_RS02760"
                     /old_locus_tag="HPSH112_02820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000480395.1"
                     /translation="MFLVKKIGVVVVVLIGFLACSQERFIQLQKKAQEQENDGSKRPS
                     YVDSDYEVFSETIFLQNMVHQPTEERDALAQLTKDEDDFFNPETSVILLNEPSDNDTK
                     NPPLNQNESDNNTNTANNDAKNPFLYKPKRKTKDPKLIEYSQQNFYPLKDGDIMMSKE
                     GDQWLIEIKSKALKRFLKDQNDKDRQIQTFTFNDTKTQIAQFKGKISSYVYTTNNSDL
                     SLRPFYESFLLEKKSDDFYTIGDKALDAIEIQKCQMVLKKHSTDKLDSQHKAISIDLD
                     FKKERFKSDTELFLECQS"
     gene            569196..569984
                     /gene="speE"
                     /locus_tag="HPSH112_RS02765"
                     /old_locus_tag="HPSH112_02825"
     CDS             569196..569984
                     /gene="speE"
                     /locus_tag="HPSH112_RS02765"
                     /old_locus_tag="HPSH112_02825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207625.1"
                     /note="catalyzes the formation of spermidine from
                     putrescine and S-adenosylmethioninamine; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="WP_000265051.1"
                     /translation="MWITQEITPYLRKEYTIEAKLLDVRSEHNILEIFKSKDFGEIAM
                     LNCQLLFKNFLHIESELLAHMGGCTKKELKEVLIVDGFDLELAHQLFKYDTHIDFVQA
                     DEKILDSFISFFPHFHEVKNNKNFTHAKQLLDLDIKKYDLILCLQEPDIHKMDGLKRM
                     LKEDGVFISVAKHPLLEHVSMQNALKNMGEFFSVAMPFVAPLRILSNKGYIYASFKTH
                     PLKDLMAPKIEALKSVRYYNEDIHRAAFALPKNLQEVLKDNIKS"
     gene            569986..570576
                     /locus_tag="HPSH112_RS02770"
                     /old_locus_tag="HPSH112_02830"
     CDS             569986..570576
                     /locus_tag="HPSH112_RS02770"
                     /old_locus_tag="HPSH112_02830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_000243306.1"
                     /translation="MVLKNAIALTGGIGTGKSTTIKILESQGYQILDADKIAHQLLQE
                     HRFKIAQHFGSDILEKDILNRKKLGVIVFQNANELKWLEDFLHPLIRERMLKKAYELE
                     KNHQAYFLDIPLFFEVGGKKCYPVSKVVLIYAPRALQIERLLERDKLKEAEILQRLAC
                     QMDIEQKRAMSDCIIDNSSSLKDLNKQVERFLKTLL"
     gene            570635..571996
                     /locus_tag="HPSH112_RS02775"
                     /old_locus_tag="HPSH112_02835"
     CDS             570635..571996
                     /locus_tag="HPSH112_RS02775"
                     /old_locus_tag="HPSH112_02835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutaminyl-tRNA synthase (glutamine-hydrolyzing)
                     subunit A"
                     /protein_id="WP_000631528.1"
                     /translation="MITLKQALSLSQDELETLKNEIDAKVRASDLNAYIKAPSLNGTS
                     AKGVPILIKDNISVKGWEVTCSSKILEGYIAPYHASVIENLHQNSMAGFGLSNMDEFA
                     MGSTTESSCYGITKNPRDKNRVPGGSSGGSAAAVAGGLAVAALGSDTGGSIRQPASYC
                     GCVGLKPTYGRVSRYGLIAYCSSFDQIGPITQNVEDASILFDAISGHDSKDSTSANLK
                     PTQTFKNLNREKRFKIAILRDHIKDASNEVQLAYENTLKALKEMGHEIVEKRMLDSHY
                     QISIYYIISMAEASSNLARFDGVRYGRRAQNIKDLKELYLKSRSEGFGDEVKRRIMLG
                     NFVLSSGYYDAYYLKAQQMRLMIKEQYNKIFEEVDLIFTPVAPTSAHLFNYHASPLEM
                     YLSDIYTIGANLSGLPALSLPVAKDPLGLPIGMQFIAKAFDEQSLLDVSYALEQELDL
                     KLD"
     gene            572006..573451
                     /locus_tag="HPSH112_RS02780"
                     /old_locus_tag="HPSH112_02840"
     CDS             572006..573451
                     /locus_tag="HPSH112_RS02780"
                     /old_locus_tag="HPSH112_02840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_001221749.1"
                     /translation="MRILQRALTFEDVLMVPRKSSVLPKDVSLKSRLTKNISLNIPFI
                     SAAMDTVTEHKTAIAMARLGGIGIVHKNMDIQTQVKEITKVKKSESGVINDPIFIHAH
                     RTLADAKVITDNYKISGVPVVDDKGLLIGILTNRDVRFETDLSKKVGDVMTKMPLVTA
                     RVGISLDEASDLMHKHKIEKLPIVDKDNVLKGLITIKDIQKRIEYPEANKDDFGRLRV
                     GAAIGVGQLDRAEMLVKAGVDALVLDSAHGHSANILHTLEEIKKSLVVDVIVGNVVTK
                     EATSDLISAGADAVKVGIGPGSICTTRIVAGVGMPQVSAIDNCVEVASKFDIPVIADG
                     GIRYSGDVAKALALGASSVMIGSLLAGTEESPGDFMIYQGRQYKSYRGMGSIGAMTKG
                     SSDRYFQEGVASEKLVPEGIEGRVPYRGKVSDMIFQLVGGVRSSMGYQGAKNILELYQ
                     NAEFVEITSAGLKESHVHGVDITKEAPNYYG"
     gene            573573..574253
                     /locus_tag="HPSH112_RS02785"
                     /old_locus_tag="HPSH112_02845"
     CDS             573573..574253
                     /locus_tag="HPSH112_RS02785"
                     /old_locus_tag="HPSH112_02845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit A"
                     /protein_id="WP_000401225.1"
                     /translation="MEHRVFTIANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQM
                     VPMGLQNVYESIISAILSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPGFESP
                     TASWSFTLVLALIVFFYYHFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRI
                     VSLSFRLFGNIKGDDMFLLIMLLLVPWAVPVAPFMVLFFMGILQAFVFMILTYVYLAG
                     AVLTDEGH"
     gene            574571..574819
                     /locus_tag="HPSH112_RS02790"
                     /old_locus_tag="HPSH112_02850"
     CDS             574571..574819
                     /locus_tag="HPSH112_RS02790"
                     /old_locus_tag="HPSH112_02850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000790556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein"
                     /protein_id="WP_000790556.1"
                     /translation="MKNIYVGNLVYSATSEQVKELFSQFGKVFNVKLIYDRETKKPKG
                     FGFVEMQEEGVSEAIAKLDNTDFMGRTIRVTEANPKKF"
     gene            complement(575021..575842)
                     /locus_tag="HPSH112_RS02795"
                     /old_locus_tag="HPSH112_02855"
     CDS             complement(575021..575842)
                     /locus_tag="HPSH112_RS02795"
                     /old_locus_tag="HPSH112_02855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipooligosaccharide 5G8 epitope
                     biosynthesis-associated protein (lex2B)"
                     /protein_id="WP_001263421.1"
                     /translation="MRVFIISLNQKVCDQFGLVFRDTTTLLHNINATHHKAQIFDAIY
                     SKTFEGELHPLVKKHLHPYFITQNIKDMGITTNLISRVSKFYYALKYYAKFMSLGELG
                     CYASHYSLWEKCIELNEPVCILEDDITLKENFKEGLDFLEKHIQELGYARLMHLLYDA
                     SVRSEPLNHKNHEIQERVGIIKAYSHGVGTQGYVITPKIAKVFKKCSRKWVVPVDTIM
                     DATFIHGVKNLVLQPFVIADDEQISTIARKEEPYSPKIALMRKLHFKYLKYWQFV"
     gene            complement(576009..576944)
                     /locus_tag="HPSH112_RS02800"
                     /old_locus_tag="HPSH112_02860"
     CDS             complement(576009..576944)
                     /locus_tag="HPSH112_RS02800"
                     /old_locus_tag="HPSH112_02860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin-disulfide reductase"
                     /protein_id="WP_000564371.1"
                     /translation="MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSS
                     EIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMSAIQRVSKKDSHFVILAEDGKTFE
                     ANSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAI
                     YLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIK
                     NTATNETRELIVPGFFIFVGYDVNNAVLKQEDGSMLCKCDEYGSIVVDFSMKTNVQGL
                     FAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH"
     gene            complement(576950..577270)
                     /locus_tag="HPSH112_RS02805"
                     /old_locus_tag="HPSH112_02865"
     CDS             complement(576950..577270)
                     /locus_tag="HPSH112_RS02805"
                     /old_locus_tag="HPSH112_02865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207617.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiol reductase thioredoxin"
                     /protein_id="WP_000020197.1"
                     /translation="MSHYIELTEENFESTIKKGVALVDFWAPWCGPCKMLSPVIDELA
                     SEYEDKAKICKVNTDEQEELSAKFGIRSIPTLLFTKDGEVVHQLVGVQTKVALKEQLN
                     KLLG"
     gene            complement(577359..577703)
                     /locus_tag="HPSH112_RS02810"
                     /old_locus_tag="HPSH112_02870"
     CDS             complement(577359..577703)
                     /locus_tag="HPSH112_RS02810"
                     /old_locus_tag="HPSH112_02870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001211675.1"
                     /translation="MRFLNNKHRAKGLKAEEEACEFLKTLGFEMVERNFFSKFGEIDI
                     IALKKGVLHFIEVKSGENFDPIYAITPSKLKKMIKTIRCYLSQKDPNSDFCIDALIVK
                     NGNFELLENITF"
     gene            complement(577704..578969)
                     /locus_tag="HPSH112_RS02815"
                     /old_locus_tag="HPSH112_02875"
     CDS             complement(577704..578969)
                     /locus_tag="HPSH112_RS02815"
                     /old_locus_tag="HPSH112_02875"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine dehydrogenase"
                     /protein_id="WP_000746802.1"
                     /translation="MKKRLNIGLVGLGCVGSAVAKILQENQEIIKDRAGVEIMIKKAV
                     VRDVKKRKGYPFEISNDLESLIEDEEIDIVVELMGGVEAPYLLAKKTLAKQKAFVTAN
                     KAMLAYHRYELEQIAKNTPIGFEASVCGGIPIIKALKDGLSANHILSFKGILNGTSNY
                     ILSQMFKNQASFKDALKDAQHLGYAELNPEFDIKGIDAAHKLLILASLAYGIDAKLEE
                     ILIEGIEKIEPDDMEFAKEFGYSIKLLGIAKKHQDCIELRVHPSMIKNECMLSKVDGV
                     MNAISVIGDKVGETLYYGAGAGGEPTASAVISDIIEIARKKSSLMLGFETPQKLPLKP
                     KEEIQCAYYARLLVSDEKGVFSQISAILAQNDISLNNVLQKEIPHSNKAKILFSTHTT
                     NEKSMLNALKELENLKSVLDTPKMIRLEH"
     gene            complement(578980..580764)
                     /locus_tag="HPSH112_RS02820"
                     /old_locus_tag="HPSH112_02880"
     CDS             complement(578980..580764)
                     /locus_tag="HPSH112_RS02820"
                     /old_locus_tag="HPSH112_02880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="WP_000774345.1"
                     /translation="MADLLSSLKNLSHSSGVYQYFDKNHQLLYIGKAKNLKKRIKSYF
                     SVRNNEITPNYRTSLRIQMMVKQIAFLETILVENEQDALILENSLIKQLKPKYNILLR
                     DDKTYPYIYMDFSTDFPIPLITRKILKQPGVKYFGPFTSGAKDILDSLYELLPLVQKK
                     NCIKDKKACMFYQIERCKAPCENKITKEEYLKIAKECLEMIENKDKLIKELELKMERL
                     SNNLRFEEALIYRDRIAKIQKIAPFTCMDLAKLYDLDIFAFYGKGNKAVLVKMFMRRG
                     KIISSSFEKIHSLNGFDTDEAMKQAIINHYQSHLPLIPEQILLNACSNETLKELQEFI
                     SHRYSKKIALSIPKKGDKLALIEIAMKNAQEIFSQEKTSNEDLILEEARSLFKLECMP
                     YRVEIFDTSHHANSQCVGGMVVYENHAFQKNSYRRYHLKGSNEYTQMSELLTRRALDF
                     AKEPPPNLWVIDGGRAQLNIALEILKSSGSFVEVIAISKEKRDSKAYRSKGGAKDIIH
                     TASDTFKLLPSDKRLQWVQKLRDESHRYAINFHRSTKLKNMKQIALLKEKGIGEASVK
                     KLLDYFGSFEAIEKASEQEKNAVLKKRI"
     gene            complement(580765..581226)
                     /locus_tag="HPSH112_RS02825"
                     /old_locus_tag="HPSH112_02885"
     CDS             complement(580765..581226)
                     /locus_tag="HPSH112_RS02825"
                     /old_locus_tag="HPSH112_02885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000437151.1"
                     /translation="MEQNIFSLLIQKKSYKKLETLLKLKKLKVFMPLSLQENLLFIFI
                     KDSKLLFAFKDLWASKEFNQRFAKEISHFLNAQGHAYGFDGLNGLEILGYVPKDSLEK
                     ANFYAPIKKQARFYRPSALGLFHNPIKDARLHECFEKARALIHYQRSFFEE"
     gene            581218..581397
                     /locus_tag="HPSH112_RS02830"
                     /old_locus_tag="HPSH112_02890"
     CDS             581218..581397
                     /locus_tag="HPSH112_RS02830"
                     /old_locus_tag="HPSH112_02890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_009112936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000468794.1"
                     /translation="MFHKLILTCFLTLVAITIQACGYKAPPFNEKPAKKTSNSSNSSM
                     QTPTNNTTPEFLNQP"
     gene            complement(581409..582050)
                     /locus_tag="HPSH112_RS02835"
                     /old_locus_tag="HPSH112_02895"
     CDS             complement(581409..582050)
                     /locus_tag="HPSH112_RS02835"
                     /old_locus_tag="HPSH112_02895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="osmoprotection protein (proV)"
                     /protein_id="WP_000659419.1"
                     /translation="MKEIVTIENVSFNYHNRAVFKDFNLNIQEGDFLCVLGESGSGKS
                     TLLGLILGLLKPSLGSVKIFNETLSNNAFLRQKIGYIAQGNSLFSHLNALQNMTFCLN
                     LQGMDKESAQKEAKALALKMGLEESLMDKFPNELSGGQAQRVGIIRGIIHRPELILLD
                     EPFSALDSFNRKNLQDLIKEIHQNSHATFIMVTHDESEAQKLATKTLEIKALK"
     gene            complement(582052..>582849)
                     /locus_tag="HPSH112_RS02840"
                     /old_locus_tag="HPSH112_02900"
                     /pseudo
     CDS             complement(582052..>582849)
                     /locus_tag="HPSH112_RS02840"
                     /old_locus_tag="HPSH112_02900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207611.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="osmoprotection protein"
     gene            582937..583590
                     /locus_tag="HPSH112_RS02845"
                     /old_locus_tag="HPSH112_02905"
     CDS             582937..583590
                     /locus_tag="HPSH112_RS02845"
                     /old_locus_tag="HPSH112_02905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001042548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS607 family transposase"
                     /protein_id="WP_001042542.1"
                     /translation="MNKRMLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRY
                     KLESLRRINRNAVFNQDELKTIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQ
                     DLGSGMNYYKKGLTKLLNLILDNQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVII
                     NKGDENVRFEEELAKDVLEIITVFSARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA"
     gene            583565..584824
                     /locus_tag="HPSH112_RS02850"
                     /old_locus_tag="HPSH112_02910"
     CDS             583565..584824
                     /locus_tag="HPSH112_RS02850"
                     /old_locus_tag="HPSH112_02910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001274343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_001274344.1"
                     /translation="MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENY
                     QLGIKTNHLQLKKEFNALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVS
                     YPKFKKKREFQGSFYIGGDQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATIT
                     QKGDHFYVSISCGVDESEYKRTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDK
                     LTRKLVRISRQLSKKIHPKTKGDKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTS
                     SLIRHSNSFCLESLKVKNMFKNHRLAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTY
                     YPSSKTCSNCQKVKQDLKLKDRIYQCLECGFELDRDINAAINLLKHLVGRVTAEFTPM
                     DLTALLNDLSKNRLATSKVELGIQQKP"
     gene            complement(<584868..585740)
                     /locus_tag="HPSH112_RS02855"
                     /old_locus_tag="HPSH112_02915"
                     /pseudo
     CDS             complement(<584868..585740)
                     /locus_tag="HPSH112_RS02855"
                     /old_locus_tag="HPSH112_02915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207611.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="osmoprotection protein"
     gene            complement(585922..586359)
                     /locus_tag="HPSH112_RS02860"
                     /old_locus_tag="HPSH112_02920"
     CDS             complement(585922..586359)
                     /locus_tag="HPSH112_RS02860"
                     /old_locus_tag="HPSH112_02920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001081212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001031795.1"
                     /translation="MNKFFLFIFLFLASLIAREKDASSNLFDLIDQGINREQELKEQE
                     QKTRLKLAQSPLVALEIVPQETPYLEWQGARESYYLKVSAVVESVVILKIDINQGRSC
                     SLYPTPKSVSLVRNQSVAYEILCENQPLWIEVSTNLGKRTFQF"
     gene            complement(586363..587130)
                     /locus_tag="HPSH112_RS02865"
                     /old_locus_tag="HPSH112_02925"
     CDS             complement(586363..587130)
                     /locus_tag="HPSH112_RS02865"
                     /old_locus_tag="HPSH112_02925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_001085329.1"
                     /translation="MAKKNKPTECPAGEKWAVPYADFLSLLLALFIALYAISAVNKSK
                     VEALKTEFIKIFNYAPKPEAMQPVVVIPPDSGKEEEQMASESSKPASQNTETKATIAR
                     KGEGSVLEQIDQGSILKLPSNLLFENATSDTINQDMMLYLERIAKIIQKLPKRVHINV
                     RGFTDDTPLIKTRFKSHYELAANRAYRVMKVLIQYGVNPNQLSFSSYGSTNPIAPNDS
                     LENRMKNNRVEIFFSTDANDLSKIHSILDNEFNPHQE"
     gene            complement(587133..587906)
                     /locus_tag="HPSH112_RS02870"
                     /old_locus_tag="HPSH112_02930"
     CDS             complement(587133..587906)
                     /locus_tag="HPSH112_RS02870"
                     /old_locus_tag="HPSH112_02930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207608.1"
                     /note="With MotB forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="motility protein A"
                     /protein_id="WP_000366185.1"
                     /translation="MDLSTILGLVLAVASISLGDILEDGNPLHIIHLSSVIIIVPTSL
                     FAAMTGTHARYVKAAYKEIKIVFLNPKINLNETIKNLVELATLARKDGVLSLEGRVAQ
                     IEDDFTRNGLSMIIDGKDLKSVKESLEISIEEMEEYYHGAAHYWETAGETAPTMGLVG
                     AVMGLMLALQKLDNPAEMAAGIAGAFTATVTGIMCSYAIFGPFGHKLKAKSKDIIKEK
                     TVLLEGILGIANGENPRDLENKLLNYIAPGEPKKSQFEG"
     gene            complement(587922..588689)
                     /locus_tag="HPSH112_RS02875"
                     /old_locus_tag="HPSH112_02935"
     CDS             complement(587922..588689)
                     /locus_tag="HPSH112_RS02875"
                     /old_locus_tag="HPSH112_02935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207607.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiamin biosynthesis protein (thiF)"
                     /protein_id="WP_000952633.1"
                     /translation="MLSRLEKERYLRHIMLEDVGEEGQLKLLKSSVLVVGAGGLGSAV
                     LIYLCAAGIGKIGIVDFDVVDMSNLQRQIIHSQDFLNQSKASSAKARLKQLNAGIEIE
                     TFEERFKAHNALSLIEPYDFIIDATDNFNAKFLINDACVLAQKPYSHAGVLKYRGQSM
                     SVLPNSACLACVFDKSPKKGLNPISGLFGVLPGVLGCIQASECLKYFLGFETLLINTL
                     LIADIKTMDFKKIQAPKNPECRVCGTHKITHLQDYEI"
     gene            complement(588690..589307)
                     /locus_tag="HPSH112_RS02880"
                     /old_locus_tag="HPSH112_02940"
     CDS             complement(588690..589307)
                     /locus_tag="HPSH112_RS02880"
                     /old_locus_tag="HPSH112_02940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MBL fold hydrolase"
                     /protein_id="WP_000404704.1"
                     /translation="MEILRRECGAVEENAYIVKLSSGIDFIIDPGFSSSEWVLENAKN
                     PKAILITHGHYDHVWDSAQLSKLLKNTPIYAPKDDVFMLENDIFHLGMPVFSPNFSVP
                     CNKGCTTLEIENTTIKYWHFPGHTPGCSIIEIEGVIFSGDFIFYRSIGRYDFPYSNEK
                     DMKESLLRFQNLDFPKDIEIYPGHGDKTSFFAEREHSKIWVSRMA"
     gene            589440..590447
                     /locus_tag="HPSH112_RS02885"
                     /old_locus_tag="HPSH112_02945"
     CDS             589440..590447
                     /locus_tag="HPSH112_RS02885"
                     /old_locus_tag="HPSH112_02945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_000555527.1"
                     /translation="MHSFGNYMQEWLYGEKGYYKKALIGQKGDFYTSVSLSKFFGGAV
                     AFYIVKLLEEEKLFLPLKIVEIGAHHGHFLSDIANFLNALSVGVMEKCEFVSCEPLKE
                     LQKLQRTIFKQATQLDLSSCSLEELDFKEKSAFVVSNELFDAFACEIIKDNKMLFIAH
                     DHKGVWGTIDEPTKELLKNLDLKQGCAPLFLEAFIKDLLEKLDEASSWVFLSFDYGDE
                     IERKDMHLRAFKNHQALDFKDILNNLASLYQKSDLTYDVNFSLVRFLFEKHHAQFSFF
                     KSQANALLDMGLMELLETFSKSASYERYLKEAAKIKPLISPGGLGERFKALEFVKKNK
                     M"
     gene            complement(590418..590608)
                     /locus_tag="HPSH112_RS08260"
                     /pseudo
     CDS             complement(590418..590608)
                     /locus_tag="HPSH112_RS08260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001231387.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            590883..591209
                     /locus_tag="HPSH112_RS02890"
                     /old_locus_tag="HPSH112_02950"
     CDS             590883..591209
                     /locus_tag="HPSH112_RS02890"
                     /old_locus_tag="HPSH112_02950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000688959.1"
                     /translation="MKIFLSCKSLLIQRSLEFYLSDCLSPMEVCDLVLSDDGKLETNK
                     PLCFIEERLRKPFTKQSVKEDIKNFYHALKESEKPCEEIQFSKEQKIQQLLEEYTQKL
                     CQIISQ"
     gene            591188..591790
                     /locus_tag="HPSH112_RS02895"
                     /old_locus_tag="HPSH112_02955"
     CDS             591188..591790
                     /locus_tag="HPSH112_RS02895"
                     /old_locus_tag="HPSH112_02955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA (guanine(966)-N(2))-methyltransferase
                     RsmD"
                     /protein_id="WP_001132707.1"
                     /translation="MPNHQPVKKFKIIGGACKGLGLNLPKISSTRPTKAIVRESFFNT
                     LQAEIRGAHFIEVFSGSASMGLEALSRGAKSAVFFEQNKSAYATLLENISLFKNRLKK
                     EIEIQTFLDDAFKLLPTLCLKNGVLNILYFDPPFETSGFLGIYEKCFQALEMLLKRFN
                     PKNLLAVFEHESVHEMPKSLVTLAIIKQKKFGKTTLTYFQ"
     gene            591799..592350
                     /gene="fliL"
                     /locus_tag="HPSH112_RS02900"
                     /old_locus_tag="HPSH112_02960"
     CDS             591799..592350
                     /gene="fliL"
                     /locus_tag="HPSH112_RS02900"
                     /old_locus_tag="HPSH112_02960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207602.1"
                     /note="interacts with the cytoplasmic MS ring of the basal
                     body and may act to stabilize the MotAB complexes which
                     surround the MS ring; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FliL"
                     /protein_id="WP_000797017.1"
                     /translation="MAEEQENTAQQPPKKSKALLFVIIGSVLVMLLLVGVIIMLLMGN
                     KEESKENASKNTQEVQANPMANKNQEAKEGSNIQQYLVLGPLYAIDAPFAVNLVSQNG
                     RRYLKASISLELSNEKLLNEVKVKDTAIKDTIIEILSSKSVEEVVTNKGKNKLKDEIK
                     SHLNSFLIDGFIKNVFFTDFIIQ"
     gene            592357..592713
                     /locus_tag="HPSH112_RS02905"
                     /old_locus_tag="HPSH112_02965"
     CDS             592357..592713
                     /locus_tag="HPSH112_RS02905"
                     /old_locus_tag="HPSH112_02965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="holo-ACP synthase"
                     /protein_id="WP_000579170.1"
                     /translation="MIGIDIVSIARIEKCVKRFKMKFLERFLSPSEINLCKDKSSSIA
                     GFFALKEACSKALQVGIGKELSFLDIKISKSPKNAPLITLSKEKMDYFNIQSLSASIS
                     HDAGFAIAVVMVSSSS"
     gene            <592773..>592952
                     /locus_tag="HPSH112_RS02910"
                     /old_locus_tag="HPSH112_02970"
                     /pseudo
     CDS             <592773..>592952
                     /locus_tag="HPSH112_RS02910"
                     /old_locus_tag="HPSH112_02970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001014866.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start and stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(592962..593582)
                     /locus_tag="HPSH112_RS02915"
                     /old_locus_tag="HPSH112_02975"
     CDS             complement(592962..593582)
                     /locus_tag="HPSH112_RS02915"
                     /old_locus_tag="HPSH112_02975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease"
                     /protein_id="WP_000883259.1"
                     /translation="MLDDIPITIQKSKKIKTLSLNITPSLEVILKMPDSCPQNRAHAF
                     LKEQKAWLQKTLSAMQEKYSLLHSRLETYQNKILVFDEVKNANDYTLTELKKILKTYL
                     EQKLPLSAQKMQTSYTHFSVRNNAKVLGSCSYHNRLSFALLLVCAKKEAIDYVIIHEL
                     AHTIHKNHSKNFWRCVEIFCPNYRALREHLKQRVVFYTQLLKPLQP"
     gene            593664..594477
                     /locus_tag="HPSH112_RS02920"
                     /old_locus_tag="HPSH112_02980"
                     /pseudo
     CDS             593664..594477
                     /locus_tag="HPSH112_RS02920"
                     /old_locus_tag="HPSH112_02980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207598.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="lipooligosaccharide 5G8 epitope
                     biosynthesis-associated protein (lex2B)"
     gene            594583..595617
                     /locus_tag="HPSH112_RS02925"
                     /old_locus_tag="HPSH112_02985"
     CDS             594583..595617
                     /locus_tag="HPSH112_RS02925"
                     /old_locus_tag="HPSH112_02985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207597.1"
                     /note="bifunctional enzyme DHBP synthase/GTP
                     cyclohydrolase II; functions in riboflavin synthesis;
                     converts GTP to
                     2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine;
                     converts ribulose 5-phopshate to 3,4-dihydroxy-2-butanone
                     4-phosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
                     /protein_id="WP_000601468.1"
                     /translation="MILKRVTEALEAYKNGEMLIVMDDEDRENEGDLVLAGIFSTPEK
                     INFMATHARGLICVSLTKDLANKFELPPMVSVNDSNHETAFTVSIDAKEAKTGISAFE
                     RHLTIELLCKDTTKPSDFVRPGHIFPLIAKDGGVLARTGHTEASVDLCKLAGLKPVSV
                     ICEIMKEDGSMARRGDKFLSDFALKHNLKTLYVSDLISYRLENESLLKMFCQEEREFL
                     KHQTQCYTFLDHQQKNHYAFKFKGAKTNDLAPLVRFHPIKEDFDFLTTGAFEVFFKAL
                     EYLKREGGYLIFMNTHSKENNIVKDFGIGALVLKNLGIKDFRLLSSSEDRQYKALSGF
                     GLKLVETISL"
     gene            595704..596543
                     /locus_tag="HPSH112_RS02930"
                     /old_locus_tag="HPSH112_02990"
     CDS             595704..596543
                     /locus_tag="HPSH112_RS02930"
                     /old_locus_tag="HPSH112_02990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014662221.1"
                     /translation="MKVIIEFMLISLKTFLKILLKIFLKTFQKIWMVLVIIWGLGCSF
                     LNANSVQLEETLRRNPKNFIWQHFKKRFKKSNTIPYAPNSRWKYLGTSVGILGVSLVI
                     GIVGLYLMPESVTNWDREKFGIKSWFENVRMGPKLDNDSFIFNEILHPYFGAMYYMQP
                     RMAGFGWMASAFFSFITSTLFWEYGLEAFVEVPSWQDLVITPLLGSILGEGFYQLTRY
                     IQRNEGKLFGSLFLGRLVIALMDPIGFVIRDLGLGEALGIHNKHEIHSSLSPNGLNLT
                     YKF"
     gene            596661..597239
                     /locus_tag="HPSH112_RS02935"
                     /old_locus_tag="HPSH112_02995"
     CDS             596661..597239
                     /locus_tag="HPSH112_RS02935"
                     /old_locus_tag="HPSH112_02995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207595.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase II"
                     /protein_id="WP_000825041.1"
                     /translation="MKRLEVSNQAKLPTQFGEFCIQCFREKGSNGSKDHLVVFTPNFS
                     QNPLVRLHSECLTGDALGSQKCDCGGALQMALERISKEGGLVIYLRQEGRGIGLFNKV
                     NAYALQDKGYDTIQANEMIGFKDDERDYSIAGEILEYYGIKKMRLLTNNPKKIAALEK
                     YAEVTRESLIVCANEHNQGYLEVKKLKMGHLL"
     gene            597310..597534
                     /locus_tag="HPSH112_RS02940"
                     /old_locus_tag="HPSH112_03000"
     CDS             597310..597534
                     /locus_tag="HPSH112_RS02940"
                     /old_locus_tag="HPSH112_03000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin synthase sulfur carrier subunit"
                     /protein_id="WP_080024699.1"
                     /translation="MMVEVRFFGPIKEESFFTKASDLKELRAILQEKEGLKEWLGVCA
                     IALNDRLIDNLNTPLKEGDVVSLLPPVCGG"
     gene            597535..597972
                     /locus_tag="HPSH112_RS02945"
                     /old_locus_tag="HPSH112_03005"
     CDS             597535..597972
                     /locus_tag="HPSH112_RS02945"
                     /old_locus_tag="HPSH112_03005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207593.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor biosynthesis protein MoaE"
                     /protein_id="WP_000912620.1"
                     /translation="MLKIIQGALDTDKLLKAYQEEACAKNFGAFCVFVGIVRGEDNIQ
                     GLSFDIYEALLKTWFEKWHHKAKDLGVVLKMAHSLGDVLIGQSSFLCVLMGKNRKNAL
                     ELYQDFIEDFKHNAPIWKYDLIHNKRIYAKERSHLLKGSGLLA"
     gene            597985..598515
                     /locus_tag="HPSH112_RS02950"
                     /old_locus_tag="HPSH112_03010"
     CDS             597985..598515
                     /locus_tag="HPSH112_RS02950"
                     /old_locus_tag="HPSH112_03010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin adenylyltransferase"
                     /protein_id="WP_001193323.1"
                     /translation="MQTIHIGVLSASDRASKGIYEDLSGKAIQEVLSEYLLNPLEFHY
                     EIVADERDLIEKSLIKMCDEYQCDLVVTTGGTGPALRDITPEATEKVCQKMLPGFGEL
                     MRMTSLKYVPTAILSRQSAGVRNKSLIVNLPGKPKSIRECLEAVFPAIPYCVDLILGN
                     YMQVNEKNIQAFRPKQ"
     gene            598525..599001
                     /locus_tag="HPSH112_RS02955"
                     /old_locus_tag="HPSH112_03015"
     CDS             598525..599001
                     /locus_tag="HPSH112_RS02955"
                     /old_locus_tag="HPSH112_03015"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic pyranopterin monophosphate synthase MoaC"
                     /protein_id="WP_001131556.1"
                     /translation="MPLTHLNEENQPKMVDIGDKETTERIALASGRISMNKEAYDAIV
                     NHCVKKGPVLQTAIIAGIMGAKKTSELIPMCHSIMLNGVDIDILEEKETHSFKLYARV
                     KTQAKTGVEMEALMSVSIGLLTIYDMVKAIDKSMTISGVMLEHKSGGKSGDYNAKK"
     gene            599121..599903
                     /locus_tag="HPSH112_RS02960"
                     /old_locus_tag="HPSH112_03020"
     CDS             599121..599903
                     /locus_tag="HPSH112_RS02960"
                     /old_locus_tag="HPSH112_03020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="neuraminyllactose-binding hemagglutinin"
                     /protein_id="WP_000646687.1"
                     /translation="MKANNHFKDFAWKKCLLGASVVALLVGCSPHIIETNEVTLKLNY
                     HPASEKVQALDEKILLLRPAFQYSDNIAKEYENKFKNQTAIKVEQILQNQGYKVINVD
                     SSDKDDFSFAQKKEGYLAVAMNGEIVLRPDPKRTIQKKSEPGLLFSTGLDKMEGVLIS
                     AGFIKVTILEPMSGESLDSFTMDLSELDIQEKFLKTTHSSHSGGLVSTMVKGTDNSND
                     AIKSALNKIFANIMQEIDKKLTQKNLESYQKDAKELKTKRNR"
     gene            599929..600765
                     /locus_tag="HPSH112_RS02965"
                     /old_locus_tag="HPSH112_03025"
     CDS             599929..600765
                     /locus_tag="HPSH112_RS02965"
                     /old_locus_tag="HPSH112_03025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001037762.1"
                     /translation="MNKLLKKGFLAFFLSVYLRADDLVTYTITKEEDLGYQRFLAKKC
                     LRGKTHSPCFTEPKKPNKKLFNIDKSSHYYGTSVVQMSWLQSREKFENHSKYRDIPFA
                     EVSLIYGYKQFFPKKERYGFRFYISLDYAYGFFLKNKGLLGDSLRESSQIPKSYREKL
                     QRKETFINAIFYGVGADFLYKRAFGTLILGMNLVGETWFYETRIFKKWAKDPSSVYHP
                     YMFQVMLNVGYRYRFSRYKNWAIELGVRIPFLTNDYFKTPLYTLHFRRNISVYLTSTY
                     DF"
     gene            600878..602233
                     /locus_tag="HPSH112_RS02970"
                     /old_locus_tag="HPSH112_03030"
     CDS             600878..602233
                     /locus_tag="HPSH112_RS02970"
                     /old_locus_tag="HPSH112_03030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_001047726.1"
                     /translation="MNLEVKKIDTANARLNAKPSVENLEKRYDKIAQKIAQKVKIDGF
                     RRGKVPLNLVKTRYQAQIEQDAQEEMIQEVLKNALKELGIENKDLIGSPNFTKFEKKD
                     THFEIEADIGLKPTIVLDKIKECVPSVGVEIPNEEKIDERLKQLAKDYAKFVDTDAQR
                     KAQNDDKLTIDFEGFIDNAPFEGGKAENFSLILGNKQMLEDFEKALLGMQAGEEKEFP
                     LTFPSEYHAEHLAGKEALFKVKLHQIQAREVLEINDELAKIVLANEENATLKLLKERV
                     EGQLFLENKARLYNEELKERLIENLDGKIVFDLPKTIIEQEMDLLFRNALYSMQAEEV
                     KSLQESQEKAKEKRESFRNDATKSVKITFIIDALAKEEKIGVHDNEVFQTLYYEAMMT
                     GQNPENLIEQYRKNNMLAAVKMAMIEDRVLTYLLDKNLPKEQQEILEKMRPNAQKTQV
                     G"
     gene            602251..602841
                     /locus_tag="HPSH112_RS02975"
                     /old_locus_tag="HPSH112_03035"
     CDS             602251..602841
                     /locus_tag="HPSH112_RS02975"
                     /old_locus_tag="HPSH112_03035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp endopeptidase, proteolytic
                     subunit ClpP"
                     /protein_id="WP_014537330.1"
                     /translation="MMGYIPYVIENTDRGERSYDIYSRLLKDRIVLLSGEINDSVASS
                     IVAQLLFLEAEDPEKDIGLYINSPGGVITSGLSIYDTMNFIRPDVSTICIGQAASMGA
                     FLLSCGAKGKRFSLPHSRIMIHQPLGGAQGQASDIEIISNEILRLKGLMNSILAQNSG
                     QSLEQIAKDTDRDFYMSAKEAKEYGLIDKVLEKNVK"
     gene            602846..603373
                     /locus_tag="HPSH112_RS02980"
                     /old_locus_tag="HPSH112_03040"
     CDS             602846..603373
                     /locus_tag="HPSH112_RS02980"
                     /old_locus_tag="HPSH112_03040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001185798.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_001185887.1"
                     /translation="MALLEIIHYPSKILRTISKEVVSFDSKLHQQLDNMHETMIASEG
                     IGLAAIQVGLPLRMLIINLPREDGVQHKEDCLEIINPKFIETKGTIMYKEGCLSVPGF
                     YEEVERFEKVKIEYQNRFAEVKVLEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKF
                     EKELKELNKNPKNKS"
     gene            603376..604896
                     /locus_tag="HPSH112_RS02985"
                     /old_locus_tag="HPSH112_03045"
     CDS             603376..604896
                     /locus_tag="HPSH112_RS02985"
                     /old_locus_tag="HPSH112_03045"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_000611097.1"
                     /translation="MINTIFCATMQRGVAEIVAVEATFTRALPAFVISGLANSSIQEA
                     RQRVQSALQNNDFTFPPLKITINLSPSDLPKSGSHFDLPIALLIALQKQELAFKEWFA
                     FGELGLDGKIKPNPNIFPMLLDIAIKHPHAKVIAPKANEEPFSLIPNLQCFFVEHFKE
                     ALEILQNPEIKADTHTKKLPFKTIELNDKEYYFSDAYALDFKEVKGQAVAKEAALIAS
                     AGFHNLILEGSPGCGKSMIINRMRYILPPLSLNEILEATKLRILSEQDSAYYPLRSFR
                     NPHQSASKSSILGSSSLKEPKPGEIALAHNGMLFFDELPHFKKDILEALREPLENNKL
                     VISRVHSKIEYETSFLFVGAQNPCLCGNLLSTTKACRCQDREITQYKNRLSEPFLDRI
                     DLFVQMEEGNYKDTPSHSWTSKEMHQLVLLAFKQQKLRKQSAFNGKLNEEQIERFCPL
                     NAEVQKLLEQAIERFNLSMRSVNKVKKVARTIADLNACENIEKSHMLKALSFRKIS"
     gene            604921..606981
                     /locus_tag="HPSH112_RS02990"
                     /old_locus_tag="HPSH112_03050"
     CDS             604921..606981
                     /locus_tag="HPSH112_RS02990"
                     /old_locus_tag="HPSH112_03050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cadmium-translocating P-type ATPase"
                     /protein_id="WP_001158823.1"
                     /translation="MQEYHIHNLDCPDCASKLERDLNKLDCVKKAQINFSTSKLFLDT
                     SDFEKVKAFIKQNEPHLSLSFKEATEKPLSFTPLIMTIIVFLGAILILHLDPSPFIEK
                     AMFFVLALVYLISGKDVILGAFRGLRKGQFFDENALMLIATIAAFCVGAYEESVSIMV
                     FYSAGEFLQKLAISRSKKSLKALVDVAPNLAYLKKGDALVSVAPEDLKVNDIVVVKVG
                     EKVPVDGVVIKGESLLDERALSGESMPVNVSERSKVLGGSLNLKAVLEIKVEKMYRDS
                     SIAKVVDLVQQATNEKSETEKFITKFSRYYTPSVLFIALMIAILPPLFSMGSFDEWIY
                     RGLVALMVSCPCALVISVPLGYFGGVGAASRKGILMKGVHVLEVLTQAKSIAFDKTGT
                     LTKGVFKVIDIVPQNGHSKEEVLHYASCSQLLSTHPIALSIQKACEEMLKGDKHQHDI
                     KNYEEVSGMGVKAQCNTDLIIAGNEKMLDQFNIAHSPSPENGTIVHVAFNQTYVGYIV
                     ISDEIKDDAIECLRDLKEQGIENFCILSGDRKSATESIAQTLGCEYYASLLPEEKTSV
                     FKTFKERYKAPAIFVGDGINDAPTLASADVGIGMGKGSELSKQSADIVITNDSLSSLV
                     KVLAIAKKTKSIIWQNILFALGIKAVFIVLGLMGVASLWEAVFGDVGVTLLALANSMR
                     AMRA"
     gene            607017..608231
                     /locus_tag="HPSH112_RS02995"
                     /old_locus_tag="HPSH112_03055"
     CDS             607017..608231
                     /locus_tag="HPSH112_RS02995"
                     /old_locus_tag="HPSH112_03055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000548888.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction endonuclease subunit S"
                     /protein_id="WP_000548888.1"
                     /translation="MHKIERLLQTLAPKGVEFRKLGEVCEIIRGKRVTKKEILDKGKY
                     PVVSGGIGFMGYLNEYNREENTITIAQYGTAGFVNWQNQKFWANDVCFSVIPKETLIN
                     RYLYYVLTNMQNYLYSISNRSAIPYSISSNNIMQITIPIPPLEIQQEIVKILDAFTEL
                     NTELNTELKARKKQYQYYQNMLLDFNNINQNHKDAKIKTYPKRLKTLLQTLAPKGVEF
                     RKLGEVLEYDQPNKYCVTSKEFDKSYPTPVLTAGKTFILGYTNEKDNIYQASKSYPVI
                     IFDDFTTATQWVDFPFKVKSSAMKILLPKNPTINIRFIFFYMQTIPYNISGEHTRQWI
                     SRYSKITIPIPPLEIQQEIVKILDQFLALTTDLLAGIPAEIEARKKQYEYYREKLLTF
                     KPLTPHKEVKKC"
     gene            complement(608391..609890)
                     /locus_tag="HPSH112_RS03000"
                     /old_locus_tag="HPSH112_03060"
     CDS             complement(608391..609890)
                     /locus_tag="HPSH112_RS03000"
                     /old_locus_tag="HPSH112_03060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001108269.1"
                     /translation="MNYKVASAKNIATLLFLFSYQSQAFDLGKIAKIKAGAESFSKVG
                     FNNKPINTNKGLYPTETFMTVMAYMQVDFTELLPKSATANGHHLDGSLGGWGGAVIYD
                     STKDFINEVTGKPYGAMTWNYVGYWGGLVGQKPWASCGLATGNLTQGQYDKMTQAQMT
                     QLSNQEALEASTCAKSYADHTRNYVIYNAYLRYNYKDIFQIRGGRYESPADYMSGYNQ
                     GLDMTLNLGNFKFWWFSSFGRGFAYNEWLYNFYSPKTYTLKNGQTINPGVHAFYIIWN
                     YKGWSIQPFVYFSPFNEYDPNFTITYDSNPTFTGLGFRSQTDVTVLNPFYAKRFWDTY
                     QFGMPAGKNAHSLMIKQKFEWNEYNFGFGIYKSFGNANWMIGYHGNRLGFDFWTNTVY
                     ANTLNSLSYMMDANAFTVFAFGGGVHRKLLWGLLGRLTYGPRANEQVLSLNLGYKFTK
                     NFSADIKFEYYNVLMHQGYKMGWNGPKLDSQPATDQDRSHIFTEIVWKL"
     gene            complement(610168..611400)
                     /locus_tag="HPSH112_RS03005"
                     /old_locus_tag="HPSH112_03065"
     CDS             complement(610168..611400)
                     /locus_tag="HPSH112_RS03005"
                     /old_locus_tag="HPSH112_03065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_001133725.1"
                     /translation="MPNRSLIFFLIKRYLRFDKSQPFISITALLAFFGVAVGVMVLIV
                     AMAIMNGMSKEFEKKLFVMNYPLTLYTTSPYGISEEVVQALEKKFPNLLFSPYLQTQS
                     LIKSAHSMNGGVVFGVDFSKERRINEVLNDALKNTNENDLFKNPFNLIVGKSLRYSLN
                     LDLNQKADLFFTELEPTGLTLSPIMKRFTIKGDFDSGLKSYDMSYMYSSLQAISAIRR
                     LPLGLYDGVHVYSKTPMKDIEILRNALKTINHHGIGIEGWWQQNGNFFSAMELEKRAL
                     FIVLMLIILMASLNIISSLLMVVMNRRKEIALLFSMGSSQKEIQKTFFYLGNIIGLGG
                     VALGVILAFLSMYLLSVFPIISLPADVYGINTLPLDLSLMDFMLTLIGSIIIVALSSY
                     YPSKKASHIDALSVLRNE"
     gene            complement(611390..613987)
                     /locus_tag="HPSH112_RS03010"
                     /old_locus_tag="HPSH112_03070"
     CDS             complement(611390..613987)
                     /locus_tag="HPSH112_RS03010"
                     /old_locus_tag="HPSH112_03070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_000588057.1"
                     /translation="MIKAIIGKIIGTRNDHWIKQYKKKVLAINALEPTYEKMSDDELQ
                     NAFEELKKRVRSVEKDLQEKTLLEVLPESFAITREASKRILKMRHFDVQLIGGMVLND
                     GKIAEMKTGEGKTLVATLAVALNALKGESVYVVTVNDYLAHRDSKEMEPLYHFLGYSV
                     GTISASVRDDDERLEIYSKDIVYGTNNEFGFDYLRDNMKYSLEHKVQKSHAFAIVDEV
                     DSILIDEARTPLIISGPVDRRMENYNKADEVAKSMQVEIDFTIDEKNRAILITEEGIK
                     KAENLFGVDNLYKIENAALSHHLDQALKANYLFFIDKDYIVANNEVVIVDEFTGRLSE
                     GRRFSEGLHQALEAKEGVSIKEESQTLADITFQNYFRMFSKLAGMTGTAQTEATEFLE
                     IYNLEVVSIPTNLAIKRKDLNDLIYKSEKEKFDAVILKIKELHDKGQPVLVGTASIEK
                     SETLHALLKKERIPHTVLNAKQHTKEAEIIKDAGLKGAVTIATNMAGRGVDIKLTDEI
                     KELGGLYIIGTERHESRRIDNQLRGRSGRQGDPGTSQFYLSLEDNLLRIFGSDRIKGV
                     MEKLGLKDGEHIESKLVTRAVENAQKKVENLHFESRKHLLEYDDVANEQRKSVYKFRD
                     ELLDVNYDISAKIAENREYALNQIFSKLKAFDHQNLSEEELLGLKNILKEDFNTHVGL
                     EDLKKASPIENFVAEKLKSNYENKMKVLDSEQRSRIERIVYLQILDNAWREHLYTMDN
                     LKTGINLRGYNQKDPLVEYKKESYNLFLELIEDIKMEAIKTFSKIQFENEQDSSDAER
                     YLDNFSEEREHESVTYRHEEALDEDLNVAMKAFAKTPKRNEPCPCGSGKKYKDCCAKS
                     GPKKGLFAK"
     gene            614134..614688
                     /locus_tag="HPSH112_RS03015"
                     /old_locus_tag="HPSH112_03075"
     CDS             614134..614688
                     /locus_tag="HPSH112_RS03015"
                     /old_locus_tag="HPSH112_03075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoprotein carrier protein"
                     /protein_id="WP_014662222.1"
                     /translation="MKAFLKILMVLIFMSVACAKNPSTLSKEEEVLQHLQSFSANFKQ
                     VLKNEKPLVYYGVLKAKAPNWALWVYEKPLKKEIYMNDKEVVIYEPNLFQATITPLKD
                     KTDFFTILKRLKKQDDGSFKTTINKTTYRLVFKDGKPFSLEFKDDMNNLVTITFSQTE
                     INPTIANETFVFKPKDENIDIVRQ"
     gene            614754..615139
                     /gene="ssrA"
                     /locus_tag="HPSH112_RS08265"
     tmRNA           614754..615139
                     /gene="ssrA"
                     /locus_tag="HPSH112_RS08265"
                     /product="transfer-messenger RNA"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00023"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00023"
     gene            615181..615708
                     /locus_tag="HPSH112_RS03025"
                     /old_locus_tag="HPSH112_03080"
     CDS             615181..615708
                     /locus_tag="HPSH112_RS03025"
                     /old_locus_tag="HPSH112_03080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001980262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001168741.1"
                     /translation="MQKFFSRFRRWALPFYFVSALAAIDIDEVTEAQANSIKLSDQLV
                     SLSDKLLEKAVDRGRNTDHLKDLNDLHEKIKHLRLILEPKPKDKENNPNLKDHQGSET
                     IEIGEAIKKALGDPVFPQDALDAALQIDKQLDSFKQDSLIDVKPLKDVLAQLEAELRK
                     AINFQKQWLNSTKPN"
     gene            complement(615715..617082)
                     /locus_tag="HPSH112_RS03030"
                     /old_locus_tag="HPSH112_03085"
     CDS             complement(615715..617082)
                     /locus_tag="HPSH112_RS03030"
                     /old_locus_tag="HPSH112_03085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207575.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000911494.1"
                     /translation="MLKFQKLPLLFVSILYNQSPLLAFDYKFSGVAESFSKVGFNHSK
                     LNSKEGIFPTATFVTATIKLQVDSNLLPKNIEKHSLKIGVGGILGALAYDSTKTLIDQ
                     ATHQVYGSELYYFIGRWWGYLGDAPWKDSPIESDAHTRNYVLYNSYLFYSYGDKFHLK
                     LGRYLSNMDFMSGYTQGFEVEYKIKPKVSLKWFSSFGRALAAGQWIRDWYAPIVTEDD
                     RKDVNDGIHAVQLYFSSKHVQITPFIYFSPKTYKAPGIKIHIDSNPKFKGLGLRSQTL
                     INAIFPVYAKDLYDVYWVNSKIGEWGSSLLIHQRFDYNEFNFGFGYYQNFGNANARIG
                     WYGNPTPFSIRNNSVYGRIFSNAITADAVSGYVFGGGVYKKFLWGILGRYTYATRASE
                     RSINLNLGYKWGSFFRVDVDLEYYVVSMHNGYKLNYLTGPFNKAFKADAQDRSNLMAS
                     VKFFF"
     gene            complement(617176..618465)
                     /locus_tag="HPSH112_RS03035"
                     /old_locus_tag="HPSH112_03090"
     CDS             complement(617176..618465)
                     /locus_tag="HPSH112_RS03035"
                     /old_locus_tag="HPSH112_03090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE transposase"
                     /protein_id="WP_001146081.1"
                     /translation="MPYALRKRFFKRLVLIVSIFCAISLNAKSYLFSPLPPAHQQIIK
                     TEPCSLECLKDLMLQNQIFSFVSQYDNNSQDESLKTYYKDILNKLNPVFIASQTPAKE
                     SYEPKIELAVLLPKKVVGRYAISVMNTLLAYLNTRNNDFNIQVFDSDEESPEKLEQTY
                     KEIEKEKFPFVIALLTKEGVENLLQNTTISTPTYVPTVNRVQLENHADRSLSERLYFG
                     GIDYKEQLGMLTAFISPNSPVIEYDDDGLIGERLRQITESLSIAVKHQENISYKQATS
                     FSKNFRKHDAFFKNSTLILNTPTTKSGLILSQIGLLEYKPFKILSTQINFNPSLLLLT
                     QPKDRKNLFIVNALQNSDETLIEYASLLESDLRHDWVNYSSAIGLEVFLNTLDPHFKK
                     SFQESLEDNQVRYHNQIYQALGYSFEPIKNGSGTKKE"
     gene            complement(618731..618997)
                     /locus_tag="HPSH112_RS03040"
                     /old_locus_tag="HPSH112_03095"
     CDS             complement(618731..618997)
                     /locus_tag="HPSH112_RS03040"
                     /old_locus_tag="HPSH112_03095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000725270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_014534255.1"
                     /translation="MKKIVVSWCVALAFLSADPAQANKAIINADLIKEIRDLKKIISA
                     QNTEINHLRKVQEVLSEQLGDMRKDILSTRDYCISLRPYIYNWR"
     gene            complement(619074..621635)
                     /locus_tag="HPSH112_RS03045"
                     /old_locus_tag="HPSH112_03100"
     CDS             complement(619074..621635)
                     /locus_tag="HPSH112_RS03045"
                     /old_locus_tag="HPSH112_03100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional aconitate hydratase
                     2/2-methylisocitrate dehydratase"
                     /protein_id="WP_000973936.1"
                     /translation="MMKDFLEDYKKSVLERESDGIPPLPLNAKQVEAVVEILMKDPTN
                     AAFAKELLIHRVSPGVDEGAKVKAEFLAKLSQKKLECTCISALEATTLLGTMLGGYNV
                     EPLIMGLESQDKSIAKESAKALKTTLLVYGSFDKIAAMSKTNALAKEVLESWANAEWF
                     LNKEPLNECIEACVFKIDGETNTDDLSPASDAFTRSDIPLHAKAMLKNRIENYEQRIK
                     AIKAKGVPVAYVGDVVGTGSSRKSATNSIMWHFGKDIPFVPNKRSGGIVIGGVIAPIF
                     FATCEDSGALPIVADVKDLKEGDMIKIYPYKGEITLNDKVVSSFKLEPETLLDEVRAS
                     GRIPLIIGRGLTNKARKFLGLGESEAFKKPSAPKSDAKGYTLAQKIVGHACGVKGILP
                     GTYCEPKVTTVGSQDTTGAMTRDEVKELASLKFDAPFVLQSFCHTAAYPKPSDVSLHA
                     TLPSFITQRGGVALHPGDGVIHTWLNRMGLPDTLGTGGDSHTRFPLGISFPAGSGLVA
                     FAAVTGTMPLNMPESVLVRFKGEMNSGITLRDLVNAIPYYAIKKGLLTVEKKGKINVF
                     NGRILEIEGLPDIKMEQAFELSDASAERSAAACVVRLNKEPMIEYLKSNIKLIDEMIA
                     SGYEDKETLKKRRDAMQAWVDNPVLLEPDSNAQYAAVIEIDVAEITEPILACPNDPDD
                     VATLSEVLADTTGKRPHAIDEVFIGSCMTNIGHFRAFGEIVKNAPPSQARLWVVPPSK
                     MDEQELINEGYYAIFGAAGARTEVPGCSLCMGNQARVRDNAVVFSTSTRNFDNRMGRG
                     AKVYLGSAELGAACALLGRIPTKEEYMNLVSEKLESQKDKIYRYMNFNLMENFRL"
     gene            621766..622449
                     /locus_tag="HPSH112_RS03050"
                     /old_locus_tag="HPSH112_03105"
     CDS             621766..622449
                     /locus_tag="HPSH112_RS03050"
                     /old_locus_tag="HPSH112_03105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001210719.1"
                     /translation="MRFGKIDYLNMLPFDVFIKSYPTPCYFKQFLRLKKTYPSKLNES
                     FLFRRIDAGFISSIAGYQFALHSYSLGIVAYKEVLSVLVVDTKNAFDKESASSNALSQ
                     ALGLKGEVLIGNKALQFYYSNPKKDFIDLAALWYEKKRLPFVFGRLCYYQNKDFYKRL
                     SLAFKHKKTKIPYYILKEAALKTNLKRQDILNYLQKIYYTLGKKEQLGLKAFYRELLF
                     KRIQKPKRF"
     gene            622558..623280
                     /locus_tag="HPSH112_RS03055"
                     /old_locus_tag="HPSH112_03110"
     CDS             622558..623280
                     /locus_tag="HPSH112_RS03055"
                     /old_locus_tag="HPSH112_03110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UMP kinase"
                     /protein_id="WP_001148050.1"
                     /translation="MQAKIKNKRVLVKFSGEALAGDNQFGIDIHVLDHIAKEIKSLVE
                     NAIEVGIVIGGGNIIRGVSAAQGGIIRRTSGDYMGMLATVINAVAMQEALEHIGLDTR
                     VQSAIEIKEICESYIYRKAIRHLEKGRVVIFGAGTGNPFFTTDTAATLRAIEIGSDLI
                     IKATKVDGIYDKDPNKFKDAKKLDTLSYNDALIGDIEVMDDTAISLAKDNKLPIVVCN
                     MFKKGNLLRVIKHQQGVFSMVK"
     gene            623292..623549
                     /locus_tag="HPSH112_RS03060"
                     /old_locus_tag="HPSH112_03115"
     CDS             623292..623549
                     /locus_tag="HPSH112_RS03060"
                     /old_locus_tag="HPSH112_03115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="WP_000376273.1"
                     /translation="MDRTLKNKRINLKKERTESLVAQALKNIGNDRYMLDNLVFVRVK
                     QLNAGAKTLVNMDPKRHKLVDIAIREIAEGKIDIDRIDERN"
     gene            623536..625866
                     /locus_tag="HPSH112_RS03065"
                     /old_locus_tag="HPSH112_03120"
     CDS             623536..625866
                     /locus_tag="HPSH112_RS03065"
                     /old_locus_tag="HPSH112_03120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001002186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penta-phosphate
                     guanosine-3'-pyrophosphohydrolase"
                     /protein_id="WP_001002213.1"
                     /translation="MNEIDKSVDIGFLRILDVIKKVTTPKGGIEILRTLIDFTPKIEN
                     ALNLAAKSHKGQYRKSGEPYIVHPICVASLVAFCGGDEAMVCAALLHDVVEDTPCKIE
                     TIEQEFGQDVANLVDALTKITEIRKEELGVSAQDPRMVVSALTFRKILISAIQDPRAL
                     VVKISDRLHNMLTLDALPHDKQVRISKETLAVYAPIASRLGMSSIKNELEDKSFYYIY
                     PEEYKNIKEYLHKNKQSLLLKLNAFASKLEKKLFDSGFSHSDFKLVTRVKRPYSIYLK
                     MQRKGAVNIDEILDLLAIRILLKNPIDCYKVLGIIHLNFKPIVSRFKDYIALPKENGY
                     KTIHTTIFDESSVYEVQIRTFDMHMGAEYGNSAHWKYKAGGVDNDDHHEGMRWLQNFK
                     YHDSDLKNDPKEFYELAKNDLYREDIVVFSPHGDTYTLPVGAIALDFAYMVHSDLGDK
                     ATDAYINSKKALLNQELRSGDVVKIVKGDKVIPRFIWMDQLKTSKAKNHLRIQRRNRL
                     KEIDTKSMINILATFFGRSVFEDVDLKDYKNFEERLTDCGVETTLTEAMKTFENLAKL
                     TEEIENKVFSLKEDAILEYQEMSLWTRGLRYLGFKTSVLNFLTPNRQWQCKELEHFSV
                     CSSNALEIKQVLLNDCCYPKYGDEIIAIVTDLKDPKAIAHHKFCKKAMAEVDAKVPMV
                     YIEWHKRDRTIYKMMFYLGEKKSVLASLLTFLNRNECNIVGVSYLGYKDKYSSHCEVS
                     FEIATDKADWIRALINRKYQDRIVELSSLDDAYELQ"
     gene            625887..627095
                     /locus_tag="HPSH112_RS03070"
                     /old_locus_tag="HPSH112_03125"
     CDS             625887..627095
                     /locus_tag="HPSH112_RS03070"
                     /old_locus_tag="HPSH112_03125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine--tRNA ligase"
                     /protein_id="WP_000435671.1"
                     /translation="MEQKISIALKEIARGANEIIGLEYIEKLVRKYYETNERFIVKAG
                     FDPTAPDLHLGHTVLIQKLALLQQYGARVKFLIGDFTAMIGDPTGKNETRKPLNREQV
                     LENAKTYEEQIYKILDQKHTEVCFNSTWLDALGAKGIIELCAKFSVARMLERDDFTKR
                     YKENRPISIVEFLYPLLQGYDSVAMDADIELGGNDQKFNLLVGRFLQRAYGLNKEQSV
                     ITMPLLEGLDGVQKMSKSLGNYVGITEEPNAMFGKIMSVSDDLMWRYYTLLSAKTLEE
                     IEDLKHGILNQTLHPKAVKEDLAGEIVARYYDNEQAIKAKEQFSKVFGANLLPEILLE
                     SDFDEGVGILDVLKQIGFCPSTSQARRDIQGGGVKINQEVVKNENYRFVKGNYVIQLG
                     KKRFMKLNIN"
     gene            627106..628197
                     /locus_tag="HPSH112_RS03075"
                     /old_locus_tag="HPSH112_03130"
     CDS             627106..628197
                     /locus_tag="HPSH112_RS03075"
                     /old_locus_tag="HPSH112_03130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase"
                     /protein_id="WP_000255235.1"
                     /translation="MVSTLKPLKIGKHTIKFPIFQGGMGVGISWDELAGNVAKEGALG
                     VISAVGTGYYKNMRFVERIVAKKPFEALNFYSKKALNEIFANARKICGNNPLGANILY
                     AINDYGRVLRDACEAGANIIITGAGLPTNMPEFAKDFSDVALIPIISSAKALKILCKR
                     WSDRYKRIPDAFIVEGPLSGGHQGFKYEDCFKEEFRLENLVPKVVEASKEWGNIPIIA
                     AGGIWDRKDIDTMLSLGASGVQMATRFLGTKECDAKVYADLLPTLNKEDILLIKSPVG
                     YPARAINTGVIKRIEEGNAPKIACVSNCVAPCNRGEEAKKVGYCIADGLGRSYLGNRE
                     EGLYFTGANGYRVDKIISVHELIKELTEG"
     gene            628204..629526
                     /locus_tag="HPSH112_RS03080"
                     /old_locus_tag="HPSH112_03135"
     CDS             628204..629526
                     /locus_tag="HPSH112_RS03080"
                     /old_locus_tag="HPSH112_03135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_014662224.1"
                     /translation="MLVRLGVVACLFWLHFAYATTLKIINIVPFGSSSVKISFNQEIK
                     TFKEVSLKNFKSYLELEAILTIPKKHYQFSKQSSITIAQFSPKLARVVISHAPKMTYE
                     VKILKDKLYVSIVEKKPLIRHQMAPKHQVLKPPKHHALKHQVLKPAPKPIKKEAKEVK
                     EKTPTKHARSKHTHSQWNERSAKKEIPKKEAENEGKNQVFIAEKNDAFIKTKRKKHKK
                     IVLDAGHGGKDCGAMSANLVCEKDIVLEVVKFLHKELKKRGYSVLLTRDKDIYIDLVA
                     RTELANKKSADLFISVHANSIPKRSTSNAHGIETYFLSTARSERARKVAEQENKDDVN
                     LMDYFSKSLLLNSLNTQRLIVSNKLAIDVQYGMLQSVRKNYPDVVDGGVREGPFWVLA
                     GALMPSILIEIGYNSHAIESKRIQSKPYQKILAKGIADGIDSFFSKND"
     gene            629545..630282
                     /locus_tag="HPSH112_RS03085"
                     /old_locus_tag="HPSH112_03140"
     CDS             629545..630282
                     /locus_tag="HPSH112_RS03085"
                     /old_locus_tag="HPSH112_03140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001012372.1"
                     /translation="MNFYQKIHTHKVVFSSLFFLLFLFNVETLLLSHFSDDFSQLFFL
                     FENHVYDFIVKLDYLGLIGVSLIYLLVLILKPFTLTRQKCACVGILCLSFYAWNFPVK
                     DSLMALYIFYFVLLATLLWRFLGASMKQSFLPSMNICIVWIFASSLQSFKFLSVSDCV
                     DFSLFILALILLILVLIYHKRLFGLYEYANTLILIVGLSVVVLCSSMFIQTKEYYGMR
                     LGFYFLGLLGWLLEYVHNTLRRLEHQI"
     gene            complement(630355..631431)
                     /locus_tag="HPSH112_RS03090"
                     /old_locus_tag="HPSH112_03145"
     CDS             complement(630355..631431)
                     /locus_tag="HPSH112_RS03090"
                     /old_locus_tag="HPSH112_03145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_000796818.1"
                     /translation="MAEEEKTELPSAKKIQKAREEGNVPKSMEVVGFLGLLAGLLSIF
                     VFFIWWVDGFSEMYRHVVKDFSLDFSKESVQKLFNQLAKDTFLLLLPVLIILVVVAFL
                     SNVLQFGWLFAPKVIEPKFSKINPINGVKNLFSLKKLLDGSLITLKVFLAFFLGFFIF
                     SLFLGELNHAALLNLQGQLLWFKSKALLLISSLLFLFFILAFIDLMIKRRQYTNSLKM
                     TKQEVKDEYKQQEGNPEIKAKIRQMMLKNATNKMMQEIPKANVVVTNPTHYAVALKFD
                     EEHPVPVVVAKGTDYLAIRIKGIAREHDIEIIENKTLARELYRDVKLNATIPEELFEA
                     VAIVFAQVAKLEQERQKQKIIKPL"
     gene            complement(631424..632029)
                     /locus_tag="HPSH112_RS03095"
                     /old_locus_tag="HPSH112_03150"
     CDS             complement(631424..632029)
                     /locus_tag="HPSH112_RS03095"
                     /old_locus_tag="HPSH112_03150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207562.1"
                     /note="MobA; links a guanosine 5'-phosphate to
                     molydopterin to form molybdopterin guanine dinucleotide;
                     involved in molybdenum cofactor biosynthesis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor guanylyltransferase"
                     /protein_id="WP_014662225.1"
                     /translation="MKNPIIDNIPCVLLAGGKSSRFIINNIQINKALMPFESYSSLLE
                     YQYTRLLKLFKKVIISAKKSYELNAPYLLERESDLFSPLFGIHNAFLTLQTPYIFFIP
                     IDTPLVSFESIKALCGIKNFSVTYAKSPTKEHYLISLWHQNSLNALNYALKTQNYRLS
                     DLVKNTSSIAMHLDKEEEFLNLNTLKDYELAVQILKERTNG"
     gene            632115..633080
                     /locus_tag="HPSH112_RS03100"
                     /old_locus_tag="HPSH112_03155"
     CDS             632115..633080
                     /locus_tag="HPSH112_RS03100"
                     /old_locus_tag="HPSH112_03155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP 3',8-cyclase MoaA"
                     /protein_id="WP_014662226.1"
                     /translation="MLVDSFNRVIDYIRVSVTKQCNFRCQYCMPTTPLNFFDDEELLP
                     LDNVLEFLKIAIDEGVKKIRITGGEPLLRKGLDEFIAKLHAYNKEVALVLSTNGFLLK
                     KMAKDLKNAGLSRVNVSLDSLKSDRVLKISQKDALKNTLEGVEESLKVGLKLKLNMVV
                     MKSVNDDEILELLEYAKNRNIQIRYIEFMENTHAKSLVKGLKEREILDLIAQKYQIIA
                     TEKPKQGSSKIYTLENGYQFGIIAPHSDDFCQSCNRIRLASDGKICPCLYYQDAIDAK
                     EAIMNKDTKNIKRLLKQSIINKPEKNMWNDKNSETPTRAFYYTGG"
     gene            633028..633184
                     /locus_tag="HPSH112_RS08270"
                     /pseudo
     CDS             633028..633184
                     /locus_tag="HPSH112_RS08270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000597919.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
     gene            633366..634487
                     /locus_tag="HPSH112_RS03105"
                     /old_locus_tag="HPSH112_03160"
                     /pseudo
     CDS             633366..634487
                     /locus_tag="HPSH112_RS03105"
                     /old_locus_tag="HPSH112_03160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000886712.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            634498..635532
                     /locus_tag="HPSH112_RS03115"
                     /old_locus_tag="HPSH112_03165"
     CDS             634498..635532
                     /locus_tag="HPSH112_RS03115"
                     /old_locus_tag="HPSH112_03165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001130748.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001130748.1"
                     /translation="MPLPFILGGLALAAAGYGVKKGIDAKNTNDEAKDLFKKAEERLE
                     ETKKRVEFAQSDCKNAFARFGEKKLHVISRGVSRFVEHFNQLEGHEFVINNMDMQNIQ
                     EQVSEALNVVNKCKEMGLSDLASLGGVGTAVGVLATYGAYTGISATAGGTVLSSLSGA
                     LAWMSGGAISLGGGLAAGSMALIGGVGAAPVIAILGVLSAKKMEKKLEDVKAYCCEVE
                     EAITKAYGVIDDLLAVERVVKLFTRQITKCDALFFSLSQDAIATMKKHNYDTSRYNQK
                     EKDQLCVTVSILMTLSAFLKVPIIDKHQKLQEKAKRALEIMKRQMDNLESGRYNVAMI
                     QSRQKDLENL"
     gene            635591..635902
                     /locus_tag="HPSH112_RS03120"
                     /old_locus_tag="HPSH112_03170"
     CDS             635591..635902
                     /locus_tag="HPSH112_RS03120"
                     /old_locus_tag="HPSH112_03170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001919181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc/iron-chelating domain-containing protein"
                     /protein_id="WP_000678794.1"
                     /translation="MKGSNEKLDRFPCTSCGLCCKNITGIVELVGFDAGNGVCKFLDL
                     ETNLCKIYESRPLICRVDEAHKKLYSHIPLEEFYAKNAEVCNALQEANHMDKSFRVIV
                     Q"
     gene            complement(635911..636792)
                     /locus_tag="HPSH112_RS03125"
                     /old_locus_tag="HPSH112_03175"
     CDS             complement(635911..636792)
                     /locus_tag="HPSH112_RS03125"
                     /old_locus_tag="HPSH112_03175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle-docking protein
                     FtsY"
                     /protein_id="WP_000481601.1"
                     /translation="MFNFFKKIVNKIKGEETKEKKRQSVPKEELEEILIGFDIQYDLI
                     ESLLNHLGDLITPKQLEVALLRFVRGESYYDKTRLKTITTKPLVHLIVGVNGAGKTTT
                     IAKLAKLSLKQHKKALLGAGDTFRAAAVKQLQLWGEKLNIQVISAKEGSDPSSLAYNT
                     IESAIAKNIDEVFIDTAGRLHNQTNLKNELSKIARTCSKVLKDAPFYKFLILDGTQGS
                     SGLTQAKIFHETLALDGVIMTKLDGTSKGGAILSVLYELKLPILYLGMGEKEDDLIAF
                     DEERFIEDLVDAVFVEQ"
     gene            complement(636799..637356)
                     /locus_tag="HPSH112_RS03130"
                     /old_locus_tag="HPSH112_03180"
     CDS             complement(636799..637356)
                     /locus_tag="HPSH112_RS03130"
                     /old_locus_tag="HPSH112_03180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001220442.1"
                     /translation="MRIKAYFLRFIALVLIVLLGFSACKNSQKSQDSQNNTTQQDSPK
                     TYTAMDLNNQEYTITGDLDSLNISPDSNTPTLLVLSALDNFLKDYAPSFNILKKTFKD
                     RLRVLILLNKPYSSDEIKDFNTHFQADFMILSPKDTALFDHLKHDSLNHSFNMLLYYK
                     HELIKMYQGIVPIEMLQFDISNLKD"
     gene            637454..638128
                     /locus_tag="HPSH112_RS03135"
                     /old_locus_tag="HPSH112_03185"
     CDS             637454..638128
                     /locus_tag="HPSH112_RS03135"
                     /old_locus_tag="HPSH112_03185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017282427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-formyltetrahydrofolate cyclo-ligase"
                     /protein_id="WP_080024701.1"
                     /translation="MFRDFCKERLKRAKPTKDKAVRDKLACKLLFWKLKDYQNILLYS
                     PLGHELDIRSLILKLRQKNKRVWLPKSIKKGANFSKEGFTIAPFRLPLRRLGWFDEPS
                     LSRYYKRELDCIVVPILGMDTSFRRVGFGLGMYDRSLPQLFKRRLKRPLIVFVSRELA
                     LANGVLTDAYDIEADLYMNARIVMKNNKRKHYEQRVNLHFIRSLSSVFDYRSNHVLCD
                     EKDLLC"
     gene            638028..639617
                     /locus_tag="HPSH112_RS03140"
                     /old_locus_tag="HPSH112_03190"
     CDS             638028..639617
                     /locus_tag="HPSH112_RS03140"
                     /old_locus_tag="HPSH112_03190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease Y"
                     /protein_id="WP_014662227.1"
                     /translation="MSSGLIYISLEVLVACLITALIMYYVMKKIYYARGQTILKGASA
                     KAKLMEFQAKSFVEAEEMRMKSQECKLQQQYENKNLQLQTHFEKKEVHLKHLEAQHKE
                     FVRDEKRYLEKEKQELEKERQILEQERENFKKQRAVCKEAQAKALDAMLNYMAYTKDE
                     IKSMVLEQLEEELEAQKSALIKRYEKEAKEEGKKKSYAILAEATARFAGNYAAENLTT
                     RIALPCSDYIGRVIGKDGKNIEAFKKVSGVDIEFSEGSSELYLSSFNLYRREVASETL
                     KILIEDGRIQPNRIEEVYHRVVRNMEKELLSEGESVVLELELGAMEDELKILIGKMRY
                     RSSFGQNALQHSKEVALLAGLIAEQLGGDKKLARRAGILHDIGKALTQELGRDHVNLG
                     VEVCKRHKEDPVVINAIYAHHGHEEIMSVECASVCAADALSAGRPGARRKSDEEYAKR
                     MQALEEIALEFDGVEKAYAMESGRELRVVVKSNQVRDNQVPIIARKIAKKIEESAQYV
                     GEVGVQVVRESRFKTTATLKQ"
     gene            complement(639618..640889)
                     /locus_tag="HPSH112_RS03145"
                     /old_locus_tag="HPSH112_03195"
     CDS             complement(639618..640889)
                     /locus_tag="HPSH112_RS03145"
                     /old_locus_tag="HPSH112_03195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MATE family efflux transporter"
                     /protein_id="WP_080024624.1"
                     /translation="MNAFLDVLVVALSVFFVGKISHHHIVALGVGLQFLMLFYGINTI
                     LYTGTNAILSRLVGARDFTQINHAFSSIFIGAFVICLGVLFVSYFLIEPFLNWMRLQD
                     PSRQLTQDYLEVLVIALPSIFLKNVLVSALASFSDTLTPFIVKIIMVIACIFLNQALI
                     FGDFGFKEMGIVGSALANVIVSYLELLALGVWIQIKKIPLKFKITFNFSFLKTMFRVG
                     WPAGFERLLSLFSLILLSKFVASYGDKVLAGMQIGIRVETFSFMPGFGFMIAAMVLTG
                     QNLGANKPKIATEYAHLILKISMGLMGVLGIVLVLFAKEFANLFSQDEEVLEVARSYL
                     IAVGLSQAPLIGYFVLDGVFRGAGISKVSLYINTLSLWGLRIMPIYLLLIYHFKVEFI
                     FVVIASETFLRSFIYYKVFSKGIWKRCGKKA"
     gene            complement(640934..642247)
                     /locus_tag="HPSH112_RS03150"
                     /old_locus_tag="HPSH112_03200"
     CDS             complement(640934..642247)
                     /locus_tag="HPSH112_RS03150"
                     /old_locus_tag="HPSH112_03200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_000892549.1"
                     /translation="MLENSSIWSNPAFVAIICMCVLSLLRLNVMLSMISATLIAGLMG
                     GLGITESFNAMIDGMKGNLNIALSYILLGALAVAIAKSNLIKVALSKLIGLMNYKRST
                     FCFLIAFIACFSQNLVPVHIAFIPILIPPLLHLMNRLELDRRAVACALTFGLQAPYLV
                     LPVGFGLIFQTTILEQLKANGVSATLAQITGVMWIAGLAMAVGLFVAVLTLYKKPRHY
                     KEKSFNIENYDSLKLNYHDYLTFIGIIVAFVIQLATDSMPLAAFLALAIILLGRGIKF
                     KETDSLMDDSVKMMAFIAFVMLVASGFGEVLQKVHAIEGLVNSITSVVQGKLLGAFLM
                     LVVGLFITMGIGTSFGTIPIIAVFYVPLCAKLGFSIESTILLIGIAAALGDAGSPASD
                     STMGPTCGLNADNQHNHIYDTCVPTFLVYNLPLIVFGVVGALLLG"
     gene            complement(642374..643252)
                     /locus_tag="HPSH112_RS03155"
                     /old_locus_tag="HPSH112_03210"
     CDS             complement(642374..643252)
                     /locus_tag="HPSH112_RS03155"
                     /old_locus_tag="HPSH112_03210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein acyltransferase"
                     /protein_id="WP_000562732.1"
                     /translation="MICASVLQHAYCGSRKKTIEHTANLLEQALKKHPKTNLVVLQEL
                     NPYSYFCQSENPKFFDLGEYFEEDKAFFSALAQKFQVVLIASLFEKRTKGLYHNSAVV
                     FEKDGLIAGVYRKMHIPDDPGFYEKFYFTPGDLGFEPIVTSVGKLGLMVCWDQWYPEA
                     ARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQNAWETIQRGHAIANGLPLIATNRVG
                     VELDPSGTIKGGITFFGSSFVVGALGEFLAKASDKEEILYAEIDLERTEEVRRMWPFL
                     RDRRIDFYNDLLKRYI"
     gene            complement(643256..643402)
                     /locus_tag="HPSH112_RS03160"
                     /old_locus_tag="HPSH112_03215"
     CDS             complement(643256..643402)
                     /locus_tag="HPSH112_RS03160"
                     /old_locus_tag="HPSH112_03215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000656202.1"
                     /translation="MKDYEDELEDFEEEELEGFEEEDEEYGDYKNVYDDDDYEDYSSD
                     YEEE"
     gene            complement(643431..644051)
                     /locus_tag="HPSH112_RS03165"
                     /old_locus_tag="HPSH112_03220"
     CDS             complement(643431..644051)
                     /locus_tag="HPSH112_RS03165"
                     /old_locus_tag="HPSH112_03220"
                     /EC_number="6.3.2.19"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA cyclic N6-threonylcarbamoyladenosine(37)
                     synthase TcdA"
                     /protein_id="WP_001871960.1"
                     /translation="MFKNDFEKIRRQRVLICGVGGVGGFALDALYRVGIGQITIIDKD
                     VFDVTNQNRQIGSERIGESKVLVLQDLYKGIQALNLHIDEAFLNSFNFRDYDYILDCM
                     DDLPIKTSLAIKCQNFAYGKFISSMGSAKRLNPKHIQVGSVWESYGDKFGRKFRDFLK
                     KRRFKGDFKVVFSPEVPHCIELGSFNAVTASFGLQIASEVVQDIIK"
     gene            complement(644143..644382)
                     /locus_tag="HPSH112_RS03170"
                     /old_locus_tag="HPSH112_03225"
     CDS             complement(644143..644382)
                     /locus_tag="HPSH112_RS03170"
                     /old_locus_tag="HPSH112_03225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001087782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001087782.1"
                     /translation="MNSPDMLLDSFKIALIKKDSRLAFSLIEHLSLEQIKSLDLDTLL
                     SLKEMIAQSIELLEKEKEELQSQMHKAKKIQKFLF"
     gene            complement(644369..644749)
                     /locus_tag="HPSH112_RS03175"
                     /old_locus_tag="HPSH112_03230"
     CDS             complement(644369..644749)
                     /locus_tag="HPSH112_RS03175"
                     /old_locus_tag="HPSH112_03230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliS"
                     /protein_id="WP_001199081.1"
                     /translation="MQYANAYQAYQHNRVSVESPAKLIEMLYEGILRFSSQAKRCIEN
                     EDIEKKIYYINRVTDIFTELLNILDYEKGGEVAVYLTGLYTHQIKVLTQANVENDASK
                     IDLVLNVARGLLEAWREIHSDELA"
     gene            complement(644829..646854)
                     /gene="fliD"
                     /locus_tag="HPSH112_RS03180"
                     /old_locus_tag="HPSH112_03235"
                     /pseudo
     CDS             complement(644829..646854)
                     /gene="fliD"
                     /locus_tag="HPSH112_RS03180"
                     /old_locus_tag="HPSH112_03235"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207545.1"
                     /note="involved in flagellin assembly; frameshifted;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar filament capping protein FliD"
     gene            complement(646871..647230)
                     /locus_tag="HPSH112_RS03185"
                     /old_locus_tag="HPSH112_03240"
     CDS             complement(646871..647230)
                     /locus_tag="HPSH112_RS03185"
                     /old_locus_tag="HPSH112_03240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207544.1"
                     /note="possibly involved in flagella export; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlaG"
                     /protein_id="WP_014534249.1"
                     /translation="MVNEVQGIGIPTSHTSVQTTPTKEISRTNTINTIDESKTTIDPE
                     QYKPKLELLSERLNEEMKRIGTDINFSYNDTIKGLVVSVKDANGDKVIREIPSKEAVE
                     LMQRMRDVIGIIFDEKG"
     gene            complement(647329..648531)
                     /locus_tag="HPSH112_RS03190"
                     /old_locus_tag="HPSH112_03245"
     CDS             complement(647329..648531)
                     /locus_tag="HPSH112_RS03190"
                     /old_locus_tag="HPSH112_03245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_000277348.1"
                     /translation="MYKLGVFLLATLLSANTQKVSDIAKDIQHKETLLKKTHEEKNQL
                     NSRLSSLGEAIRSKELQKAEMERQMIALKKSLEKNRNESLAQEKVLTNYRKSLDRLQK
                     QRSFLQKRVFDALLQDFLFSQALKGQNLASSNDVILQVAFENLHQSTLSKMSQLSQEE
                     KDLNAQALKVKSSIQKISSVIDEQKTREVTLKSLKTEQDKLILSMQKDYAIYNQRLTL
                     LEKERQNLNALLKRLNIIKQNRENEEKVSLKRSSQALEVKQVASSYQNINTTSYNGPK
                     TIAPLNDYEVVQKFGPYIDPVYNLKIFSESITLVSKTPNALVRNVLDGKIVFAKEINM
                     LKKVVIIEHKNGIRTIYSQLDKIAPTIKSGMRIQKGYVLGRIDQRLGFEVTMKEKHIN
                     PLELIARN"
     gene            complement(648524..649330)
                     /locus_tag="HPSH112_RS03195"
                     /old_locus_tag="HPSH112_03250"
     CDS             complement(648524..649330)
                     /locus_tag="HPSH112_RS03195"
                     /old_locus_tag="HPSH112_03250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_001094193.1"
                     /translation="MNTLKKHLAFIIPLVALLFSLECVLFINQAIEQKEKKLIEDYSV
                     VLASTQKLGLELLRQNFSEIVALKEIDPNYSLEPLQKTLGMDGLKELRKNLPFFYSLQ
                     LSTFPTQERLENIKEKLLKIPGVQKVEVFAKTYMQVYDLLSFIKAAVYIFALVVFVLS
                     VLLMFKQVRIWIYQYHERLEIMDLLGASVSFKNGFLYKIALMDSIIASFLAPMFMLYI
                     TSQKGFEKTMDTLGIIGGAFALNHFLWGLLFSLVVSFVSVLLVAWRTRHV"
     gene            complement(649317..649988)
                     /locus_tag="HPSH112_RS03200"
                     /old_locus_tag="HPSH112_03255"
     CDS             complement(649317..649988)
                     /locus_tag="HPSH112_RS03200"
                     /old_locus_tag="HPSH112_03255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000111072.1"
                     /translation="MSVIIAANNLCLQYQQNEPVIKHANLRIKRKDFVFISGPSGSGK
                     STLLRSFYGDLKLFSGKLEVCNINMNNASKSTILDLRKNIGVVFQDYKLIQDYTIEQN
                     IKLPMVICGVKKEECRLQLEKLLGHIDLRHKANRYPKELSGGEQQRVAMARAIANCPE
                     LILADEPTGNLDDYSSDKIWSLLRGMNTQLNATIVVVTHKFPKNFSAYHRKFYIEDGE
                     VYEYS"
     gene            complement(649985..651166)
                     /locus_tag="HPSH112_RS03205"
                     /old_locus_tag="HPSH112_03260"
     CDS             complement(649985..651166)
                     /locus_tag="HPSH112_RS03205"
                     /old_locus_tag="HPSH112_03260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207540.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine(46)-N(7))-methyltransferase"
                     /protein_id="WP_001119907.1"
                     /translation="MPHFLAKLDFKPLEYPLIEGDFCFHREFLSLKHPTKSYVYASFK
                     DRIFLLQKIRRANDFLIKSEKATPLKREVLKQALRIYSQSFEIISHNLQENSKHASGK
                     KTLDLETFEDFIQKNQAPILVEIGFGSGRHLIELAKNNPTKTCLGIEIHTPSIAQALK
                     QIELLDLKNLHILQGDGRLVLESMPHHKCEKIFVHFPVPWNEKKHRRVLSEKFLNEAL
                     RVLKPKGFLELRTDDSLYFEDSLKLALKNFKCEIEIKKNAQIPVISKYEARWNKLKKD
                     IYDLRIYSLELNETPFYHHAFDFSFDTITISKKSVGTILKTPKIIQEGYFVHVCNIYE
                     NKGDFLVELSMGDFDWPVRLFVLLTENQIFYLNKSPLKTLNNHKAHLLLQNILSQKGI
                     G"
     gene            complement(651177..652436)
                     /locus_tag="HPSH112_RS03210"
                     /old_locus_tag="HPSH112_03265"
     CDS             complement(651177..652436)
                     /locus_tag="HPSH112_RS03210"
                     /old_locus_tag="HPSH112_03265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207539.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fibronectin"
                     /protein_id="WP_014661964.1"
                     /translation="MRSWMKKKYFTLLLQSSVVLAVFIGCSSTRNHTFSALSNQENTD
                     TNLPVVHSVKTINDVSSVGFEWPKIADTYDIDGFILYRLKKDSKLKKIATIKNPYATH
                     YYDEGLETESSYTYQLATYKGDKISKLSEPILVKTSFINPVESVFASLEYPKSVKVFW
                     SPHPNPSVSKYIIQRQNKDGKFVSVGAVRNRLFVEFFDKDLEDGKKYRYQVIAENFMG
                     DKSRPSIIVEGKTKDLPKEIANVRVSQNLTRHIELSWDKSPEEDVIAYRIYASNNRND
                     KYKFIAQTTNTSYVDKIEKDNLTRYYKVVALDKTHLEGALPKDPAMGETADRPEAPII
                     TKGTIQDSSALIQWENNPSAKIATYAVYRFEANSKTPLRFGNITKNQFVDKDMKVGVS
                     YRYQVVSVDKDGLESHPSKEVRLFLER"
     gene            complement(652387..653370)
                     /locus_tag="HPSH112_RS03215"
                     /old_locus_tag="HPSH112_03270"
     CDS             complement(652387..653370)
                     /locus_tag="HPSH112_RS03215"
                     /old_locus_tag="HPSH112_03270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA pseudouridine synthase"
                     /protein_id="WP_001174289.1"
                     /translation="MQKVFIALTDHKRLDEFLAKELQISKNQVLHLIKEGLVFCQKKG
                     VKKGGLALKKGDEITILTPKITPKPLKRGLDLEIGVIFEDEDLLVLNKPPNLVIHKAP
                     SVKEPTLVDWLELKNYELSNLGSKERYGIVHRLDKDTSGGIVIAKNNFTHVYLSEQLK
                     TKMMGRYYIALLSTPLKEEKMSVECYLTRNPNNRLKMIALKAAKKEKSRYSKSEFTSL
                     LTSQNNLNLIGAKLFTGRTHQIRAHLEYLNRHIIGDNLYGLNQALPKEEIRIMLHAYL
                     IEFKHPRSEQKLRFKVPLLKDMLEYFRKVFDKENLDEVLDEEKILHAFIAK"
     gene            653501..653959
                     /locus_tag="HPSH112_RS03220"
     CDS             653501..653959
                     /locus_tag="HPSH112_RS03220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000429689.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000429695.1"
                     /translation="MENNENHEKLSGILHKFLGDAFTLDGKEGGLNMEKMHEVIKKEK
                     PIMNILLMGATGVGKSSLINGLFGQEVAKAGVGKPLTQHLEKHVNEEKGLILWDTKGI
                     EAKDYQNTIESIKKEMEYSFKTLDEKEAIDVAYLCVKEGYSRVQGRGKLY"
     gene            653992..654726
                     /locus_tag="HPSH112_RS03225"
     CDS             653992..654726
                     /locus_tag="HPSH112_RS03225"
                     /inference="COORDINATES: protein motif:HMM:PF05128.10"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024702.1"
                     /translation="MVFTHTQAEAGDAFVQEAQRVIDEEWGFKGFVRAYVRVNSVAFS
                     FRGMEVPVESLKELVDETKKCLIDAKKNKQNHFLLIQKANIQARKQAMIDEGKTIIHL
                     ASGAAGAAGLIPIPFSDALAIAPIQAGMIYKMNDAFGVKIEDSVAASLIIGLLGVTAV
                     AQVGRTLVNGLLKFIPVAGSIVGSVAGGATAATITEGIGFAYLKVLEKCFNDETGEVE
                     LPAMDTIKSLFKESYLSLDTIKKLKP"
     gene            654749..655894
                     /locus_tag="HPSH112_RS08275"
                     /old_locus_tag="HPSH112_03285"
     CDS             654749..655894
                     /locus_tag="HPSH112_RS08275"
                     /old_locus_tag="HPSH112_03285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207537.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein RodA"
                     /protein_id="WP_014662229.1"
                     /translation="MALDKRIWMHFDFLPFVFVIPLLVVSFLLIFESSAVLSLKQGVY
                     YAIGFLLFWIVFFIPFRKLDRWLFVFYWACVILLALVDFMGSSKLGAQRWLVIPFTSI
                     TLQPSEPVKIAILLLLAHLIKINPPPFKGYDWGMFLKLSFYICLPAALILKQPDLGTA
                     LIVLIMGFGILLIVGLRTRVWLPLFIALLVASPIAYHFLHDYQKKRIADFLSEKPSYH
                     VMQSIIAIGSGGFLGKSKEACTQTKFKFLPIATSDFIFAYFVERFGFLGAMLLFAIYI
                     GLSLHLFFYMFESNSDWFLKIVALGISILIFVYSSVNIAMTLGLAPVVGIPLPLFSYG
                     GSSFITFMILFGILENLLAFRYIFGYNSKPSFGNFGFLAQLVRALGS"
     gene            655856..655932
                     /locus_tag="HPSH112_RS03230"
                     /old_locus_tag="HPSH112_t08208"
     tRNA            655856..655932
                     /locus_tag="HPSH112_RS03230"
                     /old_locus_tag="HPSH112_t08208"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:655890..655892,aa:Met,seq:cat)
     gene            complement(655945..656901)
                     /locus_tag="HPSH112_RS03235"
                     /old_locus_tag="HPSH112_03290"
     CDS             complement(655945..656901)
                     /locus_tag="HPSH112_RS03235"
                     /old_locus_tag="HPSH112_03290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207536.1"
                     /note="catalyzes the formation of 5-phospho-alpha-D-ribose
                     1-phosphate from D-ribose 5-phosphate and ATP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose-phosphate pyrophosphokinase"
                     /protein_id="WP_000647450.1"
                     /translation="MKARGFKTKMRGFKIFSGSAHPAFGKEVSKHLGIPLSKAVIGKF
                     SDGEINIQISESVRGKDIFIIQPTCVPVNDNLMELLVMVDALRRSSANSITAVLPYFG
                     YARQDRKAAPRVPITAKMVANLMQEVGIERIITMDLHAGQIQGFFDVPVDNLYGSIVF
                     RDYIRSKALKNPVIASPDVGGVTRARYFANQMGLDLIIVDKRREKANESEVMNIIGSA
                     KERDVILVDDMIDTAGTICKAALALKEQGATSVMALGTHAVLSGNAIKRIKESALDEV
                     VATNSIPLVQKCDKITTLSVAPLFAEVIRRIYHNESVQSLFT"
     gene            complement(656966..657451)
                     /locus_tag="HPSH112_RS03240"
                     /old_locus_tag="HPSH112_03300"
     CDS             complement(656966..657451)
                     /locus_tag="HPSH112_RS03240"
                     /old_locus_tag="HPSH112_03300"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207535.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_001164326.1"
                     /translation="MQHLYAPWRESYLKEKDKGCVFCEISQNPTKDSENRVLYRNSDL
                     FVVMNAYPYNPGHLLIIPHVHKASVELLELNTWLNMNALAPKALKALYAYGAQGINLG
                     LNLHRNAGAGIPEHLHMHLVPRFLGDSNFISVIAQTRVCGIDLNETYLTLKNLLEKEL
                     G"
     gene            complement(657461..658942)
                     /locus_tag="HPSH112_RS03245"
                     /old_locus_tag="HPSH112_03305"
     CDS             complement(657461..658942)
                     /locus_tag="HPSH112_RS03245"
                     /old_locus_tag="HPSH112_03305"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207534.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-MurNac-pentapeptide presynthetase MurF"
                     /protein_id="WP_001191318.1"
                     /translation="MQSLSWLNLAFRWLFITGLGYYIMTLLQWYHYSVFRILTKHHKM
                     RWHGIYFLLPLGVFILSYAFTMPFVFDFFCGVIQMPMLIVWAKRNDKPLVFTPRVKRF
                     FIFLLLFLILHEILNTELVPLNGISLVLAYLCLFIFVLNASLIFEKVLSKQYLQTAKD
                     KIASLKNLKVIAITGSFGKTSIKNFLLQILQTTFNAHASPKSVNTLLGLANDINQNLD
                     DRSDIYIAEAGARNKGDIKEITRLIEPHLAVVAEVGEQHLEYFKTLENICETKAELLD
                     SKRLEKAFCYSVEKIKPYAPKDSPLIDYSSLVKNIQSTLKGTSFEMLIGSVWESFETK
                     VLGKFNAYNIASAILIAKHLGLETERIKRLVLELNPIAHRLQLLEVNQKIIIDDSFNG
                     NLKGMLEGIRLASLYEGRKVIVTPGLVESNTESNETLAQKIDEVFDVAIITGELNSKT
                     IASQLKTPQKILLKDKAQLENILQATTIQGDLILFANDAPNYI"
     gene            complement(658929..659651)
                     /locus_tag="HPSH112_RS03250"
                     /old_locus_tag="HPSH112_03310"
     CDS             complement(658929..659651)
                     /locus_tag="HPSH112_RS03250"
                     /old_locus_tag="HPSH112_03310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxy-6-oxohepta-2,4-dienoate hydrolase"
                     /protein_id="WP_001129425.1"
                     /translation="MAKRSIAYLDSVFDISYTFIDHHSPLNALFLHGWGSSKEIMQQA
                     FQGCFLNYNHLYVDLPGFNQSPNDEKVLETKDYANIINSFLKSVDKKAHVVFGHSFGG
                     KVAILCENERIVLLSSAGILEPKPLKVRCKILLAKIVKKLGLNLGFLRSKDAMGLNQA
                     MYETFKKVVSEDFSDHFKRCEKEVLLFWGKDDKATPLSSAQKMQTLLKRSALFVLEGD
                     HFFFLNQAKEIEKLVENHHAKS"
     gene            complement(659651..660694)
                     /locus_tag="HPSH112_RS03255"
                     /old_locus_tag="HPSH112_03315"
     CDS             complement(659651..660694)
                     /locus_tag="HPSH112_RS03255"
                     /old_locus_tag="HPSH112_03315"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine--D-alanine ligase A"
                     /protein_id="WP_000393614.1"
                     /translation="MEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHF
                     YLIEESNMHSKYFAQIKEKKLPPLILTRNGLLKNSFLGAKIIELPLVINLVHGGDGED
                     GKLASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLGIKALDHVLLNEKNRANALN
                     LIGFNFPFIVKPNNAGSSLGVSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNL
                     AGCKIKKDFCFSYIEEPNKQEFLDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLY
                     NDLFDGALIRCDFFVIENEVYLNEINPIPGSLANYLFDDFKTTLENLAQSLPKTPKIP
                     IKNSYLLQIQKNK"
     gene            complement(660772..661248)
                     /locus_tag="HPSH112_RS03260"
                     /old_locus_tag="HPSH112_03320"
     CDS             complement(660772..661248)
                     /locus_tag="HPSH112_RS03260"
                     /old_locus_tag="HPSH112_03320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphatase A"
                     /protein_id="WP_001032176.1"
                     /translation="MNKFSLRACFLTLFFSGYSKKAPGTIGSLVALLLGLPVLIFSAN
                     TLFLAAVFIGLIAIAQIDKEEEESKIHDSSYIVIDELVGMWLAMAISGLSLAGVILSF
                     IFFRIYDITKPSLIGKIDKEVKGGLGVVADDALAGVLAGLSALLVINILGFFNIKL"
     gene            661397..662506
                     /locus_tag="HPSH112_RS03265"
                     /old_locus_tag="HPSH112_03325"
     CDS             661397..662506
                     /locus_tag="HPSH112_RS03265"
                     /old_locus_tag="HPSH112_03325"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase"
                     /protein_id="WP_014661960.1"
                     /translation="MLLFTPGPVAISEEMRSSFSQPMPHHRTKDFEKIFQSVRENLKK
                     MTGLEEVLLLSSSGTGAMEASVVSLCQKELLFVNAGKFGERFGKIAKAHSIKAHELVY
                     EWDTPAQVDGILNALKANPNIDAFCIQACESSGGLRHPVEKIAQAIKETNPNIFVIVD
                     AITALGVEPLEITHIDALIGGSQKAFMLPPAMSLIALSQKAIERIEERNVGFYFNLKS
                     ELKNQRNNTTSYTAPILHTLGLQRYFELVQNLGGFEALYKETKRVALATQKAVLALGL
                     KIFPKSPSLSMTTIVSEHAKELRNLLKEKYQVQFAGGQEPYKDALIRINHMGIIPVYK
                     SAYALNALELALNDLKLREFDGVANTTFLKQYYEI"
     gene            662515..662976
                     /locus_tag="HPSH112_RS03270"
                     /old_locus_tag="HPSH112_03330"
     CDS             662515..662976
                     /locus_tag="HPSH112_RS03270"
                     /old_locus_tag="HPSH112_03330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207529.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_000559497.1"
                     /translation="MHYSYETFLKDSLKLVKQVERICGVPEALVCVMRGGMTLVHFLS
                     LHWNLREVYGINAISYDTTNRQNALKIENIPTIKERLKTILVVDEIVDSGNSLEAVLQ
                     VLEDKHPDKKFYSASLFQKTSAKYKADAFLKDAPEWIDFFWEVDLKNLKSH"
     gene            662978..664297
                     /locus_tag="HPSH112_RS03275"
                     /old_locus_tag="HPSH112_03335"
     CDS             662978..664297
                     /locus_tag="HPSH112_RS03275"
                     /old_locus_tag="HPSH112_03335"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12 methylthiotransferase
                     RimO"
                     /protein_id="WP_001165904.1"
                     /translation="MQIKENKQLCLISLGCSKNLVDSEVMLGKLYNYTLTNDTKSADV
                     ILINTCGFIESAKQESIQTILNAAKDKKKGAILIASGCLSERYKDEIKELIPEVDIFT
                     GVGDYDKIDIMIAKKQNQFSEQVFLSEHYNARIITGSSVHAYVKISEGCNQKCSFCAI
                     PSFKGKLQSRELDSILKEVQDLALKGYTDMTFIAQDSSSFLYDKGQKDGLIQLIKAID
                     KQQALKSARILYLYPSSTTLELIGAIESSPIFQNYFDMPIQHISDSMLKKMRRNSSQA
                     HHLKLLNAMKQVKESFIRSTIIVGHPEENEGEFEELSAFLDEFRFDRLNIFAFSAEEN
                     THAYSLEKVPKKIINARIKALNKIALKHQNNSFKALLNKPIKALVENKEGEYFYKARD
                     LRWAPEVDGEILINDSELATPLKPGHYTIMPSAFKDNILLAKVLSPF"
     gene            664669..665877
                     /locus_tag="HPSH112_RS03290"
                     /pseudo
     CDS             664669..665877
                     /locus_tag="HPSH112_RS03290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015087323.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            665874..667639
                     /locus_tag="HPSH112_RS03295"
                     /pseudo
     CDS             665874..667639
                     /locus_tag="HPSH112_RS03295"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001006156.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="labile enterotoxin output A"
     gene            667688..668005
                     /locus_tag="HPSH112_RS03300"
                     /old_locus_tag="HPSH112_03375"
     CDS             667688..668005
                     /locus_tag="HPSH112_RS03300"
                     /old_locus_tag="HPSH112_03375"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000491680.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000491674.1"
                     /translation="MFSKICSSFKLANLFKGFLFKRIASPMQSTRIVNMILNIKNALE
                     SENDPSNKIGKTLDLIVGFKKENPQDFDELFQILKELIQEYEKNPEEVKQNLTEILKK
                     GKA"
     gene            668002..669069
                     /locus_tag="HPSH112_RS03305"
                     /old_locus_tag="HPSH112_03380"
     CDS             668002..669069
                     /locus_tag="HPSH112_RS03305"
                     /old_locus_tag="HPSH112_03380"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001016109.1"
                     /translation="MNHLLILYNPYYQRDVIQQHLSVLQEKSQVGFGKIRSKLNDQEK
                     HHSLEEIYKATNEKNFLQLFLTDYANLFVAKVIKVSKDIDEDLIPSYYKEKNLEVEDF
                     FIISDLRELVREDFSLLRDQFLANFIAPNNHTYAIYGNNYVYPLPVRLKEERSYFLGD
                     GKHYLSVYKSKEYLIMQENFMRFVFGKRLFYLLHPDSINNIIHAELELLQSENDLLND
                     FTSIIVKYSKTLEYEIYLFAKKVLLKACAKDLNLYDLDYKVQGKSLILEDFFTQKPNL
                     GSVKFLLRHEKIQYHLEENLNRFINYPFSKSLSLIQDIRNEAVYEKAPSLHEVEKLRN
                     EILGIEGMSLLKSILTRREVS"
     gene            669085..670116
                     /locus_tag="HPSH112_RS03310"
                     /old_locus_tag="HPSH112_03385"
     CDS             669085..670116
                     /locus_tag="HPSH112_RS03310"
                     /old_locus_tag="HPSH112_03385"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000930460.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA(Ile)-lysidine synthetase"
                     /protein_id="WP_000930470.1"
                     /translation="MLNADLIARDFKTYLEPLREKKNLLGFSGGLDSTCLFHLLVEEN
                     IAFDIALVDYNTQKQRLEIIQHAQKLAQTHHKKCYVHYAPKIERNFEMQARKIRYDFF
                     ETLIKEHSYKHLILAHHLNDRLEWFLMQLSKGAGLNTLLSFQAYEKRGFYAIVRPLLY
                     TPKETLKTLAKDWEFFEDSSNSSLKFKRNFFRKNYANSLMQHYSKGIIQSFKFLDKEK
                     EWLYPLMVVSQMHGITFFKYSQNTLFMVDKILKQKGYVLSFSQKEEIKRNFFSLEIAQ
                     KFIIEKNKEHAFIALKPQKTLSMPKDFKDKARRLNIPKRLRPVLYAEFLKQPTHDFLT
                     RFKQSLTDL"
     gene            670221..671207
                     /locus_tag="HPSH112_RS03315"
                     /old_locus_tag="HPSH112_03390"
     CDS             670221..671207
                     /locus_tag="HPSH112_RS03315"
                     /old_locus_tag="HPSH112_03390"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase"
                     /protein_id="WP_000346087.1"
                     /translation="MDFKNKKWLFLAPLAGYTDLPFRSVVKKFGVDVTTSEMVSSHSL
                     VYAFDKTSKMLEKSHLEDHFMAQISGSKEGVVKEAVEKINALEHVSGIDFNCGCPAPK
                     VANHGNGSGLLKDLNHLVKLLKIIRENTNKKITSVKVRLGFDQKIPKEIAHALNDAPV
                     DYVVVHGRTRSDKYQKEKIDYKSIALMKGILKKPVIANGEIDSVKKAFEVLQITQADG
                     LMIGRAALRAPWIFWQIRNNTTELPAVVKKDLVLEHFDKMVEFYGDRGVIMFRKNLHA
                     YAKGEMQASAFRNCVNTLTEVKSMRESIEEFFNQEMLQSEVPLWVELNQKSV"
     gene            671177..672094
                     /locus_tag="HPSH112_RS03320"
                     /old_locus_tag="HPSH112_03395"
     CDS             671177..672094
                     /locus_tag="HPSH112_RS03320"
                     /old_locus_tag="HPSH112_03395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000532502.1"
                     /translation="MGRIESKKRLKALVFLASLGVLWGNAAEKTPFFKTKNHIYLGFR
                     LGTGANVSTSMWQQAYKDNPTCPSSVCYSEKLEAHYKGGKNLSYTGQIGDEIAIDKYH
                     ILGLRVWGDIEYAKAQLGQKVGGNTLLSQANYNPSAIKTYDSASNTQGSLNLQKTPNP
                     QDFLFNNGHFMAFGLNVNVFVNLPIDTLLKLALKTEKMLFFKIGVFGGGGVEYAILWS
                     SQYKNQNTHQDDKFFAAGGGFFVNFGGSLYIGKRNRFNVGLKIPYYSLSAQSWKNFGS
                     SNVWQQQTIRQNFSVFRNKEVFVSYAFLF"
     gene            672372..674249
                     /locus_tag="HPSH112_RS03325"
                     /old_locus_tag="HPSH112_03400"
     CDS             672372..674249
                     /locus_tag="HPSH112_RS03325"
                     /old_locus_tag="HPSH112_03400"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024703.1"
                     /translation="MSAGYQIGEAVQMVKNTGELKNLNEKYEQLNQYLNQVASLRQSI
                     QNANNIDLVNSSLNYLKSFTENNYNSTTQSPIFNAVQAVITSVLGFWSLYAGNYLTFF
                     VGNKDSKQPANVQGNPPFSTITKNCSGIENCAMDQTTYDKMKKLAEDLQAAQTNSATK
                     ANNLCALSGCTATQGQSPSSTVSNALNLAQQLMDLIANTKTAMMWDNIVIAGVSNASG
                     AITSTNYPTQYAVFNNIKAMIPILQQAVTLSQSSNTLSAGLQAQATGSQTNPQFAKDI
                     YNLAQNQKQVISYAKDIFNLFNSIPKDQYRYLEKAYLKIPNAGSTPTNPYRQEVNLNQ
                     EIQTIQNNVSYYGNRLDSALSVAKDVYNLKSNQAQIGVAYSGAKNLSEEISQLPYNQV
                     NTKDIITPPYDKNAPAAGQYNYQINQEQASNLSQALAAMSNNPFKNIGMISSQNNNGA
                     LNGLGVQVGYKQFFGESKRWGLRYYGFFDYNHGYIKSSFFNSSSDIWTYGVGSDLLVN
                     FINDSVTRKNNKLSVGLFGGIQLAGTTWLNSQYVNLTAFNNPYSAKVNTSNFQFLFNL
                     GLRMNLATAKKEDSEHSAQHGIELGIKIPTINTNYYSFLGAKLEYRRLYSVYLNYVFA
                     Y"
     gene            complement(674324..675655)
                     /locus_tag="HPSH112_RS03330"
                     /old_locus_tag="HPSH112_03405"
     CDS             complement(674324..675655)
                     /locus_tag="HPSH112_RS03330"
                     /old_locus_tag="HPSH112_03405"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate ABC transporter"
                     /protein_id="WP_000227244.1"
                     /translation="MVDAFFQIVVLLFSLFLGARLGGLGVGYAGGLGVLVLCLFLGLN
                     PGKIPFDVILIIMAVISAISAMQKAGGLDYLVKIAEKILRKHPKQINYLAPSVAYCLT
                     ILAGTGHTVFSLIPVIVEVSQSQNIKPKAPLSLAVVSSQVAITASPVSAAVVFMSGIL
                     EPLGADYLTLLMVWIPTTFLACMITAFVMGFTDLRLDSDPNYLERLKARKISLPTIKE
                     EKETSKSAKLSLWIFIGGVVAIVFYASAISKNIALINPVVLGRDYAIVSFMLSVATLI
                     VLFCKINANEIAHSSVFKSGMQACVCVLGVAWLGDTFVSNHLDEIKRYASFLIADYPF
                     LLAVALFLASMLLYSQAATSKALIPSVITALGISANHTEHLYIIVASFASVSALFVLP
                     TYPTLLGAIAMDNTGTTKMGRYVFDHAFLIPGVLVVSLSVALGFVVAPLVL"
     gene            675741..676733
                     /gene="ansB"
                     /locus_tag="HPSH112_RS03335"
                     /old_locus_tag="HPSH112_03410"
     CDS             675741..676733
                     /gene="ansB"
                     /locus_tag="HPSH112_RS03335"
                     /old_locus_tag="HPSH112_03410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207517.1"
                     /note="catalyzes the formation of aspartate from
                     asparagine, periplasmic; regulated by cyclic AMP receptor
                     protein (CRP) and also induced by anaerobiosis; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-asparaginase"
                     /protein_id="WP_000068343.1"
                     /translation="MAQNLPTIALLAMGGTIAGSGVNASLGSYKSGELGVKELLKAIP
                     SLNRLARIQGEQISNIGSQDMNEEVWFKLAKRAQELLDDSRIQGVVITHGTDTLEESA
                     YFLNLVLRSTKPVALVGAMRNFASLSADGALNLYNALSVATNEKSANKGVLVVMDDNI
                     FSAREVAKTHTTHTSTFKALNSGAIGSVYYGKTRYYMQPLRKHTTESEFSLSQLKTPL
                     PKVDIIYTHAGMTLDLFQASLNSHAKGVVIAGVGNGNVSAGFLKAMQEASKMGVVIVR
                     SSRVGSGGINSGEIDDKTFITSDNLNPQKARVLLQLALTKTNDKAKIQEMFEEY"
     gene            complement(676951..677147)
                     /locus_tag="HPSH112_RS08280"
                     /pseudo
     CDS             complement(676951..677147)
                     /locus_tag="HPSH112_RS08280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014534546.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(677266..677736)
                     /locus_tag="HPSH112_RS03340"
                     /old_locus_tag="HPSH112_03420"
     CDS             complement(677266..677736)
                     /locus_tag="HPSH112_RS03340"
                     /old_locus_tag="HPSH112_03420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc ABC transporter substrate-binding protein"
                     /protein_id="WP_000709594.1"
                     /translation="MKKALKILSVSALLFVALNAKDFSKTSDEDLAKMAGIVAPQDIV
                     DYKKELRMRMKKMPKDKREAFHKQLHEYAIKNTDNMTVADFEAHKKAVKEALKKSNMK
                     DMDDDLGLRSCKHGKMHKHHKHDGQNKAKGHDKGHGEEQGKKDHDHDDHGENEK"
     gene            complement(677765..678187)
                     /locus_tag="HPSH112_RS03345"
                     /old_locus_tag="HPSH112_03425"
     CDS             complement(677765..678187)
                     /locus_tag="HPSH112_RS03345"
                     /old_locus_tag="HPSH112_03425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001232179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001254628.1"
                     /translation="MRRSLAFCLLALLGLQVLGARDFSQLKDKELLELAGTLPSNEAI
                     DYRMEVSKRLKALNAEDAKKFRANFSRIAKKNLSKMSEEDFKKMREEVRKELEEKTKG
                     LSAEEIKAKGLNVSVCSGDTRKVWCRAVKKKDEHCSPK"
     gene            678454..679086
                     /locus_tag="HPSH112_RS03350"
                     /old_locus_tag="HPSH112_03430"
     CDS             678454..679086
                     /locus_tag="HPSH112_RS03350"
                     /old_locus_tag="HPSH112_03430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207512.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000498359.1"
                     /translation="MFVVFIEGFGLAISLCAAVGAQSLFIIERGMARNYVFLICTLCF
                     MCDIVLMSMGVFGVGAYFAKNLYLSLFLNLFGAAFTGFYAFLALKTLFQTFKKKQVQT
                     PKKLSLKKTLLFTLGVTLLNPQVYLEMVFLIGASALSFNLAQKFVFLAGTLSAALSWL
                     LLLCTLSLRYGSKLLNNQKIFMGVNLFVTAIMGTLSVTLFRDFLALLSKT"
     gene            679155..680852
                     /locus_tag="HPSH112_RS03355"
                     /old_locus_tag="HPSH112_03435"
     CDS             679155..680852
                     /locus_tag="HPSH112_RS03355"
                     /old_locus_tag="HPSH112_03435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207511.1"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the tau chain serves as a
                     scaffold to help in the dimerizaton of the alpha,epsilon
                     and theta core complex; the gamma chain seems to interact
                     with the delta and delta' subunits to transfer the beta
                     subunit on the DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_001197455.1"
                     /translation="MQVLALKYRPKHFSELVGQESMAKTLSLALDNQRLANAYLFSGL
                     RGSGKTSSSRIFARALMCEKGPKAVPCDTCTQCQSALNNHHIDIIEMDGASNRGIDDV
                     RNLIEQTRYKPSFGRYKIFIIDEVHMFTTEAFNALLKTLEEPPSHVKFLLATTDALKL
                     PATILSRTQHFRFKKIPENSVISHLKTILEKEQVSYETSALEKLAHSGQGSLRDTITL
                     LEQAINYCDNAITESKVAEMLGAIDRSVLEDFFQSLINQDEARLQERYAILENYETES
                     VLEEMMLFLKAKLLSPDAYSILLIERFFKIIMSGLSLLKEGANASFVLLLLKMKFKEA
                     LKLKALDDAILELEQSKESVLKPLNQNANAFKQEPKNAEKIEKPEKRENTETPQTPML
                     SAKDRIFHNLFKQVQTLVYERNYELGAVFEKNIRFIDFDSQTKTLTWESLATHKDKEL
                     LRERFKIVKSIVDGVFGKGETIKIALKNYSENKSALEVVKGFKFPYLKPKPTTETTAE
                     MKEKETKEKEIKENDTKEVQETQPKETPTALQEFMANHSDLIEEIRSEFEIKSVELL"
     gene            680849..681250
                     /locus_tag="HPSH112_RS03360"
                     /old_locus_tag="HPSH112_03440"
     CDS             680849..681250
                     /locus_tag="HPSH112_RS03360"
                     /old_locus_tag="HPSH112_03440"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207510.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (adenosine(37)-N6)-threonylcarbamoyltransferase complex
                     ATPase subunit type 1 TsaE"
                     /protein_id="WP_001201266.1"
                     /translation="MRAHLDELDKVAAAILKDDFKGVVLLKGVVGSGKTTLVQACLKH
                     LGLDIQATSPTFSLMHAYSESVFHYDFYMRDLEACLELGMLECLLEKGIHFVEWGDEK
                     LEKILKKYDLAIKVVEIKTELTSRFYTIKIA"
     gene            681263..681985
                     /locus_tag="HPSH112_RS03365"
                     /old_locus_tag="HPSH112_03445"
     CDS             681263..681985
                     /locus_tag="HPSH112_RS03365"
                     /old_locus_tag="HPSH112_03445"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000353224.1"
                     /translation="MDILKAEHLNKQIKKTKIVSDVSLEVKSGEVVGLLGPNGAGKTT
                     TFYMICGLLEPSGGSVYLNDVDLAKYPLHKRSNLGIGYLPQESSIFKELSVEDNLALA
                     GESTFKNSKESEEKMESLLDAFNIQAIRERKGMSLSGGERRRVEIARALMKNPKFVLL
                     DEPFAGVDPIAVIDIQKIIESLIGLNIGVLITDHNVRETLSVCHRAYVIKSGTLLASG
                     NANEIYENALVRKYYLGENFKV"
     gene            681988..683232
                     /locus_tag="HPSH112_RS03370"
                     /old_locus_tag="HPSH112_03450"
     CDS             681988..683232
                     /locus_tag="HPSH112_RS03370"
                     /old_locus_tag="HPSH112_03450"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207508.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma-54 factor"
                     /protein_id="WP_000279770.1"
                     /translation="MAVLRANLSPKNKLNATLKGWLPILQSELEDLEEVLKQNALDNP
                     LIKIENKRIKNFSDRFSAKSSSDHLENFAIASKSLFETLEAQIIPPLFPTETSQKIAM
                     DIINGLDSEGYFEENIEERARILGVESEVYEKVRQRFSCLNPAGIGAKDVKESFLFQL
                     EGRELDDNELYEEARKIILNLEKHHEFSKDFYYEKALKILKSFKNPPAIEFLEKEIEV
                     IPELFILEVDNEIIVRLNDESYPTISLEENRFKDSAYLKEKLKEAKDLIDALNLRKAT
                     IYKIGLMLLEYQYDFFKGKELRPLKLLDLANEFNHSVSTISRAISNKYLACQRGVFPI
                     KHFFSTALDNSETSNAVIKDYLLELIKNEDKKEPLSDAKILELIEEKFHLKMVRRTIT
                     KYRQLLNIASSSERKKLYLMRA"
     gene            683545..684465
                     /locus_tag="HPSH112_RS03375"
                     /old_locus_tag="HPSH112_03455"
     CDS             683545..684465
                     /locus_tag="HPSH112_RS03375"
                     /old_locus_tag="HPSH112_03455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000752062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000709691.1"
                     /translation="MKKALLLSLSLSLSFWLHAERNGFYLGLNFAEGSYIQGQGSIGE
                     KASAENALNQAINNAKNSLFPEQNTKAIRDAQNALNEVKDSKKIANRFAGNGGSGGLF
                     NELSFGYKYFLGKKRIIGFRHSLFFGYQLGGVGSVPGSGLIVLLPYGFNTDLLINWTN
                     DKRASQEYVERRVKGLSIFYKDMTGRTLDANTLKKASRHVFRKSSGLVIGMDIGASTW
                     FASNNLTPFNQVKSHTIFQLQGKFGIRYNSDEYDIDRYGDEIYLGGSSVELGVKVPAF
                     KVNYYSDNYGDKLDYKRVVSVYLNYTYNFK"
     gene            complement(684582..685802)
                     /locus_tag="HPSH112_RS03380"
                     /old_locus_tag="HPSH112_03460"
     CDS             complement(684582..685802)
                     /locus_tag="HPSH112_RS03380"
                     /old_locus_tag="HPSH112_03460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein ComGF"
                     /protein_id="WP_000270532.1"
                     /translation="MYAAHPIKLLKAPKLKTKFLRRVFVGASIRRWNDQACPLEFVEL
                     DKQAHKAMIAYLLAKDLKDRGKDLDLDLLIKYFCFEFLERLVLTDIKPPIFYALQQTH
                     SQELASYVAQSLQDEISAYFSLEELKEYLSHRPQVLETQILESAHFYASKWEFDIIYH
                     FNPNMYGVKEIKDKIDKQLHNNEHLFEGLFGEKEDLKKLVSMFGQLRFQKRWSQTPRV
                     PQTSVLGHTLCVAIMGYLLSFDLKACKSMRINHFLGGLFHDLPEILTRDIITPIKQSV
                     AGLDNCIKEIEKKEMQNKVYSFVSLGVQEDLKYFTENEFKNRYKDKSHQIIFTKDAEE
                     LFTLYNSDEYLGVCGELLKVCDHLSAFLEAQISLSHGISSNDLIKGAQNLLELRSQTE
                     LLDLDLGKLFRDFK"
     gene            complement(685989..686176)
                     /locus_tag="HPSH112_RS03385"
                     /old_locus_tag="HPSH112_03465"
                     /pseudo
     CDS             complement(685989..686176)
                     /locus_tag="HPSH112_RS03385"
                     /old_locus_tag="HPSH112_03465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001133081.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
     gene            complement(686249..687151)
                     /locus_tag="HPSH112_RS03390"
                     /old_locus_tag="HPSH112_03470"
     CDS             complement(686249..687151)
                     /locus_tag="HPSH112_RS03390"
                     /old_locus_tag="HPSH112_03470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207503.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase"
                     /protein_id="WP_000750991.1"
                     /translation="MKKTILALFLSACIGLSSVCASNALILQTDFSLKDGAVSAMKGV
                     AFSVDSNLKIFDLTHEIPPYNIWEGAYRLYQSASYWPQGSVFVSVVDPGVGTKRKSVV
                     LKTKNGQYFVSPDNGTLTLVAQTLGIDSVREIDEKANRLKGSEKSYTFHGRDVYAYTG
                     ARLASGAITFEQIGPELPAKVVEIPYQKAKATKGEVKGNIPILDIQYGNVWSNISDRL
                     LNQAGIKRNDILCVTISKGSKKKYEGKMPYVASFGDVLEGQPLVYLNSLLNVSVALNM
                     DNFAQKYQIKSGADWNIDIKKCAK"
     gene            complement(687396..687734)
                     /locus_tag="HPSH112_RS03395"
                     /old_locus_tag="HPSH112_03475"
     CDS             complement(687396..687734)
                     /locus_tag="HPSH112_RS03395"
                     /old_locus_tag="HPSH112_03475"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000021257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001091049.1"
                     /translation="MNTENILNQDHLMRIKESEKNALFDAITPKQEHGISLMALIGVL
                     VFGGAFLALLAPKIYLSNNIYYISRKINTLENQKRLLLEEQQILKNELEKERFKYYIE
                     NSENIGDIAF"
     gene            complement(687739..688671)
                     /locus_tag="HPSH112_RS03400"
                     /old_locus_tag="HPSH112_03480"
     CDS             complement(687739..688671)
                     /locus_tag="HPSH112_RS03400"
                     /old_locus_tag="HPSH112_03480"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001169162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA
                     (cytosine(1402)-N(4))-methyltransferase"
                     /protein_id="WP_001169162.1"
                     /translation="MQKIESLHQSVLLQEVLQAFTPLEEGVLIDCTLGLGGHSKALLS
                     QKPHLKLIGIDKDKFAQEIAKERLKAFEGRYNLLSGGFAKRFKEALETHNKEIKGVLV
                     DLGVSSLQLDDDNRGFNFHSHALDMRMDLEGDLNAQKVINSYPVVALEKIFKDYGEIK
                     EYKKIAHKIAERRAKKPFKDAKDLSDFLSSLSKNKKIHPATLVFQAVRIEVNSELEEL
                     KEFLQCARNLKGAILCVISFHSLEDALVKNAFKDYAKNCICDPSSFKCACSNNHALGE
                     ILTKKPITPSPEEIKNNRRSRSAKMRVFQFRPQA"
     gene            complement(688862..689683)
                     /locus_tag="HPSH112_RS03405"
                     /old_locus_tag="HPSH112_03485"
     CDS             complement(688862..689683)
                     /locus_tag="HPSH112_RS03405"
                     /old_locus_tag="HPSH112_03485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207500.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000395381.1"
                     /translation="MEFMKKFVALGLLSAVLSSSLLAEGDGVYIGTNYQLGQARLNSN
                     IYNTGDCTGSVVGCPPGLTANKHNPGGTNINWHSKYANGALNGFGLNVGYKKFFQFKS
                     FDMTSKWFGFRVYGLFDYGHADLGKQVYAPNKIQLDMVSWGVGSDLLADIIDKDNASF
                     GIFGGVAIGGNTWKSSAANYWKEQIIEAKGPDVCTPTYCNPNAPYSTNTSTVAFQVWL
                     NFGVRANIYKHNGVEFGVRVPLLINKFLSAGPNATNLYYHLKRDYSLYLGYNYTF"
     gene            689877..692684
                     /locus_tag="HPSH112_RS03410"
                     /old_locus_tag="HPSH112_03490"
     CDS             689877..692684
                     /locus_tag="HPSH112_RS03410"
                     /old_locus_tag="HPSH112_03490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207499.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-ATPase UvrA"
                     /protein_id="WP_041199833.1"
                     /translation="MDKIIIQGARENNLKNIFLEIPKNQFVVFTGLSGSGKSTLAFDT
                     LYAEGQRRYLESLSSYARQFLDKVGKPDVDKIEGLTPAIAIDQKTTSKNPRSTVGTIT
                     EIYDYLRLLFARIGEQFCPTCLEPISSMSASDIISQICHLEENSKIIILAPIIKDKKG
                     SFNDKLESLRLKGYVRAFVDGVMVRLDEEIHLHKTKKHTIEAVVDRVVINSENSSRIA
                     SAIEKALKESYGELEVEILQDNAPSIRKHYSEHKACFKCKMSFEELEPLSFSFNSPKG
                     ACESCLGLGTKFSLDISKILDPNTPLNQGAIKVIFGYNRSYYAQMFEGFCEYNGIDTA
                     LCFNELNKEQQDALLYGNGTEISFHFKNSPLKRPWKGIIQIAYDMFKEQKDLSDYMSE
                     KTCSSCEGHRLKASSLSVQVAGLKMADFLTKPIEEVYHFFNDPTHFSYLNEQEKKIAE
                     PILKEILERVFFLYDVGLGYLTLGRDARTISGGESQRIRIASQIGSGLTGVLYVLDEP
                     SIGLHEKDTLKLINTLRNLQKKGNTLIVVEHDKETIKHADFVVDIGPKAGRHGGEVVF
                     SGSVKDLLQNNHSTALYLNGTKKIERPKLELPKEKHFLEIKNVNINNIKNLSVQIPLK
                     QLVCITGVSGSGKSSLILQTLLPTAQTLLNHAKKIQSLNGVEIVGLEHLDKVIYLDQA
                     PIGKTPRSNPATYTGVMDEIRILFAEQKEAKILGYSASRFSFNVKGGRCEKCQGDGDI
                     KIEMHFLPDVLVQCDSCKGTKYNPQTLEIKVKGKSIADVLNMSVEEAYEFFAKFPKIA
                     VKLKTLIDVGLGYITLGQNATTLSGGEAQRIKLAKELSKKDTGKTLYILDEPTTGLHF
                     EDVNHLLQVLHSLVALGNSMIVIEHNLDIIKNADYIIDMGPDGGDKGGKVIASGTPLE
                     VAQNCEKTQSYTGKFLALELK"
     gene            complement(692792..693109)
                     /locus_tag="HPSH112_RS03415"
     CDS             complement(692792..693109)
                     /locus_tag="HPSH112_RS03415"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041199795.1"
                     /translation="MDRGPYNIEWLMRKYLEVGFRSCKVERIRETKFVIKFRYKKWGS
                     MIDREVKMQFPKYLKDSKREAVKITSRVFYELSKGPLFGNLLGKDPIQAILMRKGNNN
                     NNK"
     gene            complement(693102..693620)
                     /locus_tag="HPSH112_RS03420"
     CDS             complement(693102..693620)
                     /locus_tag="HPSH112_RS03420"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001911616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049760589.1"
                     /translation="MLANDFMVKKLKNKELHGLLCNKLSKRVDRFGYRAIGVGVDKET
                     SEVIVQLNRETIVRLNSKTALANGDNFMEGIFDEFNGLKANKEPQKPNSLYYGHGSSY
                     KIIDVLNDKDGDFINCKLFIVKELEVDECLGFYVPPMIDNNNTTLADLLENGEPAIYY
                     EANSANIRRFFG"
     gene            complement(693725..694870)
                     /locus_tag="HPSH112_RS03425"
                     /old_locus_tag="HPSH112_03505"
     CDS             complement(693725..694870)
                     /locus_tag="HPSH112_RS03425"
                     /old_locus_tag="HPSH112_03505"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207497.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_000684498.1"
                     /translation="MKIAIVEDDINMRKSLELFFELQDDLEIVSFKNPKDALAKLDES
                     FDLVITDINMPHMDGLEFLRLLEGKYESIVITGNATLNKAIDSIRLGVKDFFQKPFKP
                     ELLLESIYRTKKVLEFQKKHPLEKPLKKPHKHSFLAASKALEESKRQALKVASTDANV
                     MLLGESGVGKEVFAHFIHQHSQRSKHPFIAINMSAIPEHLLESELFGYQKGAFTDATA
                     PKMGLFESAHKGTIFLDEIAEMPIQLQSKLLRVVQEKEITRLGDNKSVKIDVRFISAT
                     NANMKEKIAAKEFREDLFFRLQIVPIVIAPLRERVEEILPIAEIKLKEVCDAYHLGPK
                     SFSKNAAKRLLEYSWHGNVRELLGVVERAAILSEGAEIQEKDLFLER"
     gene            complement(694867..695343)
                     /locus_tag="HPSH112_RS03430"
                     /old_locus_tag="HPSH112_03510"
     CDS             complement(694867..695343)
                     /locus_tag="HPSH112_RS03430"
                     /old_locus_tag="HPSH112_03510"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000984448.1"
                     /translation="MMRFFSFFYFLLYFLGVSLYALNPLENQEFLISYRLKIVDSRVI
                     GEEYSVSKPIVSRIKTAPYVLDYHCSIIIRNSPDLKESLLPVKLERFLLEIALKKEKE
                     RVIDCILKSQVAITHYDHSYKNGTTTTSILNLKALSVRASLVGDALFLDIFRKEEE"
     gene            complement(695340..697820)
                     /locus_tag="HPSH112_RS03435"
                     /old_locus_tag="HPSH112_03515"
     CDS             complement(695340..697820)
                     /locus_tag="HPSH112_RS03435"
                     /old_locus_tag="HPSH112_03515"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_001153690.1"
                     /translation="MQDNLINETKNIVEVGIDSSIEESYLAYSMSVIIGRALPDARDG
                     LKPVHRRILYAMHELGLTSKVAYKKSARIVGDVIGKYHPHGDNAVYDALVRMAQDFSM
                     RLELVDGQGNFGSIDGDNAAAMRYTEARMTKASEEILRDIDKDTIDFVPNYDDTLKEP
                     DILPSRLPNLLVNGANGIAVGMATSIPPHRIDEIIDALVHVLENPNAGLDEILEFVKG
                     PDFPTGGIIYGKAGIIEAYKTGRGRVKVRAKVHVEKTKNKEIIVLDEMPFQTNKAKLV
                     EQISDLAREKQIEGISEVRDESDREGIRVVIELKRDAMSEIVLNHLYKLTTMETTFSI
                     ILLAIYNKEPKIFTLLELLRLFLNHRKTIIIRRTIFELEKAKARAHILEGYLIALDNI
                     DEIVRLIKTSQSPEAAKDALMERFTLSEIQSKAILEMRLQRLTGLERDKIKEEYQNLL
                     ELISDLNGILKSEDRLNKVVKTELLEVKEQFSSQRRTEIQEVYENIDIEDLIANEPMV
                     VSMSYKGYVKRVDLKAYERQNRGGKGKLSGNTYEDDFIENFFVANTHDILLFITNKGQ
                     LYRLKVYKIPEASRIAMGKAIVNLISLAPDEKIMATLSTKDFSDERSLAFFTKKGVVK
                     RTNLSEFDSNYNGMRAIVLDEGDELVSAKIVDKNAKHLLIASYLGLFIKFPLEDVREI
                     GRSTRGVRGIRLNENDFVVGAVVINDDSNKLLSVSENGLGKQTLAEAYREQSRGGKGI
                     IGMKLTQKTGNLVSVISVDDENLDLMILTASAKMIRVSIKDIKETIGRNTSGVKLIDT
                     ADKVVYANSCPKEEEPENLENPPTQLFE"
     gene            complement(697840..698226)
                     /locus_tag="HPSH112_RS03440"
                     /old_locus_tag="HPSH112_03520"
     CDS             complement(697840..698226)
                     /locus_tag="HPSH112_RS03440"
                     /old_locus_tag="HPSH112_03520"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207494.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="WP_001279244.1"
                     /translation="MSDFKVPPKAKGFKRLFKALFYSKDGLKCAWVEESAFRQIAILA
                     LFCIVLASYLIKDFLEWGLLILPCFLSVVIELINSSIEKAVDFTSKEFHPLAKKAKDM
                     ASSAQLIGLIFWAFIWGRYLLTLYLE"
     gene            complement(698219..699247)
                     /locus_tag="HPSH112_RS03445"
                     /old_locus_tag="HPSH112_03525"
     CDS             complement(698219..699247)
                     /locus_tag="HPSH112_RS03445"
                     /old_locus_tag="HPSH112_03525"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000162092.1"
                     /translation="MTKKFMSWMVVIGALICVLLGVFIFFTSMSVKKSLTAYLNAYLD
                     QRPKIKGVGIVGAPFECEGFFKIACVSKEISFLDSQNSPIMDFKNLSIKLNSLDKSSL
                     VLSVHSQIKSPILEQSIQQKIHQIPLKDLNALLEKIKPTRLNCFLKFNALDEKTLNDH
                     LKCDLTNAENILAYTFFQEGLMEAQENLSLKNIFKTLSSKDAKAIEELQDKLRFLVPK
                     LGVSIQARHLKNLLDAFYHQNKESLGFFSPYFSLRSQTPSVSYESALASLEKYFMALF
                     QSHFKDDAKLQQNFKGLLQAFVSMAKDKRSQIALNAQAKDNAKLTFNALLESLSVNFF
                     QSYKISHE"
     gene            complement(699530..700036)
                     /locus_tag="HPSH112_RS03455"
                     /old_locus_tag="HPSH112_03530"
     CDS             complement(699530..700036)
                     /locus_tag="HPSH112_RS03455"
                     /old_locus_tag="HPSH112_03530"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetone carboxylase subunit gamma"
                     /protein_id="WP_000245380.1"
                     /translation="MVMSKYTQEQIKNLVEGNLDWNTVLKMLSMPKDHERFQMYLKVL
                     QDKVDFDDKIVLPLGPHLFVVQDPQKKWAIKCSCGHAFCAPEENWKLHANIYVRDTAE
                     KMEEVYPKLLASDTNWQVYREYICPDCGILLDVEAPTPWYPVIHDFEPDIEAFYKDWL
                     GIQPPERR"
     gene            complement(700047..702344)
                     /locus_tag="HPSH112_RS03460"
                     /old_locus_tag="HPSH112_03535"
     CDS             complement(700047..702344)
                     /locus_tag="HPSH112_RS03460"
                     /old_locus_tag="HPSH112_03535"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetone carboxylase subunit alpha"
                     /protein_id="WP_001285101.1"
                     /translation="MANLLKNGKTLKQARDEILARTEKTGHYNGLKKLEFKERDPIGY
                     EKMFSKLRGGIVHARETAKRIAASPIVEQEGELCFTLYNAVGDSVLTSTGIIIHVGTM
                     GSAIKYMVENNWEDNPGINDKDIFTNNDCAIGNVHPCDIMTLVPIFHDEKLIGWVGGV
                     THVIDTGSVTPGSMSTGQVQRFGDGYMITCRKTGANDESFKDWLHESQRSVRTPKYWI
                     LDERTRIAGCHMIRDLVMEVIKEDGIDSYMRFIDEVIEEGRRGLISRIKSMTIPGKYR
                     KVAFVDVPYAHKDIGVCSEFAKLDTIMHSPVEITINKDATWKLDFEGASRWGWHSFNC
                     NQVSFTSGIWVMMTQTLIPTSRINDGAYFATQFRLKKGTWMNPDDRRTGHAYAWHFLV
                     SGWSALWRGLSQAYYSRGYLEEVNSGNANTSNWLQGGGINQDGEIHAVNSFETSSCGT
                     GACAIKDGLNHAAAIWNPEGDMGDVEIWEMAEPLLYLGRNVKANTGGYGKYRGGNGFE
                     TLRMVWGAHDWTMFFMGNGYMNSDWGMMGGYPAASGYRFEAHNTDLENRIKNNASLPL
                     GGDFNPTDRDYEKHISHASQVKRDKQCITTENCFDNYDLYLNYIKGGPGFGDPIERDL
                     NAILEDLNSKQLLPEYAYKVYGAVVSQNKDGVWVGDEAKTKARRKEILENRKARSIPV
                     KQWMEQERNAILEKEASKQVKHMYATSFDLSPKFLNDFKTFWNLPKSWSVKEDELGVF
                     TYGSKYRMDLNKLPDVRTVVLVDEK"
     gene            complement(702356..704497)
                     /locus_tag="HPSH112_RS03465"
                     /old_locus_tag="HPSH112_03540"
     CDS             complement(702356..704497)
                     /locus_tag="HPSH112_RS03465"
                     /old_locus_tag="HPSH112_03540"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207489.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetone carboxylase subunit beta"
                     /protein_id="WP_000650533.1"
                     /translation="MKDAKVQVMGIDAGGTMTDTFFVKENGSFVVGKAQSNPEDESLA
                     IYNSSQDALSHWESDVNKVYPELVTCVYSGTAMLNRVVQRRGMEVGLICNKGFEQMHS
                     MGRALQSYLGYALEERLHINTHKYDDPLIPLKRIRGVTERTDVKGQVVIPVRPEEIKV
                     AVKELLEAGAKAIVICLLQSHKNAESERIVRDIALKEIEKLGKNVPVFASVDYYPQRK
                     ESHRMNTTILEAYAAEPSRQTLSKVSNRFKEHGAKFDLRVMATHGGTISWKAKELART
                     IVSGPIGGVIGSKLLGETLGYDNIACSDIGGTSFDMALIVKSNFNIASDPDMARLVLS
                     LPLVAMDSVGAGAGSFVRIDPHSRSVKLGPDSAGYRVGTCWKDSGLDTVSVTDCHIVL
                     GYLNPDNFLGGLIKLDVDRAKKHIKEQIADPLGISVEDAAAGVIELLDLELKEYLRSN
                     ISAKGYSPSDFVCFSYGGAGPVHTYGYTEGLGFKDVVVPAWAAGFSAFGCACADFEYR
                     YDKSVDIAIPQYSSDKSKVEACKIIQDAWDELTLKVIEEFKINGFSQKDVILRPGYRM
                     QYMGQLNDLEITSPVSKAASVADWEEIVKEYEKTYARVYSESACSPELGFSVTGVIMR
                     GVVATQKPVIPVEKEHGATPPKEAKIGVRKFYRHKKWVDADVWQMEKLLPGNEVIGPA
                     IVESDATTFVIPKGFATRLDKHRLFHLKEIK"
     gene            complement(704730..705731)
                     /locus_tag="HPSH112_RS03470"
                     /old_locus_tag="HPSH112_03545"
     CDS             complement(704730..705731)
                     /locus_tag="HPSH112_RS03470"
                     /old_locus_tag="HPSH112_03545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000465242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000465184.1"
                     /translation="MFFKFILCLLLGMFAWAKEDILTPLTPSKRYSINLMTENDGYIN
                     PYIDEYYTAGNQIGFSTKEFDFSKNKAMKWTSYLGFFNKSPRVTRFGISLAQDMYTPS
                     LENRKLVHLHDNHPYGGYLRVNLNVYNRHQTFMELFTLSLGTTGQDSLAAQTQHLIHK
                     WGHDPQFYGWNTQLKNEFIFELHYQLLKKVPLLKTRFFSMELMPGFNVELGNARDYFQ
                     LGSLFRAGYNLDADYGVNKVNTAFDGGMPYSDKFSIYFFVGAFGRFQPLNIFIQGNSP
                     ETRGIANLEYFVYASEIGAAMMWRSFRVAFTITDISKTFQSQPKHHQIGTLELNFAF"
     gene            complement(705853..707217)
                     /locus_tag="HPSH112_RS03475"
                     /old_locus_tag="HPSH112_03550"
     CDS             complement(705853..707217)
                     /locus_tag="HPSH112_RS03475"
                     /old_locus_tag="HPSH112_03550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain fatty acid transporter"
                     /protein_id="WP_000479474.1"
                     /translation="MFLLRHLTSACVFLASKCLPDSFVLVTLLSFIVFILVYGLTGQD
                     AFSVISSWGNGAWTLLGFSMQMALILVLGQALASAKLVQKLLKYLASLPKGYYAALLL
                     VTFLSLIANWINWGFGLVISAIFAKEIAKNVKGVDYRLLIASAYSGFVIWHGGLSGSI
                     PLSVATQNEDLSKISTGVIEKAIPISQTIFSAYNLIIIGIILVGLPFLMAIIHPKKEE
                     IVEIDAKLLKDEYKETELIDHQQDKTIAHFLENSALLSYLLVFLGFGYLGIYFFKGGG
                     ISLNIVNTIFLFLGILLHKTPLAYVKAINHSARSVAGILLQFPFYAGIMGMMASHSVG
                     GHSLAQMLSLAFTHIANEKTFALMTFLSAGIVNIFIPSGGGQWAIQAPIMLPAGQSLG
                     VDPGVVSMAIAWGDAWTNMIQPFWALPALAIAGLGAKDIMGYCVLTLIFVGLVVCGVF
                     YFLV"
     gene            complement(707236..707859)
                     /locus_tag="HPSH112_RS03480"
                     /old_locus_tag="HPSH112_03560"
     CDS             complement(707236..707859)
                     /locus_tag="HPSH112_RS03480"
                     /old_locus_tag="HPSH112_03560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA--3-ketoacid-CoA transferase"
                     /protein_id="WP_001206275.1"
                     /translation="MREAIIKRAAKELKEGMYVNLGIGLPTLVANEVSGMNIVFQSEN
                     GLLGIGTYPLEGGVDADLINAGKETVTVVPGASFFNSADSFAMIRGGHIDLAILGGME
                     VSQNGDLANWMIPKKLIKGMGGAMDLVHGAKKVIVIMEHCNKYGESKVKKECSLPLTG
                     KGVVHQLITDLAVFEFFNNAMKLVELQEGVSLDQVREKTEAEFEVCL"
     gene            complement(707856..708554)
                     /locus_tag="HPSH112_RS03485"
                     /old_locus_tag="HPSH112_03565"
     CDS             complement(707856..708554)
                     /locus_tag="HPSH112_RS03485"
                     /old_locus_tag="HPSH112_03565"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-CoA--3-ketoacid CoA transferase subunit
                     A"
                     /protein_id="WP_001045153.1"
                     /translation="MNKVITDLDKALSALKDGDTILVGGFGLCGIPEYAIDYIYKKGI
                     KDLIVVSNNCGVDDFGLGILLEKKQIKKIIASYVGENKIFESQMLNGEIEVVLTPQGT
                     LAENLHAGGAGIPAYYTPTGVGTLIAQGKESREFNGKEYILEKAITGDYGLIKAYKSD
                     TLGNLVFRKTARNFNPLCAMAAKICVAEVEEIVPAGELDPDEIHLPGIYVQHIYKGEK
                     FEKRIEKITTRSAK"
     gene            complement(708565..709740)
                     /locus_tag="HPSH112_RS03490"
                     /old_locus_tag="HPSH112_03570"
     CDS             complement(708565..709740)
                     /locus_tag="HPSH112_RS03490"
                     /old_locus_tag="HPSH112_03570"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_001006951.1"
                     /translation="MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLK
                     PSDVDSVILGNVLSAGLGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDSI
                     MLGRDEVVVCGGVENMSAAPYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGIT
                     ADNVAQAYHISREEQDAFALQSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEY
                     PRETTLESLAKLKPAFKKDGSVTAGNSSGINDGASIIILCSAQKVQKLGLKTMATIKG
                     FGLGGCSPDIMGICPSIAIKNNLKNVKINLNDIDLFELNEAFAAQSIAVLKELELNPN
                     IVNVNGGAIAIGHPIGASGARILVTLLHEMKRSGHGVGCASLCVGGGQGLSVVVEQK"
     gene            complement(709989..710801)
                     /locus_tag="HPSH112_RS03495"
                     /old_locus_tag="HPSH112_03575"
     CDS             complement(709989..710801)
                     /locus_tag="HPSH112_RS03495"
                     /old_locus_tag="HPSH112_03575"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000882713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000882732.1"
                     /translation="MLCVFDIETIPSVSLCKEHFQLEENDALKICERSFEKQKEKSGS
                     EFLPLYLHEIISIAAVIGDDYGKFIKVGNFGQKHENKEDFASEKELLEDFFKYFNEKQ
                     PRLISFNGRGFDMPLLTLKALKYNLTLDAFYNQENKWENYRARYSEQFHLDLMDSLSH
                     YGSVRGLNLNGVCSMTNIPGKFDVSGDLVHAIYYNPHLSQKEKKGVIDSYCQSDALNT
                     YWLFLKYEVLKGALNKEQYLGLLSDFLEKFPKEKSYSSVFINALEKEIGEFA"
     gene            710938..712866
                     /locus_tag="HPSH112_RS03500"
                     /old_locus_tag="HPSH112_03580"
     CDS             710938..712866
                     /locus_tag="HPSH112_RS03500"
                     /old_locus_tag="HPSH112_03580"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferrous iron transporter B"
                     /protein_id="WP_014662235.1"
                     /translation="MEEIIVALVGQPNVGKSSLINALSNAHLKVGNFAGVTVDKMEVS
                     LIHKERQITIIDLPGTYALNDFTTEEKVTKDFLEKGQYDLILNVVDSTNLERNLALSA
                     QLLDTNKKMLLALNMWDEAQKEGIKINTEKLSQELGVVCVPTSARSKEDRLNTELLLD
                     EIVRLYSQNTTNNESIKVPFQSFKESLKYSQSAQRIAKLVISENKQNASFEHTYKIDK
                     ILMHKRYGIFIFLGFMFIIFSLSFLIGGGAQKALEAGFKFLSDSVKENVANEDLASLV
                     GDGIIGGVGATVSFLPLIVVLYFGISLLETTGYMSRVAFLLDGILHKFGLHGKSFIPL
                     ITGFGCSVPAYMATRTLQNYNERLITLFVIGFMSCSARLPIYVLFVGSFFPSSSAGFV
                     LFCIYILGAVVALVMAKLLKLSVFKGQTESFIMEMPKYRFPSWRMVYFSIYTKSLSYL
                     KKAGTYILVGAILIWFMSQYPKSDAAMKTYKQESSLVDKDTTLSSEAKEEKLKELKTK
                     LDQKNLKNSIVGRGGAYLEKVFSPMDFDWRLSVSLVTGFMAKEVVVSTLGVLFSLGDQ
                     NEKSDAFREILRKEVSVPSGIAFIVFVMFYIPCFAATITFGREAGGIKFVAYLFIFTT
                     VVAYAFSLIAFYATQILV"
     gene            713107..715410
                     /locus_tag="HPSH112_RS03505"
                     /old_locus_tag="HPSH112_03585"
     CDS             713107..715410
                     /locus_tag="HPSH112_RS03505"
                     /old_locus_tag="HPSH112_03585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ligand-gated channel"
                     /protein_id="WP_000822118.1"
                     /translation="MKRILVSLVVLSHSAHAVKTHNLERVEASGVANDKEAPLSWRSK
                     EVRNYMGSRTVISNKQLTKSANQSIEEALQNVPGVHIRNATGIGAVPSFSVRGFGGGS
                     SGHSNTAMVLVNGIPIYVAPYVDISIPIFPVTFQSVDRISVTKGGESVRYGPNVFGGV
                     INVITKGIPTKWESQVSERATFWGKSENGGFFNQNSKNLDKSLANNMLFDTYLRTGGM
                     MNKHFGIQAQANWLKGQGFRYNSPTNIQNYMLDSLYQINESNKITAFFQYYNYFMADP
                     GSLGIAAYNQNRFQNNRPNNNKSGRAKRWGAVYQNFFGDTDKIGGDFTFSYYGHDMSR
                     DFQFDSNFLNVNTNPKLGPVYTDQNYAGFFIFDHLRRYIMNAFEPNLNLVVNTSKVKQ
                     TFNVGMRFMTMDMYFRLDQSTCEKTDIINGVCHMPPFVLSKKPSNNQNLFNNYTAVWL
                     SDKIELFDSKLVITPGIRYTFLNYNNKEPEKHDFSVWNITKKRQNEWSPGLNIGYKPM
                     ENWIWYANYRRSFIPPQHTMLGITRTNYNQIFNEIEVGQRYSYKNLLSFNTNYFVIFA
                     NRYYAGGYSPQPINARSQGVELELYYAPIRGLQFHVAYTYIDARITSNADDIAYYFTG
                     IVNKPFDIKGKRLPYVSPNQFIFDMMYTYKHTTFGISSYFYSRAYSSMLNQAKSQTVC
                     LPLNPEYTGGLEYGCNSVGLLPLYFVLNVQVSSVLWQSGRHKITGSLQINNLFNMKYY
                     FRGIGTSPTGREPAPGRSITAYLNYEF"
     gene            complement(715449..716195)
                     /locus_tag="HPSH112_RS03510"
                     /old_locus_tag="HPSH112_03590"
     CDS             complement(715449..716195)
                     /locus_tag="HPSH112_RS03510"
                     /old_locus_tag="HPSH112_03590"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001210302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliP"
                     /protein_id="WP_001210303.1"
                     /translation="MRFFIFLILICPLIYPLMSADSALPSVNLSLNAPNDPKQLVTTL
                     NVIALLTLLVLAPSLILVMTSFTRLIVVFSFLRTALGTQQTPPTQILVSLSLILTFFI
                     MEPSLKKAYDTGIKPYMDKKISYTEAFEKSALPFKEFMLKNTREKDLALFFRIRNLPN
                     PKTPDEVSLSVLIPAFMISELKTAFQIGFLLYLPFLVIDMVISSILMAMGMMMLPPVM
                     ISLPFKILVFILVDGFNLLTENLVASFKMV"
     gene            716283..717584
                     /locus_tag="HPSH112_RS03520"
                     /old_locus_tag="HPSH112_03600"
     CDS             716283..717584
                     /locus_tag="HPSH112_RS03520"
                     /old_locus_tag="HPSH112_03600"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001940572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional N-acetylglucosamine-1-phosphate
                     uridyltransferase/glucosamine-1-phosphate
                     acetyltransferase"
                     /protein_id="WP_000953665.1"
                     /translation="MLSVIILAAGKGTRMHSSLPKTLHTICGEPMLFYILETAFSISD
                     DVHLILHHQQERIKEAVLKRFKGVIFHTQIVEKYSGTGGAIMQEDKTPIPTQHEQVLI
                     LNADMPLITKDALAPLLKSHNNAIGLLHLADPKGYGRVILENHQVKKIVEEKDANDEE
                     KEIKSVNAGVYGFEREFLEKYLPKLHDQNAQKEYYLTDLIALGINENETIDAIFLEEE
                     CFLGVNSQTERAKAEEIMLERLRKNAMDLGVVMQLPSSIYLEKGVSFKGECVLEQGVH
                     LSGNCLIEDACIKAYSVIEESQIINSSVGPFAHARPKSVICNSHVGNFVETKNAKLQG
                     AKAGHLSYLGDCEIGKNTNVGAGVITCNYDGKNKHQTIIGENVFIGSDSQLVAPINIG
                     SNVLIGSGTTITKDIPSGSLSLSRAPQTNIENGYFKFFKKS"
     gene            717833..718183
                     /locus_tag="HPSH112_RS03525"
                     /old_locus_tag="HPSH112_03605"
     CDS             717833..718183
                     /locus_tag="HPSH112_RS03525"
                     /old_locus_tag="HPSH112_03605"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001981860.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041199796.1"
                     /translation="MKGFVMSGLKTFSCVVVLCGAMANTAIAGPRIEARGEFGRFWGG
                     AVGAGMGGAMGGIIGSLVGPWSTVVGAGIGGGIGAYSGAEIGDRVEDFIRGVDREPQT
                     PREPTYDRHFVYDR"
     gene            718207..718680
                     /locus_tag="HPSH112_RS03530"
                     /old_locus_tag="HPSH112_03610"
     CDS             718207..718680
                     /locus_tag="HPSH112_RS03530"
                     /old_locus_tag="HPSH112_03610"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_208081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001021870.1"
                     /translation="MNIKERLRISEYRWAVALVYGGCLSMGTGILYEINGSASDSTFD
                     PKNSYYMWLILLIAALLSNLLFDPRGRDCYKSFQVRYPRFLKAIFKARFFGAFYDAVL
                     GARLRDFYMVLSMMPFVVAMHEISAYCGHPSNFLVECLVILGLQCFLKLCTKLGW"
     gene            718847..721213
                     /locus_tag="HPSH112_RS03535"
                     /old_locus_tag="HPSH112_03615"
     CDS             718847..721213
                     /locus_tag="HPSH112_RS03535"
                     /old_locus_tag="HPSH112_03615"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase subunit
                     alpha"
                     /protein_id="WP_000633918.1"
                     /translation="MITVVKRNGRIEPLDITKIQKYTKDATDNLEGVSQSELEVDARL
                     QFRDKITTEEIQQTLIKTAVDKIDIDTPNWSFVASRLFLYDLYHKISGFTGYRHLKEY
                     FENAEEKGRILKGFKEKFDLEFLNGQIKPERDFQFNYLGIKTLYDRYLLKDANNNPIE
                     LPQHMFMSIAMFLAQNEQEPNKIALEFYEVLSKFEAMCATPTLANARTTKHQLSSCYI
                     GSTPDNIEGIFDSYKEMALLSKYGGGIGWDFSLVRSIGSYIDGHKNASAGTIPFLKIA
                     NDVAIAVDQLGTRKGAIAVYLEIWHIDVMEFIDLRKNSGDERRRAHDLFPALWVCDLF
                     MKRVLEDAMWTLFDPYECKDLTELYGQDFEKRYLEYEKDPKIIKEYINAKDLWKKILM
                     NYFEAGLPFLAFKDNANRCNPNAHAGIIRSSNLCTEIFQNTAPNHYYMRIEYTDGTIE
                     FFEEKQLVTTDNHITKCANKLTSTDILKGKQIYIATKVAKDGRTAVCNLASINLSKIN
                     TEEDIKRVVPIMVRLLDNVIDLNFYPNRKVKATSLQNRAIGLGVMGEAQMLAEHQIAW
                     GSKEHLEKIDALMEQISYHAIDTSANLAKEKGVYKDFENSEWSKGIFPIDKANNEALK
                     LTEKGLFNHACDWQGLREKVKANGMRNGYLMAIAPTSSISILVGTTQTIEPIYKKKWF
                     EENLSGLIPVVVPNLNLETWNFYTSAYDIDAKDLIKAAAVRQKWIDQGQSINVFLRIE
                     NASGKTLHEIYTLAWKLGLKSTYYLRSESPSIDEKSVLDRSVECFNCQ"
     gene            721275..722222
                     /locus_tag="HPSH112_RS03540"
                     /old_locus_tag="HPSH112_03620"
     CDS             721275..722222
                     /locus_tag="HPSH112_RS03540"
                     /old_locus_tag="HPSH112_03620"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000895509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_000895495.1"
                     /translation="MLFAMIGSGGFIAPKHLQAIRDTGHFLDCSFDIHDSVGVLDEYF
                     AQSEFFTNIEDFEKHLEQSKAMGKEINYLSVCTPTHTHFDYIRFGLKYGMHVICEKPL
                     VLDPSEIQELKDLEVKYQKRVFSLLPLRLHCDTLALKEKIKSELDKNPEKVFDITLTY
                     ISVQGKWYFSSWRADVNRSGGLATHMGISIFDALIYLFGGVKDKVINREELDCVGGIL
                     FLEHAKIRWFFSINPEHMGVAKEKVYHKMILEGEEVNLTQSFDNLYIESYKQILAQGG
                     FGLDEAMASIKLAYELRNLSVSEPNEDSHALCCKNNACK"
     gene            722278..723045
                     /locus_tag="HPSH112_RS03545"
                     /old_locus_tag="HPSH112_03625"
     CDS             722278..723045
                     /locus_tag="HPSH112_RS03545"
                     /old_locus_tag="HPSH112_03625"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="anion permease"
                     /protein_id="WP_000356009.1"
                     /translation="MDIYALYIAIGLFTGILSGIFGIGGGMIIVPIMLATGHSFEESI
                     GISILQMALSSFVGSVLNFKKKSLDFSLGLLIGAGGLIGASFSGFILKIVSSKILMVI
                     FALLVVYSMIQFVLKPKKKDFIADTKRYHLQGLKLFLIGALTGFFAITLGIGGGMLMV
                     PLMHYFLGYDSKKCVALGLFFILFSSISGAFSLIYHHIINKEVLLAGAIVGLGSVMGV
                     SIGIKWIMGLLNEKMHKALILGVYGLSLLIVLYKLFF"
     gene            723049..723555
                     /locus_tag="HPSH112_RS03550"
                     /old_locus_tag="HPSH112_03630"
     CDS             723049..723555
                     /locus_tag="HPSH112_RS03550"
                     /old_locus_tag="HPSH112_03630"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methylated-DNA--protein-cysteine
                     methyltransferase"
                     /protein_id="WP_000244844.1"
                     /translation="MVLYHYYFKTPKSFPLEYLHLCANESHLLRLDFDATNFSHNTPM
                     NTPLKLSVQALERYFLGQLFEFNAPLDLIGTFFQKQVWSALMTIPYGKTKSYDEIAKL
                     INNPRSCRAIGNANRNNPISLIVPCHRVVRKNGALGGYNGGIEVKKWLLEFESKILNQ
                     QAKNSLIS"
     gene            complement(723618..724685)
                     /locus_tag="HPSH112_RS03555"
                     /old_locus_tag="HPSH112_03635"
     CDS             complement(723618..724685)
                     /locus_tag="HPSH112_RS03555"
                     /old_locus_tag="HPSH112_03635"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000682415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_000682415.1"
                     /translation="MKHPLEELKDPIENLLLWIGRFLRYKCTSLSNSQVKDQNKVFEC
                     LNELNQACSASHLEKVCKKARNAGLLGINTYALPLLKFYEYTKKISLKSLKSIDEVLL
                     AEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEKSYIYNITLKNISGVNQSA
                     GNKLPTHLNNEELEKFLEGIDKIEMSAKVRARNRLLIKIIVFTGMRSNEALQLKIKDF
                     TLENGCYTILIKGKGDKYRAVMLKAFHIESLLKEWLMERELYPVKNDLLFCNQKGSAL
                     TQAYLYKQVERIINFAGLRREKNGAHMLRHSFATLLYQKRHDLILVQEALGHASLNTS
                     RIYTHFDKQRLEEAAGIWEEK"
     gene            complement(724695..725535)
                     /locus_tag="HPSH112_RS03560"
                     /pseudo
     CDS             complement(724695..725535)
                     /locus_tag="HPSH112_RS03560"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001001345.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(<725727..726194)
                     /locus_tag="HPSH112_RS08285"
                     /pseudo
     CDS             complement(<725727..726194)
                     /locus_tag="HPSH112_RS08285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001919086.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(726511..727683)
                     /locus_tag="HPSH112_RS03570"
                     /old_locus_tag="HPSH112_03655"
     CDS             complement(726511..727683)
                     /locus_tag="HPSH112_RS03570"
                     /old_locus_tag="HPSH112_03655"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="WP_001147053.1"
                     /translation="MPYSSKIQSLSESTTIAISTLAKELKSQGKDILSFSAGEPDFDT
                     PQAIKDAAIKALNDGFTKYTPVAGIPELLKAIAHKLKKENNLDYEPNEILVSNGAKQS
                     LFNAIQALIGEGDEVIIPVPFWVTYPELVKYSGGVSKFIQTDEKSHFKITPKQLKDAL
                     TPKTKMLILTTPSNPTGMLYSKAELEALGEVLKDTPIWVLSDEIYEKLVYKGEFVSCA
                     AVSEEMKKRTITINGLSKSVAMTGWRMGYAASKDKKLVKLMNNLQSQCTSNINSITQM
                     ASIVALEGLVDKEIETMRQAFEKRCHLAHAKINAIEGLNALKPDGAFYLFINIGGLCG
                     GDSMRFCHELLEKEGVALVPGKAFGLEGYVRLSFACSEEQIEKGMERIARFVKSKG"
     gene            complement(727842..728654)
                     /locus_tag="HPSH112_RS03575"
                     /old_locus_tag="HPSH112_03660"
     CDS             complement(727842..728654)
                     /locus_tag="HPSH112_RS03575"
                     /old_locus_tag="HPSH112_03660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207465.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000715000.1"
                     /translation="MKKFVVFKTLCLSVVLGNSLLAAEGSTEVQKQLEKPKEYKAVKG
                     EKNAWYLGISYQVGQASQSVKNPPKSSEFNYPKFPVGKTDYLAVMQGLGLTVGYKQFF
                     GEKRWFGARYYGFMDYGHAVFGANALTSDNGGVCELHQPCATKVGTMGNLSDMFTYGV
                     GIDTLYNVINKEDASFGFFFGVQIAGNSWGNTTGAFLETKSPYKHTSYSLDPAIFQFL
                     FNLGIRTHIGRHQEFDFGVKIPTINVYYFNHGNLSFTYRRQYSLYVGYRYNF"
     gene            complement(728776..730125)
                     /locus_tag="HPSH112_RS03580"
                     /old_locus_tag="HPSH112_03665"
     CDS             complement(728776..730125)
                     /locus_tag="HPSH112_RS03580"
                     /old_locus_tag="HPSH112_03665"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000562048.1"
                     /translation="MIASLGGVEYFEGQCLAFLKNPQTNPQNEQYIPGVFSYQENKIS
                     FSFMVSGEIKEIHSLQYQTLYIVDNKKRYTLYKPYNRIILGHVLGYPVPITLYYEWLF
                     DDHVDPNKIKGECFVCRTNYLESFFTTKKHLLPDALFKADESGCESYHGDNDKNFILQ
                     SFYIQNGFLSQKYEKDKVKARSNTLFSKRQNRLLTYQCDLFLECNMIFETLEKLELIA
                     EAIKNFFILIYAHSNFDIQIDYIQFKLSNKDITAIRNTYKKDKKSMQIDPYGIAIDFQ
                     RIDNFSVILEKWIDFCIKNKGFQLESILDIVNKKDPIIHLYSDMFVLISMIESFLKKS
                     KRTPLRVKLSEFFKISLSRTKCDQTKNYFNDKCQEDLIEQIVDCRNSLAHGKDLELDT
                     NKATDISHAFIDFKQIVIEYFFGEIGLSGFIINNDSFLNKVKLRNPPKTEKITKQNR"
     gene            complement(730122..734943)
                     /locus_tag="HPSH112_RS03585"
                     /pseudo
     CDS             complement(730122..734943)
                     /locus_tag="HPSH112_RS03585"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001290157.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
     gene            complement(735021..736310)
                     /locus_tag="HPSH112_RS03590"
                     /old_locus_tag="HPSH112_03680"
     CDS             complement(735021..736310)
                     /locus_tag="HPSH112_RS03590"
                     /old_locus_tag="HPSH112_03680"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001014025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase subunit C"
                     /protein_id="WP_001004819.1"
                     /translation="MNENIFEEVGDACVKCAKCVPGCTIYRIHKDETTSPRGFLDLMR
                     LNAQNKLKLDTNLKHLLETCFLCTACVEICPFHLPIDTLIEKAREKIAQKYGIAWYKK
                     SYFSLLKNRKKMDRVFSVAHFLAPCIFKQVGDSLEPRMAFKGLFKRFKKSALPPLNQK
                     SFLQKHAEMKPLENPIQKVAVFIGCLSNYHYQQVGESLLYILEKLNIQAIIPKQECCS
                     APAYFTGDKDTTLFLVKKNIEWFESYLDEVDAIIVPEATCASMLINDYYKVFLGEKDK
                     DLYLKRLEKITPKIYLASVFLEKHTPLKHLLEKIPKGKKETITYHNPCHAKKTLNAHK
                     EVRNLLNSHYEIKEMPDNCCGFGGITMQTEKAGFSLKVGLLRAKEIMDTKAEILSAEC
                     GACHMQLNNALKSLDDPNTPQFSHPLELIAKALKSAE"
     gene            complement(736307..737680)
                     /locus_tag="HPSH112_RS03595"
                     /old_locus_tag="HPSH112_03685"
     CDS             complement(736307..737680)
                     /locus_tag="HPSH112_RS03595"
                     /old_locus_tag="HPSH112_03685"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxygen-independent coproporphyrinogen III
                     oxidase"
                     /protein_id="WP_001193131.1"
                     /translation="MQTIDFEKFSQYSKPGPRYTSYPTAVEFKENFNEESLKTAFFNH
                     DHLKNPMPLSLYTHLPFCRSACYFCACSVIYTSLEEKKTRYISYLKKELALLKNAMDT
                     NREVVQFHYGGGTPTFFSPIQLDEITQSIQEVFPNFSQDIEMSCEIDPRHFTKEHMQT
                     LFDRGFNRLSFGVQDFDFEVQKAIHRIQPFEMVQESVKLARDYGIKSINFDLIYGLPN
                     QTKESFLKTLELVLKLDPDRLAVFNYAHVPWVKKTMRKIDETLLPSPRDKLEILESLI
                     SFLEKAHYQMIGMDHFAKSDNELYLALQKAELRRNFQGYTTKKFTQTIGIGITSIGEG
                     SDYYTQNYKDLHHYEKALDLGHLPVERGVALTKEDVLRKEVIMQMMSNLKLDYSNIEE
                     KFSIDFKAHFKKELEKLKPYEEAGLLSFNAKGFEMTKTGGMLVRNMAIEFDAYLRGGE
                     KHFSKTL"
     gene            complement(737680..738195)
                     /locus_tag="HPSH112_RS03600"
                     /old_locus_tag="HPSH112_03690"
     CDS             complement(737680..738195)
                     /locus_tag="HPSH112_RS03600"
                     /old_locus_tag="HPSH112_03690"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000413468.1"
                     /translation="MEKLPKKRVSKTKSQKLIHSLTTQKNRAFLKKISASEMLLELEK
                     GAFKKNEAYFISDEEDKNYVLVPDNVISLLAENARKAFEARLRAELERDIITQAPIDF
                     EDVREVSLQLLENLRQKDGNLPNINTLNFVKQIKKEHPNLFFNFDNMFKQPPFNENNF
                     ENFDNSDEENF"
     gene            complement(738233..739330)
                     /locus_tag="HPSH112_RS03605"
                     /old_locus_tag="HPSH112_03695"
     CDS             complement(738233..739330)
                     /locus_tag="HPSH112_RS03605"
                     /old_locus_tag="HPSH112_03695"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate synthase"
                     /protein_id="WP_001094045.1"
                     /translation="MNTLGRFLRLTTFGESHGDVIGGVLDGMPSGIKIDYALLENEMK
                     RRQGGRNVFITPRKEDDKVEITSGVFEGFSTGTPIGFLIHNQRARSKDYDNIKNLFRP
                     SHADFTYFHKYGIRDFRGGGRSSARESAIRVAAGAFAKMLLREIGIVCESGIIEIGGI
                     KAKNYDFNHALKSEIFALDEEQEEAQKTTIQNAIKNHDSIGGVALIRARSAKTNQKLP
                     IGLGQGLYAKLDAKIAEAMMGLNGVKAVEIGKGVESSLLKGSEYNDLMDQKGFLSNRS
                     GGVLGGMSNGEEIIIRAHFKPTPSIFQPQQTIDINNNECECLLKGRHDPCIAIRGSVV
                     CESLLSLVLADMVLLNLTSKIEYLKTIYNEN"
     gene            complement(739327..740046)
                     /locus_tag="HPSH112_RS03610"
                     /old_locus_tag="HPSH112_03700"
     CDS             complement(739327..740046)
                     /locus_tag="HPSH112_RS03610"
                     /old_locus_tag="HPSH112_03700"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015645070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="WP_000792203.1"
                     /translation="MKNKRSQNSPYATPNSPYATLEKALGYSFKDKRLLEQALTHKSC
                     KLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEGKLSKLRASIVSAHGFTKLAKVIA
                     LQDYLHVSSSEEISNGREKPSILSSAFEALMAGVYLEAGLAKVQKIIQNLLNRAYKRL
                     DLEHLFMDYKTALQELTQAQFCVIPTYQLLKEKGPDHHKEFEMALYIQDKIYATAKGK
                     SKKEAEQQCAYQALQKLKEAK"
     gene            complement(740021..740485)
                     /locus_tag="HPSH112_RS03615"
                     /old_locus_tag="HPSH112_03705"
     CDS             complement(740021..740485)
                     /locus_tag="HPSH112_RS03615"
                     /old_locus_tag="HPSH112_03705"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001155441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HI"
                     /protein_id="WP_001155441.1"
                     /translation="MQEIEIFCDGSSLGNPGPGGYAAILRYKDKEKIISGGESFTTNN
                     RMELRALNEALKILKRPCHITLYSDSQYVCQAINVWLTNWQKKNFSKVKNVDLWKEFL
                     EVSKGHLIMAVWIKGHNGHAENERCDSLAKLEAQKRVKTTKGKNDEKQTLSK"
     gene            complement(740472..741488)
                     /locus_tag="HPSH112_RS03620"
                     /old_locus_tag="HPSH112_03710"
     CDS             complement(740472..741488)
                     /locus_tag="HPSH112_RS03620"
                     /old_locus_tag="HPSH112_03710"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001163513.1"
                     /translation="MQHFNFLYKDSLFSIALFTFIIALVILLEQARAYFTQKKNKKFL
                     QKFAQNQNAYAGSENLSELLKHAKISSLMFLARAYSKADVQMSIEILKGLLNRPLKDE
                     EKITVLDLLAKNYFSVGYLQKTKDTVKEILRFSPRNVEALLKLLHAYELEKDYSKALE
                     TLECLEELETPEIETIKNYLYLMHLIENKEDAAKILHVSKASLDLKKIALNHLKSHDE
                     NLFWQEIDATERLENMIDLLWDMNIPAFILEKHAILQDIARSQGLLLDNKPCQVFELE
                     VLRALLNSPIKASLTFEYRCKHCKQIFPFESHRCPVCYQLAFMDMVLKISKESYGSGL
                     DARD"
     gene            complement(741499..742719)
                     /locus_tag="HPSH112_RS03625"
                     /old_locus_tag="HPSH112_03715"
     CDS             complement(741499..742719)
                     /locus_tag="HPSH112_RS03625"
                     /old_locus_tag="HPSH112_03715"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001225945.1"
                     /translation="MRKIFSYVLKALLFFGIAHADPESKVEALEGKKQESSLDKKIRQ
                     ELKNKELKNKEEKKNAEEKKEIKAKRKPRAEVHHGDAKNPTQKITPPKIKGSKKAFQN
                     QSDQNNAIKPKEKTTQTTEKKEATPNSQFNSIFGNPNDAANSTLEDKVVGGISLLVNG
                     SPITLYQIQEEQEKSKVSKAQARDRLIAERIKNQEIERLKIHVDDDKLDQEMAMMAQQ
                     QGMDLDHFKQMLMAEGHYKLYRNQLKEHLEMQELLRNILLTNVDTSSETKMREYYNKH
                     KEQFSIPTEIETVRYTSTNQEDLERAMSNPNLEIPGVSKANEKIEMKTLNPQIAQVFI
                     SHEQGSFTPVMNGGGGQFITFYIKEKKGKNEVSFSQAKQFIAQKLVEESKDKILEEHF
                     EKLRVKSRIVMIRE"
     gene            complement(742719..744146)
                     /locus_tag="HPSH112_RS03630"
                     /old_locus_tag="HPSH112_03720"
     CDS             complement(742719..744146)
                     /locus_tag="HPSH112_RS03630"
                     /old_locus_tag="HPSH112_03720"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000982612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="WP_000982559.1"
                     /translation="MMPFEAVIGLEVHVQLNTKTKIFCSCSTSFGESPNSNTCPVCLG
                     LPGALPVLNKEVVKKAIQLGTAIEANINQYSIFARKNYFYPDLPKAYQISQFEVPIVS
                     DGKLEIDTKEGAKIVRIERAHMEEDAGKNIHEGSCSLVDLNRACTPLLEIVSKPDMRN
                     SEEAIAYLKKLHAIVRFIGISDANMQEGNFRCDANVSIRPKGDEKLYTRVEIKNLNSF
                     RFIAKAIEYEIERQSAAWESGRYHKEVVQETRLFDTNKGITLSMRNKEESADYRYFKD
                     PDLYPVFIDEKLLKEAQKINELPSAKKIRYMKDFNIKEDDANLLASDPLLAEYFESML
                     DLGVKAKTSVTWLCVELLGRLKAEITLENCGVSAHMLGVLAKRIDEGKISGKSAKDVL
                     DRLLEEQGGDVDALIEQMGLSQVNDTETIVKVIEEVLKNNADKVLEYKSGKDKLFGFF
                     VGQAMKNLKGANPSVVNAILKEKLD"
     gene            complement(744143..745441)
                     /locus_tag="HPSH112_RS03635"
                     /old_locus_tag="HPSH112_03725"
     CDS             complement(744143..745441)
                     /locus_tag="HPSH112_RS03635"
                     /old_locus_tag="HPSH112_03725"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_000721996.1"
                     /translation="MKKILITLLLGVFMGLQASALTHQEINQAKVPVIYEENHLLPMG
                     FIHLAFRGGGSLSDKNQLGLAKLFAQVLNEGTKELGAVGFAQALEQKAISLNVDTSTE
                     DLQITLEFLKEYEDEAIMRLKELLKSPNFTQSALEKVKTRMLAALLQKESDFDYLAKL
                     TLKQELFANTPLANAALGTKESLQKIKLDDLKQQFDKVFELNKLVVVLGGDLKINQTL
                     KRLDNALNFLPQGKAYEEPYFETSHQKSEKILYKDTEQAFVYFGAPFKIKDLKQDLAK
                     SKVMMFVLGGGFGSRLMEKIRVQEGLAYSVYIRSNFSKVAHFASGYLQTKLSTQAKSV
                     ALVKKIVKEFIEKGMTQQELDDAKKFLLGSEPLRNETISSRLNTTYNYFYLDLPLNFN
                     QTLLDQIQKMSLKEINDFIKAHTEINDLTFAIVSNKKKDK"
     gene            complement(745447..746598)
                     /locus_tag="HPSH112_RS03640"
                     /old_locus_tag="HPSH112_03730"
     CDS             complement(745447..746598)
                     /locus_tag="HPSH112_RS03640"
                     /old_locus_tag="HPSH112_03730"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207450.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehypoxanthine futalosine cyclase"
                     /protein_id="WP_000113569.1"
                     /translation="MARNVKGYASTLTWTITRNTLNFLWEQGFKMRIDREEILDLMKN
                     APLKELGQKALRIKQRLHPENLTTFIVDRNINYTNICFVDCKFCAFKRTLKEKDAYVL
                     SYEEIDQKIEELLAIGGTQILFQGGVHPQLKIDYYENLVSHIAQKFPTITIHGFSAVE
                     IDYISKISKLSLKEVLERLKNAGLSSIPGAGAEILSDRVRDVIAPKKLSSDRWIEVHR
                     MAHLCGIKSTATMMFGSVDNEEDVVEHLQRVRDLQDETGGFRAFILWSFQPDNTPLKE
                     EIPSIKKASSNRYLRYLACSRIFLDNIQNIQSSWVTQGSMIGQLALLFGANDLGSVMM
                     EENVVKAAGTSFCMNESEMIELIEDIGSVAAKRNTAYEILKRYPAKAKV"
     gene            complement(746510..749245)
                     /locus_tag="HPSH112_RS03645"
                     /old_locus_tag="HPSH112_03735"
     CDS             complement(746510..749245)
                     /locus_tag="HPSH112_RS03645"
                     /old_locus_tag="HPSH112_03735"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207449.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein assembly factor BamA"
                     /protein_id="WP_080024704.1"
                     /translation="MKKFILSSLVFACINTSVEALENDGSKPNDLTSPKEASQESQKN
                     EIQRNEAQNETSQSSQTPKEMKVKSVSYVGLSYMSDMLANEIVKIRVGDIVDSKKIDT
                     AVLALFNQGYFKDVYATFEGGILEFHFDEKARIAGVEIKGYGTEKEKDGLKSQMGIKK
                     GDTFDEQKLEHAKTALKSALEGQGYYGSVVEVRTQKVSEGALLIVFDVNRGDSIYIKQ
                     SIYEGSAKLKRRMIESLSANKQRDFMGWMWGLNDGKLRLDQLEYDSMRIQDVYMRRGY
                     LDAHISSPFLKTDFSTHDAKLHYKVKEGIQYRISDILIEIDNPVVPLKTLEKALKVKR
                     KDVFNIEHLRADAQILKTEIADKGYAFAVVKPDLDKDEKNGLVKVIYRIEVGDMVYIN
                     DVIISGNQRTSDRIIRRELLLGPKDKYNLTKLRNSENSLRRLGFFSKVKIEEKRVNSS
                     LMDLLVSVEEGRTGQLQFGLGYGSYGGLMLNGSVSERNLFGTGQSMSLYANIATGGGR
                     SYPGMPKGAGRMFAGNLSLTNPRIFDSWYSSTINLYADYRISYQYIQQGGGFGVNIGR
                     MLGNRTHVSLGYNLNVTKLLGFSSPLYNRYYSSVNEVVSPRRCSTPASVIINRLSGGK
                     TPLQPESCSSPGAITTSPEIKGIWDRDYHTPITSSFTLDLSYDNTDDYYFPRNGVIFS
                     SYATMSGLPSSGTLNSWNGLGGNVRNTKVYGKFAAYHHLQKYLLIDLIARFKTQGGYI
                     FRYNTDDYLPLNSTFYMGGVTTVRGFRNGSVTPKDEFGLWLGGDGIFTASTELSYGVL
                     KAAKMRLAWFFDFGFLTFKTPTRGSFFYNAPFTTANFKDYGVIGAGFERATWRASTGL
                     QIEWISPMGPLVLIFPIAFFNQWGDGNGKKCKGLCFNPNMDDYTQHFEFSMGTRF"
     gene            complement(749328..750410)
                     /locus_tag="HPSH112_RS03650"
                     /old_locus_tag="HPSH112_03740"
     CDS             complement(749328..750410)
                     /locus_tag="HPSH112_RS03650"
                     /old_locus_tag="HPSH112_03740"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminofutalosine synthase MqnE"
                     /protein_id="WP_000346645.1"
                     /translation="MDFLEKVLDNQVTESKELVRLYGYDLYTLGEVADRIRQNMHQKI
                     VYFNVNRHLNPSNICADACKFCAFSAHRKNPNPYEMSLEEILEKVKNSYNKGIKEVHI
                     VSAHNPNYSYEWYLKVFETIKQEMPNLHLKAMTAAEVHFLSAKFNKPFELVLEDMLKA
                     GVDSMPGGGAEIFDEEIRRKICNGKVGSSRWLEIHAYWHKLGKMSNATMLFGHIENKI
                     HRIDHMLRIKKIQSPKDKVENKEGGFNAFIPLLYQKENNYLKVEKSPSAIEILKTIAI
                     SRILLNNIPHIKAYWATLGLNLALVAQEFGANDLDGTIEIESIQSAAGAKSRHGLEKE
                     DLIFKIKDAGFVAVERDSLYNFIQKF"
     gene            750705..751208
                     /locus_tag="HPSH112_RS03655"
                     /old_locus_tag="HPSH112_03745"
     CDS             750705..751208
                     /locus_tag="HPSH112_RS03655"
                     /old_locus_tag="HPSH112_03745"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207447.1"
                     /note="cytoplasmic iron storage protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin"
                     /protein_id="WP_000949223.1"
                     /translation="MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLF
                     DHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFESLTQIFQKAYGHEQHISESIN
                     NIVDHAIKSKDHATFNFLQWYVAEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKG
                     IAKSRKS"
     gene            751224..751847
                     /locus_tag="HPSH112_RS03660"
                     /old_locus_tag="HPSH112_03750"
     CDS             751224..751847
                     /locus_tag="HPSH112_RS03660"
                     /old_locus_tag="HPSH112_03750"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoserine phosphatase SerB"
                     /protein_id="WP_001170490.1"
                     /translation="MQKLAVFDFDSTLVNAETIESLARAWGVFDEVRKITSQAMNGET
                     DFHKSLILRVSKLKNMPLKLAKEVCESLPLFKGALELISALKEKNYKVVCFSGGFDLA
                     TNYYRDLLKLDAAFSNTLIVENGALNGLVTGHMMFSHSKGEMLLALQRLLNISKTNTL
                     VVGDGANDLSMFKHAYIKIAFNAKEVLKQHATHCINEPDLALIKPLI"
     gene            751985..753253
                     /locus_tag="HPSH112_RS03670"
                     /old_locus_tag="HPSH112_03760"
     CDS             751985..753253
                     /locus_tag="HPSH112_RS03670"
                     /old_locus_tag="HPSH112_03760"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662240.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fucosyltransferase"
                     /protein_id="WP_014662240.1"
                     /translation="MANWFNGPKEFKASVLYFILKQRYKIILHSNPNEPSDLVFGSPL
                     GQARKILSYQNTKRVFYTGENEAPNFNLFDYAIGFDELNFNDRYLRMPLYYASLHYKA
                     EIVNDTTSPYKLKADSLYALKKPSHQFKENHPHLCALIKNESDPLKRGFASFVASNAN
                     APVRNAFYEALNSIEPVAGGGAVKNTLGYNVKNKNEFLSQYKFNLCFENSQGYGYVTE
                     KILDSYFSHTIPIYWGSPSVAKDFNPKSFVNVHDFNNFDEAIDYIKYLHAHQNAYLDM
                     LYENPLNTIDGKAGFYQDLSFEKILDFFKTILENDTIYRNPSALCRDLNEPLVSVDDL
                     RVNYDDLRVNYDDLRVNYDDLRVNYDDLRVNYDDLRVNYDDLRRDYERLLSKATPLLE
                     LSQNTSFKIYRKAYQKSLPLLCTIRRWVKK"
     gene            complement(753262..753852)
                     /locus_tag="HPSH112_RS03675"
                     /old_locus_tag="HPSH112_03765"
     CDS             complement(753262..753852)
                     /locus_tag="HPSH112_RS03675"
                     /old_locus_tag="HPSH112_03765"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000440374.1"
                     /translation="MERLLGETYTNINLTKPQNKPLNKQVYEGIENCNLCKRHQNSKP
                     VIGLFNPTSKLTFITLTPMLDSQLNFLNNLKAAMLESIIQKVFNCPLKDCSILSLLKC
                     DSNSLNLEEEINACLFHLTWQLDNSASKVIVVFGEILPQRLLNLSKEESFGRIVSLKT
                     KHFLSTHALEDMLKNPTLKKEALAHFKTALQFLNQS"
     gene            complement(753897..755303)
                     /locus_tag="HPSH112_RS03680"
                     /old_locus_tag="HPSH112_03770"
     CDS             complement(753897..755303)
                     /locus_tag="HPSH112_RS03680"
                     /old_locus_tag="HPSH112_03770"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate ammonia-lyase"
                     /protein_id="WP_001217500.1"
                     /translation="MRIEHDFIGQMEISDEVYYGIQTLRASENFFITNDKLCSYPVFI
                     KSFAQVKKAAALANAQLGLIDEKLKIAICHACDLLVDGKYHDQFIVDMIQGGAGTSTN
                     MNMNEVIANLALEYMGHKKGEYQFCHPNDHVNRSQSTNDAYPSALKIAIYERLSNLVA
                     PMKALRDAFAQKAKEFAHVIKMGRTQLQDAVPMTLGQEFETYALMVDRDIEQVLDARN
                     WVRELNLGGTAIGTGINSHPDYRSLIEKKIQEVTGRPFVMANNLIEATQSTGAYVQVS
                     GVLKRIAVKLSKVCNDLRLLSSGPRAGLNEINLPKMQPGSSIMPGKVNPVIPEVVNQV
                     CFAVIGNDLSVALAAEGGQLQLNVFEPVIAYKLFHSFVILGRAIETLTTKCVEGITAN
                     EKICHDYVFNSIGIVTALNPHIGYEKSAMIAKEALKSDRSIYDIALEKKILTKEQLDD
                     IFKPENMLSPHAFKKHKD"
     gene            complement(755361..756629)
                     /locus_tag="HPSH112_RS03685"
                     /old_locus_tag="HPSH112_03775"
     CDS             complement(755361..756629)
                     /locus_tag="HPSH112_RS03685"
                     /old_locus_tag="HPSH112_03775"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_000346513.1"
                     /translation="MDFLEIVGQVPLKGGVEISGAKNSALPILAATLLSQQEVKIKSL
                     PQVVDIKAMALLLQNLGASLEWLDPNTLQISAKSLHHTEATYDLVRKMRASILVLGPL
                     LARFKECLVSLPGGCAIGARPVDLHLKAMQQLGAEIKIEQGYIHAKAPKGLKGNDILF
                     DKISVTGTENALMAASLAKGITRIINAAKEPEITQLCAFLQSGGVEIEGVGSSELKIR
                     GVENDALNLKDIQIIPDRIEAGTYLCVGAITNSQLKINRIIPNHLQAITDKLIEIGFS
                     LDIQENSIEIYPAQKRQAFEITTKEYPGFPTDMQAQFMALATQCLGTSVIEETLFENR
                     FMHASELQRLGANISLKTNIATISGSAELTGSDVMATDLRASSALILAALVAKGVSRV
                     HRIYHLDRGYERLEDKINALGAKVARLKEK"
     gene            complement(756632..757039)
                     /locus_tag="HPSH112_RS03690"
                     /old_locus_tag="HPSH112_03780"
     CDS             complement(756632..757039)
                     /locus_tag="HPSH112_RS03690"
                     /old_locus_tag="HPSH112_03780"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207441.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000527292.1"
                     /translation="MGNLAYYAYMYLILFICLLPVLLVGLAWRLSRPPLKQNIPNKNL
                     SLEYLSEQVKNLKSAPTLEKLKNSFNERFKICPKDKETLWLETIQNLVASEFFELEDA
                     INFGQDLENANPSHAQKIANSTGLAIKNKKEKG"
     gene            complement(757051..757872)
                     /locus_tag="HPSH112_RS03695"
                     /old_locus_tag="HPSH112_03785"
     CDS             complement(757051..757872)
                     /locus_tag="HPSH112_RS03695"
                     /old_locus_tag="HPSH112_03785"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_000591466.1"
                     /translation="MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAM
                     EAGCEVMAIVTGRNKRSLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQ
                     KQMKGLGHAILTGEALIGNEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIE
                     EVALEEVSKYGVIRGEWLEEGVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILS
                     ETKPGKNNEIQITDALLTQAKRKRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL"
     gene            complement(757869..759551)
                     /locus_tag="HPSH112_RS03700"
                     /old_locus_tag="HPSH112_03790"
     CDS             complement(757869..759551)
                     /locus_tag="HPSH112_RS03700"
                     /old_locus_tag="HPSH112_03790"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="murein transglycosylase"
                     /protein_id="WP_001210347.1"
                     /translation="MRFFILFFIGMLGVGFSQTEFNLKDLEKKPAGIVRDYYLWRYIS
                     DKKTTLENAKKAYELTQNKNNALQKAMQEKGSDNPEKSPDVKLPEDIYCKQTALESML
                     EETDTFQASCIAIALKSKIKDFDKIPLQTLKPLQIKIKEAYPVLYEELEILQSKNVSA
                     SLFKANAQVFSALFNHLSYEKKLQIFEKHIPIKELNRLLDEDYPAFNRLIYQVILDPK
                     LDHFKDALTKTNATHSNAQTFFILGINEILRKKPSKALKYFERSESVIKDDDFSKDRA
                     VFWQYLVSKKKKTLERLSQSPALNFYSLYASRKLQTTPSYRIISHIQNLSQEDPPFNT
                     YDPFSWQIFKEKTLSLKDESAFNAMLKSLYYEKSAPELTYLLSQRNKDKIYYYLSPYE
                     GIIEWQNMDEKAMAYAIARQESFLLPAVISRSFALGLMQIMPFNVGPFAKSLGMDNVD
                     LNDMFNPNIALKFGNYYLNHLKKEFNHPLFVAYAYNAGPGFLRRWLESSKRFKEKNHF
                     EPWLSMELMPYSETRLYGFRVMRNYLIYQEIFGNFIPVDAFLEQTLNSKDKP"
     gene            complement(759560..759853)
                     /locus_tag="HPSH112_RS03705"
                     /old_locus_tag="HPSH112_03795"
     CDS             complement(759560..759853)
                     /locus_tag="HPSH112_RS03705"
                     /old_locus_tag="HPSH112_03795"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YggT family protein"
                     /protein_id="WP_000577949.1"
                     /translation="MIFSTLINAVAVILSSLITIYMWVVIIYSLISFVQPNPNNPIMQ
                     ILARLCEPVFYFLRSRFKLVFNGLDFAPLVVVIVLKFLDLTLIQWLFALAKSL"
     gene            complement(759850..761169)
                     /locus_tag="HPSH112_RS03710"
                     /old_locus_tag="HPSH112_03800"
     CDS             complement(759850..761169)
                     /locus_tag="HPSH112_RS03710"
                     /old_locus_tag="HPSH112_03800"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207437.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate--tRNA ligase"
                     /protein_id="WP_000943213.1"
                     /translation="MLRFAPSPTGDMHIGNLRAAIFNYIVAKQQHKPFLIRIEDTDKE
                     RNIEGKDQEILEILKLMGISWDKLVYQSHNIDYHREMAEKLLKENKAFYCYASAEFLE
                     REKEKAKNEKRPFRYLDEWAALEKDKHHAPVVRLKSPNHAVSFNDAIKKEVEFEPYEL
                     DSFVLLRKDKSPTYNFACACDDLLYEISLIIRGEDHVSNTPKQILIQQALGSNDPIVY
                     AHLPIILDETSGKKMSKRDEASSVKWLLNQGFLPEAIVNYLIAIGNKVPKEVFSLDEA
                     IEWFDLENLSSSPAHFNLKYLKHLNHEHLKLLDDEKLLELTLIKDKNLLGLLRLFIEE
                     CGTLLELREKISLFLEPKDIVKTYENEDFKERCLVLFNALKSMDFQAYKDFESFKKEA
                     MRLSQLKGKDFFKPLRILLTGNSHGIELPLIFPYIQSHHQKVLRLKA"
     gene            complement(761335..761988)
                     /locus_tag="HPSH112_RS03715"
                     /old_locus_tag="HPSH112_03805"
     CDS             complement(761335..761988)
                     /locus_tag="HPSH112_RS03715"
                     /old_locus_tag="HPSH112_03805"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent oxidoreductase"
                     /protein_id="WP_000373509.1"
                     /translation="MDREQVIALQHQRFATKKYDPNRRISEKDWEALVEVGRLAPSSV
                     GLEPWKMLLLKNERMKEDLKPMAWGAISSLEGASHFVIYLARKGVTYDSDYVKKVMHE
                     VKKRDYDADSRFAQIIKNFQESDIKLNSERSLFDWASKQTYIQMANMMMAAAMLGIDS
                     CPIEGYDQEKVEAYLKEKGYLNTAEFGVSVMASFGYRNQEITPKTRWKTEIIYEVIE"
     gene            complement(762248..763414)
                     /locus_tag="HPSH112_RS03720"
                     /old_locus_tag="HPSH112_03815"
     CDS             complement(762248..763414)
                     /locus_tag="HPSH112_RS03720"
                     /old_locus_tag="HPSH112_03815"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="poly(A) polymerase"
                     /protein_id="WP_000462229.1"
                     /translation="MFELDKELKELFDIYEKSSHELYLVGGCVRDCLMGITPKDYDLT
                     SNALVNESKELLLKHHFRVLETGIKHGTITALKNNQSYEITTFRIEKGHIKHRKPKEL
                     VFSARLTDDLKRRDFSMNAIAYSPTKGIIDPFKGQNAIENQMIECVGEVRLRFFEDAL
                     RILRALRFSATLGFKIAPSTKEAIFAYKDLLKHLSKERLQSELNKFLMGKNAYEVAKE
                     YQEILELVTQEKIESLGFLKSAPFNLELRLLGFFKHQKSLENLRYPKKTCVLFLKAKE
                     CHKAFLNIHNKTGLKFLLKNYDLEPFNLALDFYALKNPKRALKIKSLLKEIFNANEPF
                     KKEHLVLKGGTLQNLGYQRQQIGEILNACLNLVIAHPENNSLERLVEWVRDRGY"
     gene            763476..764156
                     /locus_tag="HPSH112_RS03725"
                     /old_locus_tag="HPSH112_03820"
     CDS             763476..764156
                     /locus_tag="HPSH112_RS03725"
                     /old_locus_tag="HPSH112_03820"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="7-cyano-7-deazaguanine synthase QueC"
                     /protein_id="WP_000434363.1"
                     /translation="MEQEICAISFSGGQDSTTLAVWAKKRFKKVCLVGFDYAQKHSVE
                     LECAQKIASLLQLPYEIIPLDFLENITHSALFKNSNDLMGHSHAQNKDLPNSFVPNRN
                     AIFITLLHSYAQKIGASNIALGVSQADFSGYPDCKEDFIKSIEHALNLGSNTAIKILT
                     PLMFLNKAQEFQMAKDLGVLDLVIKETHTCYQGERKILHAYGYGCGECPACQLRKKGY
                     EEFESNKK"
     gene            complement(764202..765149)
                     /locus_tag="HPSH112_RS03730"
                     /old_locus_tag="HPSH112_03825"
     CDS             complement(764202..765149)
                     /locus_tag="HPSH112_RS03730"
                     /old_locus_tag="HPSH112_03825"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000465112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000465112.1"
                     /translation="MFFIKTQQLKSYFYNKILTNNKILNSRKNHEKSSLTLSLSLSFW
                     LHAERNGFYLGLNALEGSYIQEQGSIGERILEETALNQAIKNANNYPFEKPLVKDVED
                     AQNALNKVKDSNKIAIQLKGKGGTGGILNELSFGYKYFLGKKRIIGFRHSLFFGYQTS
                     RLAYAPIASLIAVSPLSLFTFSSISYSNIGSIAFLPYGFNTDLLINLIDNEKYSLGLV
                     IGMDIGASTWFSSNNLYPFSSVNLNPFNQVKSRTIFQLQGKFGVRYNNVKYKYSVELG
                     VKVPAFKVNYYSDNYGDKLDYKRVVSVYVNYAYNFKNKN"
     gene            765241..765693
                     /locus_tag="HPSH112_RS03735"
                     /old_locus_tag="HPSH112_03830"
     CDS             765241..765693
                     /locus_tag="HPSH112_RS03735"
                     /old_locus_tag="HPSH112_03830"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207431.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000554106.1"
                     /translation="MHQNNKTFLPNQSAHLSKTILFLNAGFLAYLLSACGANVPVEEV
                     LVKDPKETKAQEVAREENAIQQENAIIDAHTTPLINRFTNYSAYGSLNGFYNSVDNLN
                     SPMQNGMYGGYYMPYYYMPYGFMPYGSGLMPYGPYGYGAPGYFPYAFY"
     gene            765808..766221
                     /locus_tag="HPSH112_RS03740"
                     /old_locus_tag="HPSH112_03835"
     CDS             765808..766221
                     /locus_tag="HPSH112_RS03740"
                     /old_locus_tag="HPSH112_03835"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001223763.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001223599.1"
                     /translation="MRIVKNLFLVSFVAYSSAFAVDLETETKSEKKSDKKFYKLHKNH
                     GLETETKNDKKLYDFTKNSALEGINLEKSPTLKSHKKSDKKFYKQLAKNNIAEGVSMP
                     VVNFNKALSFGPYFERTKSKKTQYMDGGLMMHIRF"
     gene            complement(766226..767764)
                     /locus_tag="HPSH112_RS03745"
                     /old_locus_tag="HPSH112_03840"
     CDS             complement(766226..767764)
                     /locus_tag="HPSH112_RS03745"
                     /old_locus_tag="HPSH112_03840"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207429.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000896149.1"
                     /translation="MAFVFLFKCANEETSLNFTPLLEQMACNLQVRFYSVYKDNTASF
                     CLQASAETTLEFAQKLSEILPFSLDFSFLSLKEITEPLDENLFQTASLSKPLFMNAKE
                     HQDFLDKNSSLYANALGFVKNTAFKGTIIHSPKELIDCLTQLKEALKTQDFIPIHTSR
                     GALSLSLKNPSPSVIFSDLSSVLSCTKLPLEDAKYLASLEKPSIKASLKSVFKDTFKN
                     DEIIAQLPFDPILNLLCRILQDEGIEFVFTHANHSQEVLLHYETLFRTPKRLITPTKK
                     FVLENNLSAIAFKDELEFLKETPHSVVLYLSFKRPTRLLLHANDSLKTLLSVSFDFNQ
                     SFNLLKQDEKASRMLKNYATKFPNFYARILELSKYQLGGENLLDFFQILGFVLGYSED
                     FCAQSVISLAKECLRPKGPRIDYKILKDDSFKMALNFSKIMHSAMSFRLAGVENEILS
                     LGILDSLAEFLGNFIWDNAQNFSVQEVTIAGDFFGEKVFLDLFVQYFPKTLTLKTHAF
                     LDYE"
     gene            complement(767766..768302)
                     /locus_tag="HPSH112_RS03750"
                     /old_locus_tag="HPSH112_03845"
     CDS             complement(767766..768302)
                     /locus_tag="HPSH112_RS03750"
                     /old_locus_tag="HPSH112_03845"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207428.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein"
                     /protein_id="WP_000078652.1"
                     /translation="MSQKILILGIGNILFGDEGIGVHLAHYLKRNFSFFPSVDIVDGG
                     TMAQQLIPLITSYEKVLILDCVSAKGVEIGSVYAFDFKDAPKEITWAGSAHEVEMLHT
                     LRLTEFLGDLPKTFIVGLVPFVIGSETTFKLSSEILNALETALKAIETQLNAWGVQMQ
                     RTDHIALDCIAELSYKGF"
     gene            complement(768299..768973)
                     /locus_tag="HPSH112_RS03755"
                     /old_locus_tag="HPSH112_03850"
     CDS             complement(768299..768973)
                     /locus_tag="HPSH112_RS03755"
                     /old_locus_tag="HPSH112_03850"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207427.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Ni/Fe-hydrogenase, b-type cytochrome subunit"
                     /protein_id="WP_000359897.1"
                     /translation="MDKMNKVVLHKEYSGFVRFFHWVRALSIFALIATGFYIAYPFLQ
                     PNSSFYKGVYLLQAYVRSFHVMFGFLLISALIFRTYLFFTKESLMERRSFSQLLSPKA
                     WIDQMKAYFLISGKPHTKGAYNPIQLVAYSTLVVLIVLMSLSGVVLYYNVYHAGLGAF
                     LASAFKWFEALCGGLANVRFIHHLATWGFILFVPVHVYMVFFHSIRYESSGADSMING
                     YGYTKE"
     gene            complement(768986..770722)
                     /locus_tag="HPSH112_RS03760"
                     /old_locus_tag="HPSH112_03855"
     CDS             complement(768986..770722)
                     /locus_tag="HPSH112_RS03760"
                     /old_locus_tag="HPSH112_03855"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207426.1"
                     /note="involved in hydrogen uptake; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase 2 large subunit"
                     /protein_id="WP_000038066.1"
                     /translation="MSKKIVVDPITRIEGHLRIEVIVDDDNVITDAFSSSTLFRGLET
                     IIKGRDPRDAGFIAQRICGVCTYSHYKAGITAVENALGITPPLNAQLVRSLMNMALLF
                     HDHVVHFYTLHGLDWCDIMSALKADPIQAAKLSFKYSPYPINTGAGELKAVQKRLSDF
                     AKSGSLGPFNNGYYGHKTYRLSPEQNLIVLSHYLKLLEIQREAAKMTAIFGAKQPHPQ
                     SLTVGGVTSVMDILDPTRLAEWKSKFEVVAHFINHAYYPDLVMAGEMFANEPSVIKGC
                     GLRNFIAYEEVLLGKDKYLLSSGVVLDGDISKLHPIDESLIKEEVTHSWYQYEDTKEV
                     QLHPYDGQTNPHYTGLKDGESVGIENKIIPAKVLDTQNKYSWIKSPRYDSKPMEVGPL
                     SSVVVGLAAKNPYVTEVATKFLKDTKLPLEALFSTLGRTAARCIEAKTIADNGLLAFD
                     ALVENLKSDQSTCAPYHIDKNQEYKGRYIGQVPRGMLSHWVRIKNGVVENYQAVVPST
                     WNAGPRDSKNQRGAYEMSLIGTKIADLTQPLEIIRTIHSFDPCIACSVHVMDFKGQSL
                     NEFKVEPNFAKF"
     gene            complement(770739..771893)
                     /locus_tag="HPSH112_RS03765"
                     /old_locus_tag="HPSH112_03860"
     CDS             complement(770739..771893)
                     /locus_tag="HPSH112_RS03765"
                     /old_locus_tag="HPSH112_03860"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="quinone-reactive Ni/Fe-hydrogenase small chain"
                     /protein_id="WP_000499041.1"
                     /translation="MFYDEKKTYQKIEERLDTIRSFNAHNEHKNLQEEFRGAGISRRD
                     LLKWAGMMSTALALPASFTPLTLKAVEVANRLPVIWLHMAECTGCSESLLRSADPTID
                     SIIFDYINLEYHETIMVASGFQAEKSLHDAIEKHKNNYILMVEGGIPQGTEYFLTQGP
                     NAETGAEECKKVAQHAAAIFAIGTCSSFGGVQAAYPNPSNAQPLHKIIDKPVINVPGC
                     PPSEKNIVGNVLYYLMFGALPKLDAYNRPSWAYGNRIHDLCERRGHFDAGEFVEHFGD
                     ENAKKGFCLYKMGCKGPYTFNNCSKLRFNSHTSWPIGAGHGCIGCSEPNFWDTMSPFE
                     EPLANRSIKTAFDGLGADKVADKVGTTLLSATAIGIVAHALLSKAIKNKE"
     gene            772026..772610
                     /locus_tag="HPSH112_RS03770"
                     /old_locus_tag="HPSH112_03865"
     CDS             772026..772610
                     /locus_tag="HPSH112_RS03770"
                     /old_locus_tag="HPSH112_03865"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207424.1"
                     /note="involved in drug resistance; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH quinone reductase MdaB"
                     /protein_id="WP_000756684.1"
                     /translation="MKKVLIINGAKAFGSSGGKLNETLSDHAKKTLESLGLEVDTTIV
                     DKGYNHSQEVEKVFSADATIWQMPGWWMGEPWIVKKYIDEVFSAGYGKLWASDGRSSQ
                     NPTKNYGKGGLMQGKKYMLSLTWNAPIEAFNDPSEFFEGVGVDVVYLHLHKAFQFLGL
                     SALPTFICNDVMKNPQVEQYLNSLTTHLHQAFGK"
     gene            complement(772661..774703)
                     /locus_tag="HPSH112_RS03775"
                     /old_locus_tag="HPSH112_03870"
     CDS             complement(772661..774703)
                     /locus_tag="HPSH112_RS03775"
                     /old_locus_tag="HPSH112_03870"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207423.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000648452.1"
                     /translation="MKATQSTINDFFALTGTIFSIPVYQRNYNWEEENCEKLLQDIIN
                     ISQNKKTHFMGSITYILHWIDDEKSLRQLQEFVIIDGQQRVTTIMLLLKAIETNIPNE
                     EIKKEIDNLLNLSGQRLRLKPIKSDKEAFDLVMQNRSHEIQGVSHIRNNYKFFTKELD
                     NYISKGYRIEEIYGAFLRLKIVAIGLELGEDDPQVVFESINATGVQLKGLDLIRNYLM
                     MGENSEKQKHLYDTYWVPLENWLGEKDLNDFIKTYLRIYFEDKVKEGEREVYYVLKDH
                     HRKNFPNDIQGLMSDMREYGRIYQIFLDRDHHFLERGNPQQLANLRLRIKDLVKIKFG
                     VAKPFVLRCTRDFEEGKLDYENFYEILQILISYFVRRSVCGDPTGTLNKVLYPLYRQL
                     ENVSADAFKRYLGKSVGQMVFPNDDKIKVAFAVRNAYSANQVCKFILLEIEKLSNAEP
                     PKEENLEVEHFYPQKPTQEWRDRVGDYFTFEQDYLNNFGNLTLSGQNQKLGNKPYEAK
                     IELMEQYSSLHLNDYFINNTHSWGIEEVKARSEYLADQFCQVELFKDLPKEYRTREIS
                     KTLDDDLTFHNLQSVKLPNNERRLAKNAEGLVKAVIDYLLENAREAFESYTDEAQRYI
                     CWDKAKVQLRDRDGTLVVPFEKYGFYFVSNASYQTVGNNLRDLILGCDLNPRDFIV"
     gene            complement(774823..775881)
                     /locus_tag="HPSH112_RS03780"
                     /old_locus_tag="HPSH112_03880"
     CDS             complement(774823..775881)
                     /locus_tag="HPSH112_RS03780"
                     /old_locus_tag="HPSH112_03880"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015429034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000914897.1"
                     /translation="MLKKSLLLLVFLVLQLSGAEENNQAQKNTPPELNPANAKGAPNP
                     NTQITPKNDNSNLLDKLGSPENAQTELSAGIELAKKGDYQGAFKLFSQSCDNGNAAGC
                     FAVGAMYANGVGIQTNRLKAARYYEMGCSGGDATACANLAQMYENKKNADTNDKENAL
                     QLYAVACQGGDMIACNNLGWMFANGSGVPKDYYKAMGYYKFSCENGNDMGCYNLGLMS
                     NVNNIYGIDKAQLNQVDLNYLACNAGDMMGCANLGWIYANGDLGAPLNNHYAAKYFQM
                     ACDGGILGSCNNLGVLYQKGLGVPQDDQRALDLFSYACDNGFESSCRNYGNFKEHLLR
                     VNPNYGRLFMPYHSYEIP"
     gene            complement(775893..777098)
                     /locus_tag="HPSH112_RS03785"
                     /old_locus_tag="HPSH112_03885"
     CDS             complement(775893..777098)
                     /locus_tag="HPSH112_RS03785"
                     /old_locus_tag="HPSH112_03885"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,3,4,5-tetrahydropyridine-2,6-carboxylate
                     N-succinyltransferase"
                     /protein_id="WP_000608571.1"
                     /translation="MINKFKNFVSNYQQSNHYKEPLGFGIARVDIAPISKKILCATYP
                     VLNWKDENLGSYAVFCNSLSKEKILKESASECVIEIDESFVLKALDFYTPFLNEAYSN
                     KMTHKNIQVVLELLKALEENRLKNSDGESLYRLVILFEDKPCESVESAYMKLLALSLG
                     KAPLRSLNLEGIFNQLSNAAWSGNKPYELEWLRMNEVALKMQGNFPSIDFIDKFPRYL
                     MQLIPEFDNIRLLDSSKTRFGAYLGTGGYIQMPGASYVNFNAGAMGVCMNEGRISSSV
                     VVGAGTDIGGGASVLGVLSGGNNNPISIGKNCLLGANSVTGISLGDGCIVDAGVAILA
                     GSVIEIEENEFKKLLEVNSDLEKHANNLYKGKELSGKNGVHFRSNSQNGKLIAFRSVK
                     KIELNQNLH"
     gene            complement(777101..778180)
                     /locus_tag="HPSH112_RS03790"
                     /old_locus_tag="HPSH112_03890"
     CDS             complement(777101..778180)
                     /locus_tag="HPSH112_RS03790"
                     /old_locus_tag="HPSH112_03890"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
                     synthase (flavodoxin)"
                     /protein_id="WP_000892507.1"
                     /translation="MLENRVKTKQIFIGGVAIGGDAPISTQSMTFSKTADIESTKNQI
                     DRLKLAGADLVRVAVSNEKDALALKELKRVSPLPLIADIHFHYKFALIAAQSVDAIRI
                     NPGNIGSKDKIKAVVDACKEKNIPIRIGVNAGSLEKQFDQKYGPTPKGMVESALYNAK
                     LLEDLDFTDFKISLKASDVIRTIEAYRMLRPLVIYPFHLGVTEAGNLFSSSIKSAMAL
                     GGLLMEGIGDTMRVSITGELENEIKVARAILRHSGRLKEGINLISCPTCGRIEANLVD
                     MASKVEKRLSHIKTPLDISVMGCVVNALGEAKHADMAIAFGNRSGLIIKEGKVIHKLA
                     EKDLFETFVIEVENLAKEREKSLKD"
     gene            778300..779427
                     /locus_tag="HPSH112_RS03795"
                     /old_locus_tag="HPSH112_03895"
     CDS             778300..779427
                     /locus_tag="HPSH112_RS03795"
                     /old_locus_tag="HPSH112_03895"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000142372.1"
                     /translation="MTFEPYPFERLRALFKEITPKKKGLDLGIGEPRFETPKFIQDAL
                     KSHTHSLNIYPKSAFEESLREAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVL
                     FDYQNPTIAYPNPFYQIYEGSAQFSRAKSLLMPLTKENDFTPSLNEKELQEVDLVILN
                     SPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLIGNEA
                     FKNVLVIHSLSKRSSAPGLRSGFIAGDSSILEKYKAFRTYLGYTSANAIQKASEMAWL
                     DDAHAEFFRNIYANNLKLARKIFKDTLIYPYSFYVYLPVQNGENFAKTLYQNEGIITL
                     PALYLGRNHIGTDCVRLALVYDTPLLEKPLEIIETYRENHA"
     gene            779420..780769
                     /locus_tag="HPSH112_RS03800"
                     /old_locus_tag="HPSH112_03900"
     CDS             779420..780769
                     /locus_tag="HPSH112_RS03800"
                     /old_locus_tag="HPSH112_03900"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramate--L-alanine ligase"
                     /protein_id="WP_000894754.1"
                     /translation="MLETPKVLLKNLQDCKIHFIGIGGIGISGLAKYLKAQGATISGS
                     DIAISPSVKYLKALGVEINIPHDPKAIKNQDAIIHSAIIKEDNTEIQRAKELKIPILS
                     RKDALYSILKDKRVFSVCGAHGKSSITAMLSAIFPFFGAIIGAHSKEFDSNVRESAND
                     SLVFEADESDSSFLFSNPYAAIVPNTEPEHLEHYDHNLERFFFAYEYFLDHAQKRVIY
                     KEDPFLKNYSKDAIVLEKKDIRNIQYILKDGEPHTSFELKDLGAFLVWGLGEHNATNA
                     SLAILSALDELDLEEIRNNLLNFKGIKKRFDILQKNALILIDDYAHHPTEISATLKSA
                     RIYANLLNTQEKIVVIWQAHKYSRLMDNLEEFKKCFLEHCDRLIILPVYSASEVKKDI
                     DLKAHFKHYNPTFIDRVRKKGDFLELLVNDNVVETIQKGFVIGFGAGDITYQLRGEM"
     gene            780769..781134
                     /locus_tag="HPSH112_RS03805"
                     /old_locus_tag="HPSH112_03905"
     CDS             780769..781134
                     /locus_tag="HPSH112_RS03805"
                     /old_locus_tag="HPSH112_03905"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017281162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000500530.1"
                     /translation="MGAAVVLFLTLVLLFLVLRDFGLASPKQKLVAFLIVGIIGASIS
                     VYTYQQNQQNQREIALQRAFLRGDTLLCKGIKVNNQTFNLVSGTLSFLGKKQTPMKDV
                     LVDLDSCQTLQKDPLIQPQ"
     gene            781141..783390
                     /locus_tag="HPSH112_RS03810"
                     /old_locus_tag="HPSH112_03910"
     CDS             781141..783390
                     /locus_tag="HPSH112_RS03810"
                     /old_locus_tag="HPSH112_03910"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001063738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease MutS2"
                     /protein_id="WP_001063743.1"
                     /translation="MNNNNNTPPKPLEESLDLKEFIALFKTFFAKERDTIALENDLKQ
                     TFTYLNEVDVIGLPTPKSVKESNLIIIKLTKLGTLHLDEIHEIVKRLRYIVILQNAFK
                     TFTHLKFHERLNAIVLPPFFNDLIALFDDEGKIKQGANATLDALNESLNRLKKESAKI
                     IHHYAHSKELAPYLVDTQSHLKHGYECLLLKSGFSSAIKGVVLERSANGYFYLLPESV
                     QKIAQKIAQIDNEIDCCIVEMCQTLSHSLQKHLLFLKFLFKEFDFLDSLQARLNFAKA
                     YNLEFVMPSFTQKKMILENFSHPILKEPKPLNLKFEKSMLAVTGVNAGGKTMLLKSLL
                     SAAFLSKHLIAMKINAHHSIIPYFKEIHAIINDPQNSANNISTFAGRMKQFSALLSKE
                     NMLLGVDEIELGTDADEASSLYKTLLEKLLKQNNQIIITTHHKRLSVLMAENKEVELL
                     AALYDEEKERPTYTFLKGVIGKSYAFETALRYGVPHFLIEKAKAFYGEDKEKLNVLIE
                     NSSALERELKQKNELLENALKEQEDLKNAWLLEMEKQKETFHNKKLELEKSYQQALNI
                     LKSEVASKDTSSMHKEIHKASEILNKHKTNQEIPQIITSFQANEKARYKNESVLIVQI
                     LDKGYYWIETELGMRLKAHGSLLKKIQKPPKNKFKPPKTTIPKPQKASLRLDLRGQRS
                     EEALDSLDAFLNDALLGGFEEVLICHGKGSGILEKFVKEFLKNHPKVVSFSDAPINLG
                     GSGVKIVKL"
     gene            complement(783539..784060)
                     /locus_tag="HPSH112_RS03815"
                     /old_locus_tag="HPSH112_03915"
     CDS             complement(783539..784060)
                     /locus_tag="HPSH112_RS03815"
                     /old_locus_tag="HPSH112_03915"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="WP_001047364.1"
                     /translation="MNLEKLEISHDANALCVVIEISKHSNIKYELDKESGALMVDRVL
                     YGAQNYPANYGFVPNTLGSDGDPVDALVLSDVAFQAGSVVKARLVGVLNMEDESGMDE
                     KLLALPIDKIDPTHSYVKDINDLSKHTLDKIKHFFETYKDLEPNKWVKVKGFENKESA
                     IKVLEKAIKAYQG"
     gene            complement(784116..784913)
                     /locus_tag="HPSH112_RS03820"
                     /old_locus_tag="HPSH112_03920"
     CDS             complement(784116..784913)
                     /locus_tag="HPSH112_RS03820"
                     /old_locus_tag="HPSH112_03920"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_014662243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="WP_014662243.1"
                     /translation="MVIETQQNPKEPFDPCKIAPQKISFNQVVFKKIKRKLNHFIGNI
                     LARTEVYKKLVAKYDDLTGKYDDLTGKYDDLTGKYDDLTGKYDDLTGKYDDLTGKYDD
                     LTGKYDDLTGKYESLLAKEANIKETFWERRADSEKEAFFLEHFYLTSVYVSTTAGYYL
                     TPKGAKTFIEATERFKIIEPVDMFINNPTYHDIANFTYVPCPVSLNKHAFNSTIQNAK
                     KPDISLKPPKKSYFDNLFYDQLNTKKCLRAFHKYSKQYDHLKTPKGV"
     gene            complement(784859..785463)
                     /locus_tag="HPSH112_RS03825"
                     /old_locus_tag="HPSH112_03925"
                     /pseudo
     CDS             complement(784859..785463)
                     /locus_tag="HPSH112_RS03825"
                     /old_locus_tag="HPSH112_03925"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000626758.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
     gene            complement(785516..786514)
                     /locus_tag="HPSH112_RS03830"
                     /old_locus_tag="HPSH112_03930"
     CDS             complement(785516..786514)
                     /locus_tag="HPSH112_RS03830"
                     /old_locus_tag="HPSH112_03930"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000580721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LPS biosynthesis protein"
                     /protein_id="WP_000564179.1"
                     /translation="MICVYIISLKESQRRLDTEKLVSESNEKFKGRCVFQIFDAISPK
                     HEDFEKFVQELYDAQSMLKSDWFHSYVGDGLTLPELGCYLSHYLLWKECVKTNQPVVI
                     LEDDVALESNFMQALEDCLKSPFDFVRLYGCYWYYHETKFHVLPKEFVFPPFDYPFKN
                     NPILEKFKKFFDVSRFLNLSTHKVIHYILKKIQKSYYSTHEKEAFFLEHFYLTSVYVA
                     STAGYHLTPKGAKTFIEATERFKIIEPVDMFMDNSAYHDIANFTYVPCPVSLSEHSLD
                     STIQKPQKKSLKSYPLPPKKSTFRELFFYSLNAKKRLKAFHKYNKQYDHLKTPKEV"
     gene            complement(786540..787115)
                     /locus_tag="HPSH112_RS03835"
                     /old_locus_tag="HPSH112_03935"
     CDS             complement(786540..787115)
                     /locus_tag="HPSH112_RS03835"
                     /old_locus_tag="HPSH112_03935"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_000811296.1"
                     /translation="MKQLFLIIGAPGSGKTTDAELITKNNSEKIAHFSTGDLLRAESA
                     KKTERGLLIEKFTSQGELVPLEIVVETILSAIKSSSKGIILIDGYPRSVEQMQALNKE
                     LSAQNEVVLKSVIEVEVSENTAKERVLGRSRGADDNEVVFHNRMRVFLDPLGEIQNFY
                     KNKKVYKAINGERSIEEIVHEMQEYILSFGN"
     gene            complement(787132..788865)
                     /locus_tag="HPSH112_RS03840"
                     /old_locus_tag="HPSH112_03940"
     CDS             complement(787132..788865)
                     /locus_tag="HPSH112_RS03840"
                     /old_locus_tag="HPSH112_03940"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207412.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate--tRNA ligase"
                     /protein_id="WP_001256348.1"
                     /translation="MRSHFCAEISEKDVGKTIKVAGWCNTYRDHGGVVFIDLRDKSGL
                     VQLVCDPSSKAYEKALEVRSEFVLVAKGKTRLRGPGLENPKLKTGKIEIVLEELVIEN
                     KSATPPIEIGNKNVNEDLRLKYRYLDLRSLNAYEIFKLRSEVALIARNALAQKGFLEI
                     ETPILSKTTPEGARDYLVPSRVHEGEFFALPQSPQLFKQLLMVGGMDRYFQIARCFRD
                     EDLRADRQPEFTQIDAEMSFCSENDVMGVVEDLLQEIFKAIGHNISKPFKRMPYKEAM
                     ENYGSDKPDLRFGLPLIEVGDCFMDSSNAIFSNIAQDPKNKRIKALNVKGADAIFSRS
                     VLKELEEFVRQFGAQGLAYLQIKEDGVKGPLVKFLSEKGLKNILEKTGAKTGDIVFFG
                     AGDKKIVLDYMGRLRLKVAETLDLIDKDALNFLWVVNFPMFEKTENGYHAAHHPFTMP
                     KNIECKDLEEIEAHAYDVVLNGVELGGGSIRIHKEEMQKKVFEKINIHEEEAQKKFGF
                     LLEALKFGAPPHGGFAIGFDRLIMLMTKSSSIRDVIAFPKTQKASCLLTDAPSPINEE
                     QLRELHIRLRK"
     gene            complement(788899..789840)
                     /locus_tag="HPSH112_RS03845"
                     /old_locus_tag="HPSH112_03945"
     CDS             complement(788899..789840)
                     /locus_tag="HPSH112_RS03845"
                     /old_locus_tag="HPSH112_03945"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheV"
                     /protein_id="WP_000251465.1"
                     /translation="MVRGIDKTTSLHLNNEAQFLCFRLDGEKDAQLYGLNIFKIREII
                     HYDGEVTEILGGSDGVMLGFLSIRGESIPLVDVKRWLHYNASDTSRNLKECSVKDEHN
                     LVIVCHFSNHSIALKVLKIERIIHKNWTEISTGDKQGINEEGKLSAITRFDEERVVQI
                     LDVEKMISDVFPSLKDLDDLTLRCIEAIQSQKLILIAEDSLSALKTLEKIVQTLELRY
                     LAFPNGKELLDYLYEKEHYQQVGVVITDLEMPVISGFEVLKTIKADSRTEHLPVIINS
                     SMSSDSNRQLAQSLEADGFVVKSNILEIHEMLKKTLS"
     gene            789918..791888
                     /locus_tag="HPSH112_RS03850"
                     /old_locus_tag="HPSH112_03950"
     CDS             789918..791888
                     /locus_tag="HPSH112_RS03850"
                     /old_locus_tag="HPSH112_03950"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207410.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA ligase (NAD(+)) LigA"
                     /protein_id="WP_000597599.1"
                     /translation="MIKSQKEYLERIEYLNTLSHHYYNLDDPIVSDAVYDELYQELKA
                     YEEKNPNSIQANSPTQKVGATTPNSFNKNPHLMRMWSLDDVFNQSELQAWLQRILKAY
                     PSASFVCSPKLDGVSLNLLYQHGKLVKATTRGNGLEGELVSANAKHIANIPHAIAYNG
                     EIEIRGEVIISKKDFDALNKEHLNANEPLFANPRNAASGSLRQLDSEITKKRKLQFIP
                     WGVGKHSLNFPSFKECLDFIVSLGFSAIQYLSLNKNHQEIEENYHTLIKEREGFFALL
                     DGMVIVVNELNIQKELGYTQKSPKFACAYKFPALEKHTKIVGIINQVGRSGAITPVAV
                     LEPVEIAGAIITKATLHNYSEIEKKNIMLNDRVVVIRSGDVIPKIIKPLESYRDGSQH
                     KIERPKVCPICSHELLCEEIFTYCQNLNCPARLKESLIHFASKDALNIQGLGDKVIEQ
                     LFEEKLIFNALDLYALKLEDLMRLDKFKIKKAQNLLDAIQKSKNPPLWRLINALGIEH
                     IGKGASKTLAKYGLNVLEKSEAEFLEMEGFGVEMARSLVNFYASNQEFIRSLFDLLNP
                     KNSDMAKEKQKSSSVFNHKTIVLTGTLSKPRQEYAQMLENLGAKISSSVSAKTDFLIA
                     GENAGSKLALAQKHGVSVLNEEELLKRLKEFD"
     gene            791986..792321
                     /locus_tag="HPSH112_RS03855"
                     /old_locus_tag="HPSH112_03955"
     CDS             791986..792321
                     /locus_tag="HPSH112_RS03855"
                     /old_locus_tag="HPSH112_03955"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024705.1"
                     /translation="MMEHHKAHTTIQALQAKRKKLLTELAELEAEIKVSSERKSGFNI
                     SLSPSLLAEIEEIEYEEKTSKERRINHSVLLSPSFMTKVDEYMKEKGFSNRSLLFEKA
                     LEFYMLKHP"
     gene            792641..793342
                     /locus_tag="HPSH112_RS03860"
                     /old_locus_tag="HPSH112_03960"
     CDS             792641..793342
                     /locus_tag="HPSH112_RS03860"
                     /old_locus_tag="HPSH112_03960"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_000624968.1"
                     /translation="MISNINITPKKNIKNALNVNNFSFKSNTSTAIIGTNGAGKSTLI
                     NTILGIRADYNIKAQNNNTPYKNNIMPQRKQFGVVSNLFNYPPGLNANDIFRFYKFFY
                     KNCTINLFDKKLLNKTYESLSDGQKQRLKIDLALSHHPQLVIMDEPETSLEQNALIKL
                     SSLIELRNTQQLTSIIATHDLIVLESCKWVLLLNGGNIAKYETLDSILKTITISFSLK
                     EKLSAKDLLALLKDI"
     gene            793342..794091
                     /locus_tag="HPSH112_RS03865"
                     /old_locus_tag="HPSH112_03965"
     CDS             793342..794091
                     /locus_tag="HPSH112_RS03865"
                     /old_locus_tag="HPSH112_03965"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001973251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter permease"
                     /protein_id="WP_000500932.1"
                     /translation="MGAILSILKLEIKSYLTNTSALFWTFIYPILMLLLLVFVFSKNT
                     TEVFYFNSIIGLMGLLIISSAIFGLTQAIASLRSHNVFLFYILSPATLKQITLALIAS
                     RLIIVIIYAFTFIGISFYTLNIFDLLNFKTLIFGFISIFSSSLFCFCLAIFVAKIFQN
                     EQSILGFANIINLYAVISCNVFVSLDYLPSIGQLFIKTSVFYQLNQLLLKSFQGIDPI
                     LILIASTLFIVCGITLFLLSANRMLLIERMR"
     gene            complement(794151..803705)
                     /locus_tag="HPSH112_RS03870"
                     /old_locus_tag="HPSH112_03970"
     CDS             complement(794151..803705)
                     /locus_tag="HPSH112_RS03870"
                     /old_locus_tag="HPSH112_03970"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000565898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin"
                     /protein_id="WP_000565892.1"
                     /translation="MIDKNDKTDLKNKRFKNRSFKGVKKKIAKKYKIKNSSLTIYPLK
                     THSNLCVSFNKKIFLALGFVSALSAQSEDYNSSVYWLNSVNENHNNKSYYVSPLRTWA
                     GGSRSFTQNYNNSKLYIGTKNASSTPNNSSVWFGEKGYIGFITGVFKARDIFITGAVG
                     SGNELKTGGGAILVFESSNELSANGAYFQNNRAGMQTSWINLISNHSVNLTNTDFGNQ
                     TPNGGFNVMGRKITYNGGIVNGGNFGFDNVDSNGTTTISGVTFNNNGALTYKGGNGIG
                     GSITFTNSNINHYKLNLNANSVTFNNSTLGSMPNTNTIGNAYILNASNITFNNLTFNG
                     GWFVFDRSDASVHFQGTTTINNPTSPFINMSAKVTINPNAVFNIQNYTPTIGSAYTLF
                     SMKNGSIAYNDVSNLWNIIRLKNTQATKDNSKNATSNNNTHTYYVTYNLGGTLYNFRQ
                     IFSPDSIVLQSVYYGANNIYYTNSMNIHDNVFNLKNINDDRSDTIFYLNGLNTWNYTN
                     ARFTQTYGGKNSALVFNATTPWANGSIPKSNSTVRFGGYEGVNWGKTGYITGTFTADR
                     VYITGNMMSGNGAQTGGGATLNFVGATEINIAGADFKNLKTTSQNSYMTFMALGDSSG
                     SGKINVSQSDFYDWTGGGYDFTGNGAFDSVNFNKAYYKFQGAENSYHFKNTNFLAGNF
                     KFQGKTTIEKSVLDDASYTFNGVNNAFNENKFNGGSFSFNHAEQTDAFNNNSFNGGSF
                     SFNAKQVDFSGNSFNGGVFDFNNTPKVSFTDDTFNANNQFKINGAQTTFTFNKGVVFN
                     MQGLLNSLSVGTTYQLLNAKSVDYKNNNALYQMLRWTSGENPSGRLVDENQSVPSSAK
                     IYNVQFIDNGLTYYIKENFNNGITLTRLCTLGYTHCVNIYNDAFNLKNVNNNASNTVF
                     YLNGMTTWKIAGTGVFTQDYSGSNSVLVFNQTTPFLAGANPASNSVVSFGKTSGAEWG
                     LVGYIQGVFKANQIDITGTIRSGNGAQTGGGATLVFNAQERLNIANASLNNDKAGLQD
                     SWMNFIVNNGNLNVTNANFSNQTPHGGFNLKANNITWDKGSVNGGGNFGVDNASANGN
                     AVIKNVNFSDNGTLIYKGGENSAGNSLTLENNTFNSYNINAKAQNLIFNNNSFSGGSY
                     SFNDTKNTTFKGTNTLINSDPFSRLQGSIAIDNNSIFNIERDLTDKTTYTLLSGNNIK
                     YNNEILADNVFSKNLWNLIHYGGEQGTLLRADNNTFFVQFTQSNGQKFVFEETFNPGS
                     ITYKYLTLNSSPFHTDADSKDIWSQVRKQFDFIPGKTPVCVGVCYIAPYKNQDLIGSS
                     AFAWSLNFGATVVGTLLLGSAQEKANNNGGSIWFGKNNLLYLHGNFNATNIFLTNNFN
                     VGNPNAGGGATINFNADETLNADGLNYTNFQTVAMGLQTSASQHSWANFNSRLSMDIK
                     NSNFRDFTWGGFNFNSGRITFENTTFSGWTNINGATESGSSYVNMVANTDLIFTNSIL
                     GGGIRYDLKANNIIFNNSQMVIDVSKNVNQSSLNGNVTFNNSRLSVKPNAAINIGDSQ
                     TQTTLENASSLSFYNNSVANFNGTTAFNGVSYLNLNPNAQLSFNQANFNNANVTFYGI
                     PLFGKTPDFGNSVRLINFKGNTNFNQATLNLRAKNIHINFQGASTFENNSTMNLAESS
                     QASFNALSVEGETDFNLNGSSLLNFNGDSVFNAPVSFYANNSQISFTKLATFNADASF
                     DLGNNSTLNFQSVLLNGTLNLLGNGANALSINASGNFSFGTQGVLNLSNVNLFDAENK
                     PLVYNILQAQNIQGLMGNNGYEKIRFYGIQIEKADYSFNNGVHSWSFTNPLNTTETIT
                     ETLHNNRLKVQISQNYASNNEMFNLAPSLYDYQKNPYDESSNSYNYTSDKTGTYYLNS
                     NIKGFNQNNEIPGTYNAQNQPLQALHIYNQAITKQDLSIIASLGKEFLPKIANLLSSG
                     ALDNLNFNSPNSFETILGIFEKYGITLNQENWKSLLKIINGFSNTANYHFSQGNLVVG
                     AIKEGQTNTKSVVWFGGDGYKEPCAVGDNTCQMFRQTNLGQLLNSTSPYLGYINANFR
                     AKNIYITGTIGSGNAWGSGGSANVSFESGTNLVLNQANIDAQGTDKIFSYLGKEGIDK
                     LFGEKGLGNILSNIIYEESLNDNAIPKDLASMIPKDFGSKTLSSLLNPTEVNNLLGVS
                     AFKNAIMEILNSKTVGDVFGENGLLNALDPIKRKEIDQMLLEQIQAHSSGFEKFIVKT
                     LGIENVENFINNWYGKQSLSSFANNFVPGGLNQALDKIGSNANSKDLQNFLDKTTFGD
                     ILNQMINQAPLINKLISWLGPQDLSVLVNIALNSITNPSKELLGAISGMGQKVLNDLL
                     GEGVVNKIMSNQVLGQMINKIIADKGFGGVYHQGLGSILPKPLQDELKKLGMGSLLKP
                     KGLHNLWQKGNFNFLAKDYVFVNNSSFSNATGGGLNFVAGKSIIFNGKNTINFTQYQG
                     KLSFISQDFSSISLDTLNATNGLTLNASKNDISVQKGQICVNVLNCMGEKKANSLSAP
                     TDETLEVNANNFTFLGTIKANGLVDFSKVLQNTTIGTLDLGSNALLRANNLIVNNAFN
                     NNSNHRADISGNLNVVKGATLSTNENGLNVGGDFKSEGPLIFNLNNPTHQTIINVTRT
                     STIMSYNNQALINFNTQLKQGAYTLMDAKRMVYGYDNQMILGGSLSDYLKLYTLIDFN
                     GKRMRLNGDSLSYDNKPVNIKDGGLVVSFKDNQGQMVYSSILYDKVQVTVSDKPINIQ
                     APSLEYYIKYIQGSAGLNAIESAGNNSLMWLNALFMAKGGNPLFAPYYLQDTPTEHIV
                     TLMKDITGALGMLTNSNLKNNSTDVLQLNTYTQQMGRLAKLSNFASFDSTDFSERLSS
                     LKNQRFADAIPNAMDVILKYSQRDKLKNNLWATGVGGVSFVENGTGTLYGINVGYDRF
                     IKGVIVGGYAAYGYSGFYERITSSKSDNVDVGLYARAFIKKSELTFSVNETWGANKTQ
                     ISSNDALLSMINQSYQYSTWTTNARVNYGYDFMFKNKSIILKPQIGLRYYYIGMTGLE
                     GVMNNALYNQFKANADPSKKSVLTIDFAFENRHYFNKNSYFYAIGGIGRDLLVRSMGD
                     KLVRFIGDNTLSYRKGELYNTFASITTGGEVRLFKSFYANAGVGARFGLDYKMINITG
                     NIGMRLAF"
     gene            complement(803857..804339)
                     /locus_tag="HPSH112_RS03875"
                     /old_locus_tag="HPSH112_03975"
     CDS             complement(803857..804339)
                     /locus_tag="HPSH112_RS03875"
                     /old_locus_tag="HPSH112_03975"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_073470518.1"
                     /translation="MVGLAPIKITPKPVSDSSYTAFLWGAKGGYQFAFFKALALRGEF
                     SYLMAIKPTALHTINTSLLSLNADVLSDFYTYKKYSFGVYGGLGIGYFYQSNHLGMKN
                     SSFMGYNGLFNVGLGSTIAHHHRIELGAKIPFSNTRNSFKNSYFLESVFIHAAYSYAF
                     "
     gene            complement(804423..807509)
                     /locus_tag="HPSH112_RS03880"
                     /old_locus_tag="HPSH112_03980"
     CDS             complement(804423..807509)
                     /locus_tag="HPSH112_RS03880"
                     /old_locus_tag="HPSH112_03980"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_000278434.1"
                     /translation="MYKTAINRPITTLMFALAIVFFGTMGFKKLSVALFPKIDMPTVV
                     VTTTYPGASAEIIESKVTDKIEEAVMGIDGIKKVTSTSSKNVSIVVIEFELEKPNEEA
                     LNDVVNKISSVRFDDSNIKKPSINKFDTDSQAIISLFVSSSSVPATTLNDYAKNTIKP
                     MLQKINGVGGVQLNGFRERQIRIYADPTLMNKYNLTYADLFNTLKAENVEIDGGRIVN
                     SQRELSILINANSYSVADVEKIQVGNHVRLGDIAKIEIGLEEDNTFASFKDKPGVILE
                     IQKIAGANEIEIVDRVYEALKHIQAISPSYEIRPFLDTTGYIRTSIEDVKFDLVLGAI
                     LAVLVVFAFLRNGTITLVSAISIPISIMGTFALIQWMGFSLNMLTMVALTLAIGIIID
                     DAIVVIENIHKKLEMGMNKRKASYEGVREIGFALVAISAMLLSVFVPIGNMKGIIGRF
                     FQSFGITVALAIALSYVVVVTIIPMVSSVVVNPRHSRFYVWSEPFFKALESYYTRLLQ
                     WVLNHKLIIFIAVVLVFVGSLFVASKIGMEFMLKEDRGRFLVWLKAKPGVSIDYMTQK
                     SKIFQKAIEKHAEVEFTTLQVGYGTAQNPFKAKIFVQLKPLKERKKERKLGQFELMSA
                     LKKELKSMPEAKGLESINLSEVSLIGGGGDSSPFQTFVFSHSQEAVDKSVANLKKFLL
                     ESPELKGKVESYHTSTSESQPQLQLKILRQNANKYGVSAQTIGSVVSSAFSGTSQASV
                     FKQDGKEYDMIIRVPDNKRVSVEDIKRLQVRNKYDKLMFLDALVEITETKSPSSISRY
                     NRQRSVTVLAEPNRNAGVSLGEILTQVSKNTKEWLVEGANYRFTGEADNAKETNGEFL
                     IALATAFVLIYMILAALYESILEPFIIMVTMPLSFSGAFFALGLVHQPLSMFSMIGLI
                     LLIGMVGKNATLLIDVANEERKKGLNIKEAILFAGKTRLRPILMTTIAMVCGMLPLAL
                     ASGDGAAMKSPIGIAMSGGLMISMVLSLLIVPVFYRLLAPIDDKIKRFYQNQKTLE"
     gene            complement(807522..808226)
                     /locus_tag="HPSH112_RS03885"
                     /old_locus_tag="HPSH112_03985"
     CDS             complement(807522..808226)
                     /locus_tag="HPSH112_RS03885"
                     /old_locus_tag="HPSH112_03985"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000619679.1"
                     /translation="MIRKILIGLFLSLLSLEAGEKVYAIFNVKAAQDSKLTLDSTGIV
                     DSIKVAEGSVVKKGDVLLLLYNQDKQAQSDSTEQQLIFAKKQYQRYSKIGGAVDKNTL
                     ESYEFNYRRLESDYAYSIAVLNKTILRAPFDGVIASKNIQVGEGVNANNTVLLRLVSH
                     ARKLVIEFDSKYINAVKVGDTYTYSIDGDSNQHEAKITKIYPTVDENTRKVSAEALLS
                     KPMAVGLFGDGFIQTK"
     gene            complement(808236..809669)
                     /locus_tag="HPSH112_RS03890"
                     /old_locus_tag="HPSH112_03990"
     CDS             complement(808236..809669)
                     /locus_tag="HPSH112_RS03890"
                     /old_locus_tag="HPSH112_03990"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000848896.1"
                     /translation="MKTIIRYVSLWGLCAALTLAQTPSKTPDEIKQILNNYSHKNLKL
                     IDPPTSSLEATPSFLPSSKETATTINQEIAKYHEKSDKAALGLYELLKGATTNLSLQA
                     QELSVKQAMKNHTISKAMFLPTLNMNYNFKNENRDTPHFKRYNTQQLQAEVKLNVFNG
                     FSDVNNVKEKSATYRSTVANLEYSRQSVYLQVVQQYYEYFNNLARMIALQKKLEQIKT
                     DIKRVTKLYDKGLTTIDDLQSLKAQGNLSEYDILDMQFALEQNRLTLEYLTNLSVKNL
                     KKTTIDAPNLQLRERQDLVSLREQISALKYQNKQLNYYPTVDVYDSWLYWIQKPAYAL
                     GSFGNFFPGQQNTAGVTASMKFFDDIGLSLQKQSIMLGRLANEKNLAYKKLEQEKDEQ
                     LYRKSLDIARAKIESSKASLDAANLSFANIKRKYDANLVDFTTYLRGLTTRFDAEVAY
                     NLALNNYEVQKANYIFNSGHKIDDYVH"
     gene            complement(809679..810701)
                     /locus_tag="HPSH112_RS03895"
                     /old_locus_tag="HPSH112_03995"
     CDS             complement(809679..810701)
                     /locus_tag="HPSH112_RS03895"
                     /old_locus_tag="HPSH112_03995"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="WP_079991988.1"
                     /translation="MMIFIDACFRKETPYTPIWMMRQAGRYLSEYQESRQKAGSFLGL
                     CKNSDLATEVTLQPVEILGVDAAILFSDILVVPLEMGLNLEFIPKKGPHFLETITDLK
                     SVESLKIGAYKQLNYVYDTISQTRQKLSKEKALIGFCGSPWTLATYMIEGEGSKSYAK
                     SKKMLYSEPEVLKALLEKLSLELIEYLSLQIQAGVNAVMIFDSWASALEKEAYLKFSW
                     DYLKKISKELKKRYVHIPVILFPKGIGAYLDSIDGEFDVFGVDWGTPLEVAKKILGDK
                     YVLQGNLEPTRLYDKNALEEGVERILKVMGNQGHIFNLGHGMLPDLPRENAKYLVQLV
                     HAKTRR"
     gene            complement(810766..811335)
                     /locus_tag="HPSH112_RS03900"
                     /old_locus_tag="HPSH112_04000"
     CDS             complement(810766..811335)
                     /locus_tag="HPSH112_RS03900"
                     /old_locus_tag="HPSH112_04000"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080024746.1"
                     /translation="MAKKDWNFFKPLEPTKKYFGSFKIGYLYQHAETTKRSPIRPKNR
                     PPILMDKIYHDASLGFEAGYTLRKKILLGGYLDAGMGDSYFMSAGFMAGVRLFKGWVI
                     PKIALGYQLQILGAKIDKYQFNIQSAVGSVGLFFNAAKNFGLSIEARGGIPFYFIQSK
                     FSKAFGTPRLNIYSIGITFTFYDFTRFLG"
     gene            complement(811380..812036)
                     /locus_tag="HPSH112_RS03905"
                     /old_locus_tag="HPSH112_04005"
     CDS             complement(811380..812036)
                     /locus_tag="HPSH112_RS03905"
                     /old_locus_tag="HPSH112_04005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_000263520.1"
                     /translation="MWDSFEVLKALKSLDLLKNAPAWWWPNALKFEALLGAVLTQNTK
                     FEAVLKSLENLKNAFILENDDEINLKKIAYIEFSKLAECVRPSGFYNQKAKRLIDLSE
                     NILKDFQSFENFKQEVTREWLLDQKGIGKESADAILCYVCAKEVMVVDKYSYLFLKKL
                     GIEIEDYDELQHFFEKGVQENLNSALALYENTISLAQLYARFHGKIVEFSKQKLELKL
                     "
     gene            complement(812154..813686)
                     /locus_tag="HPSH112_RS03910"
                     /old_locus_tag="HPSH112_04010"
     CDS             complement(812154..813686)
                     /locus_tag="HPSH112_RS03910"
                     /old_locus_tag="HPSH112_04010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207396.1"
                     /note="FlaB; structural flagella protein; in Helicobacter
                     flagella are composed of flagellin A and flagellin B; the
                     amounts of each seem to be controlled by environmental
                     conditions; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="WP_000885472.1"
                     /translation="MAFQVNTNINAMNAHVQSALTQNALKTSLERLSSGLRINKAADD
                     ASGMTVADSLRSQANSLGQAIANTNDGMGIIQVADKAMDEQLKILDTVKVKATQAAQD
                     GQTTESRKAIQSDIVRLIQGLDNIGNTTTYNGQALLSGQFTNKEFQVGAYSNQSIKAS
                     IGSTTSDKIGQVRIATGALITASGDISLTFKQVDGVNDVTLESVKISSSAGTGIGVLA
                     EVINKNSNQTGVIAHASVITTSDVAVQSGSLSNLTLNGIHLGNIADIKKNDSDGRLVA
                     AINAVTSETGVEAYTDQNGRLNLRSLDGRGIEIKTDSTSNGPSALTMVNGGQDLTKGS
                     TNYGRLSLTRLDAKSINVVSASDSQHLGFSAIGFGESQVAETTVNLRDVTGNFNANVK
                     SASGANYNAVFASGNQSLGAGVTTLRGAMVVIDIAESAMKMLDKVRSDLGSVQNQMIS
                     TVNNISITQVNVKAAESQIRDVDFAEESANFNKNNILAQSGSYAMSQANTVQQNILRL
                     LT"
     gene            813854..815067
                     /locus_tag="HPSH112_RS08075"
                     /pseudo
     CDS             813854..815067
                     /locus_tag="HPSH112_RS08075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207395.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            815139..816440
                     /locus_tag="HPSH112_RS03925"
                     /old_locus_tag="HPSH112_04025"
     CDS             815139..816440
                     /locus_tag="HPSH112_RS03925"
                     /old_locus_tag="HPSH112_04025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_000467812.1"
                     /translation="MFGNKQLQLQISQKDSEITELKKEINLYQNLLNLCLHEGFVGIK
                     NNKVVFKSGNLASLNNLEEQSVHFKENAESVNLQGVSYSLKSQNIDGVQYFSLAKKTS
                     CVGEYHKNDLFKTFCASLKEGLENAQESMQYFHQETGLLLNAAKSGEEHSAEGLGTVN
                     KTGQDIESLYEKMQNATSLADSLNQRSNEITQVISLIDDIAEQTNLLALNAAIEAARA
                     GEHGRGFAVVADEVRKLAEKTQKATKEIAVVVKSMQQEANDIQTNTHDINSIVGSIKD
                     DVGELKSTVKNNMIVAQAAKYTIYNINNRVFCGLAKLDHVVFKNNLYGMVFGLNSFDI
                     TSHKNCRLGKWYYEGAGKENFSNTSGYRALESHHASVHAEANDLVKAVQEDHITDLKY
                     LEHKVHLMEDSAKHVKENIDKMFYEKQDELNKIIEKIQKGE"
     gene            816463..817584
                     /locus_tag="HPSH112_RS03930"
                     /old_locus_tag="HPSH112_04030"
     CDS             816463..817584
                     /locus_tag="HPSH112_RS03930"
                     /old_locus_tag="HPSH112_04030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001937148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="WP_000491838.1"
                     /translation="MFSKSLEALHHAKRYRKRELFDPLLKDYASNDYLGLSVKKDLLQ
                     NAFNKLQSFDAHSPKASMLVNGYHPLHAELEERLADLLGFESALLVGSGFLGNLALID
                     ALLVKNALLFMDEHYHASGIFSTKAKPNQVVFFSHNDSKDLQQKLFNAPKNKLKFIAI
                     EGVYSMDASVAPYDFYAITQEIPNAFLIVDEAHSFGTIGENLLGFLEYYRIKEKEKII
                     KLSTFSKALASYGACILAPLQIIEFLTNRAKSVIYTTALSLLDTALTLAHLEYFIAQK
                     QELKNELSKHQQIIFETLGIRTPTGFFTLEFENNLALLNAHRFLKEKGFLVGAIRPPT
                     VSKPLLRVSLSLKNSLQDTKELANTLLNYSKIQSSFKSD"
     gene            817585..819564
                     /locus_tag="HPSH112_RS03935"
                     /old_locus_tag="HPSH112_04035"
     CDS             817585..819564
                     /locus_tag="HPSH112_RS03935"
                     /old_locus_tag="HPSH112_04035"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein 1A"
                     /protein_id="WP_000913658.1"
                     /translation="MLKKIFYGFIVLFLIVIGLLAILIAQVWVTTDKDIAKIKDYRPG
                     VASQILDRKGRLIANIYDKEFRFYARFEEIPPRFIESLLAVEDTLFFEHGGINLDAIM
                     RAMIKNAKSGRYTEGGSTLTQQLVKNMVLTREKTLTRKLKEAIISIRIEKVLSKEEIL
                     ERYLNQTFFGHGYYGVKTASLGYFKKPLDKLTLKEITMLVALPRAPSFYDPTKNLEFS
                     LSRANDILRRLYSLGWISSNELKSALNEVPIVYNQTSTQNIAPYVVDEVLKQLDQLDG
                     LKTQGYTIKLTIDLDYQRLALESLRFGHQKILEKIAKEKPKTNASNEDEDNLNASMIV
                     TDTSTGKILALVGGIDYKKSAFNRATQAKRQFGSAIKPFVYQIAFDNGYSTTSKIPDT
                     ARNFENGNYSKNSEQNHAWHPSNYSRKFLGLVTLQEALSHSLNLATINLSDQLGFEKI
                     YQSLSDMGFKNLPKDLSIVLGSFAISPIEAAEKYSLFSNYGTMLKPMLIESITNQQND
                     VKTFTPIETKKITSKEQAFLTLSVLMNAVENGTGSLARIKGLEIAGKTGTSNNNVDAW
                     FIGFTPTLQSVIWFGRDDNTPIGKGATGGVVSAPVYSYFMRNILAIEPSLKRKFDVPK
                     GLRKEIVDEIPYYSTPNSITPTPKRTGDSEEPLLF"
     gene            complement(819567..820145)
                     /locus_tag="HPSH112_RS03940"
                     /old_locus_tag="HPSH112_04040"
     CDS             complement(819567..820145)
                     /locus_tag="HPSH112_RS03940"
                     /old_locus_tag="HPSH112_04040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207391.1"
                     /note="Tip-alpha; forms a dimer; found in culture
                     supernatant; induces TNF-alpha and NF-kappa-B in cell
                     cultures of mouse cells; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tumor necrosis factor alpha-inducing protein"
                     /protein_id="WP_000890600.1"
                     /translation="MLEKPFLKSKQLFLCGLGVLMLQACTCPNTSQRNSFLQDVPYWM
                     LQNRSQYITQGVDSSHIVDGKATEEIEKIATKRATIRVAQNIVHKLKEAYLSKSNRIK
                     QKITNEMFIQMTQPIFDSLMNVDRLGIYINPNNEEVFALVRARSFDKDALSEGLHKMS
                     LDNQAVSVLVSKVEEIFKDSINYGDVKVPIAM"
     gene            complement(820260..820575)
                     /gene="rnpB"
                     /locus_tag="HPSH112_RS08110"
     ncRNA           complement(820260..820575)
                     /ncRNA_class="RNase_P_RNA"
                     /gene="rnpB"
                     /locus_tag="HPSH112_RS08110"
                     /product="RNase P RNA component class A"
                     /inference="COORDINATES: nucleotide
                     motif:Rfam:12.0:RF00010"
                     /inference="COORDINATES: profile:INFERNAL:1.1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
                     /db_xref="RFAM:RF00010"
     gene            complement(820611..822083)
                     /locus_tag="HPSH112_RS03945"
                     /old_locus_tag="HPSH112_04050"
     CDS             complement(820611..822083)
                     /locus_tag="HPSH112_RS03945"
                     /old_locus_tag="HPSH112_04050"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein B"
                     /protein_id="WP_001031567.1"
                     /translation="MNKETRFYNLFSLAILGILIFPVGLANFYFGYVLKDSPCIFCWV
                     QRINMILIGAVALLVVRFGFKPKYIALLLLMASSGLYESFYHTSSHALEDVGQGFALA
                     ILGLHTQFWALFVFFSVVVLLAVLLFFAPNTQLFKDYPLNTLQKSAFYVFFIVVGSNA
                     VQAFFSTGPFPYIGQSDPVRFSWNLKESVWSMENWNHLKFPRSVLGRRDVGEPLKLSA
                     LPKDNDYERSPLEITKALEIGKKEELFLKLNGAITDLSFNEDKAILTTENQGLYLVGN
                     DLKTIHSHMVLDSYYSATVGSFVGADFNEDENIVIMGNNKTSVEITPNKNANALKNFP
                     YFLEGANSFDEVERSRLKTSRAKNYYVSAARRGAKFTYLITAPNKRYKDLIVISMLNS
                     DKQVHGEFLLELGNAKLKEKRKLSELVISALALKDNKLYAFSKEFNTLLVINPTKEEI
                     LEVYGLPKEIKNISAGGFRDNELILVSYENHKNILYTLNF"
     gene            complement(822092..822256)
                     /locus_tag="HPSH112_RS03950"
                     /old_locus_tag="HPSH112_04055"
     CDS             complement(822092..822256)
                     /locus_tag="HPSH112_RS03950"
                     /old_locus_tag="HPSH112_04055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000394837.1"
                     /translation="MEFLGLLLSLTAVLMAFKKPEKENWAFGILIVVWLVELIIFIAH
                     SSSVLPNMNL"
     gene            complement(822399..824177)
                     /locus_tag="HPSH112_RS03955"
                     /old_locus_tag="HPSH112_04060"
     CDS             complement(822399..824177)
                     /locus_tag="HPSH112_RS03955"
                     /old_locus_tag="HPSH112_04060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001224698.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_000548638.1"
                     /translation="MHKFLDGAKSEILKYDVISFDIFDTLLLRPFIKPTDLFLYIETK
                     YDIKGFCQARILAEMQSRKISKEQDITLDEIYHQIPKEFHSYKEVEIATEKEMLIPNL
                     EMLELYRFAKENNKRVIIVSDMYLPLEVLEDILISKGFDGYTNFYLSSHIMLTKHSKD
                     LFKHVLKQENITHTQMLHVGDNSWADDAMPKSLGIATLFRKSVLKQFEEIFPKYQTFS
                     PTSVAQSFILGSLCVFYKNYIQKHEKFDYWFLLGAMQAGIVAIAYCQFIYKEIHKRNI
                     DTLVFVARDGYLLQKIFNILYPNSYKTTYVYAPRILKKAVFLEVIEGESLEILRILEG
                     EEEIKKKQITTNQQAYIYIYSNFEHCRHLALKCLDNYRKYLSSLNLEGNIAIVDTITL
                     GYSSQELIQKALNKEVFGCYVDLLRILNHDCVSFLPFSHPKSIYFHNWDFMEFLLTSP
                     EYPILNVENGVPIYQKNVSSCEKHRSKAYEKIVEGAVGYALYFKESQISLDIHDVIKW
                     VNFFIDHPSIQDQEQFKQIYFLPDATHKNALPLFCNDVSLLSCILKPSQSYGILKRSL
                     RTNKQERLFKILSLIKKIYGKLKKKS"
     gene            complement(824286..824840)
                     /gene="oorC"
                     /locus_tag="HPSH112_RS03960"
                     /old_locus_tag="HPSH112_04065"
     CDS             complement(824286..824840)
                     /gene="oorC"
                     /locus_tag="HPSH112_RS03960"
                     /old_locus_tag="HPSH112_04065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000388047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate:acceptor oxidoreductase"
                     /protein_id="WP_000388028.1"
                     /translation="MEAQLRFTGVGGQGVLLAGEILAEAKIVSGGYGTKTSTYTSQVR
                     GGPTKVDILLDKDEIIFPYAKEGEIDFMLSVAQISYNQFKSDIKQGGIVVIDPNLVTP
                     TKEDEEKYQIYKIPIISIAKDEVGNIITQSVVALAITVELTKCVEENIVLDTMLKKVP
                     AKVADTNKKAFEIGKKHALEALKK"
     gene            complement(824840..825661)
                     /locus_tag="HPSH112_RS03965"
                     /old_locus_tag="HPSH112_04070"
     CDS             complement(824840..825661)
                     /locus_tag="HPSH112_RS03965"
                     /old_locus_tag="HPSH112_04070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207385.1"
                     /note="catalyzes the coenzyme A-dependent formation of
                     succinyl-CoA from 2-oxoglutarate and ferredoxin; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate ferredoxin oxidoreductase subunit
                     beta"
                     /protein_id="WP_000885326.1"
                     /translation="MAFNYDEYLRVDKIPTLWCWGCGDGVILKSIIRTIDALGWKMDD
                     VCLVSGIGCSGRMSSYVNCNTVHTTHGRAVAYATGIKMANPSKHVIVVSGDGDGFAIG
                     GNHTMHACRRNIDLNFILVNNFIYGLTNSQTSPTTPNGMWTVTAQWGNIDNQFDPCAL
                     TTAAGASFVARESVLDPQKLEKVLKEGFTHKGFSFFDVHSNCHINLGRKNKMGEASQM
                     LKWMESRLVSKRQFEAMSPEERVDKFPTGVLKHDTDRKEYCEAYQEIIEKAQGKQ"
     gene            complement(825663..826790)
                     /locus_tag="HPSH112_RS03970"
                     /old_locus_tag="HPSH112_04075"
     CDS             complement(825663..826790)
                     /locus_tag="HPSH112_RS03970"
                     /old_locus_tag="HPSH112_04075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate synthase subunit alpha"
                     /protein_id="WP_001206809.1"
                     /translation="MREIISDGNELVAKAAIEVGCRFFGGYPITPSSDIMHAMSVALP
                     KCGGHFIQMEDEISGISVSLGASMSGTKSMTASSGPGISLKVEQIGYSFMAEIPLVIA
                     DVMRSGPSTGMPTRVAQGDVNFLKHPIHGDFKAVALAPANLEEAYTETVRAFNLAEML
                     MTPVFLLMDETVGHMYGKVQIPDLEEVQKMTINRKEFVGDKKDYKPYGVAQDEPAVLN
                     PFFKGYRYHVSGLHHGPIGFPTEDVKIGGDLIDRLFHKIESKQDIINENEEMDLEGAE
                     IVIIAYGSVSLAVKEALKDYHKESKQKVGFFRPKTLWPSPAKRLKEIGDKYEKILVIE
                     LNKGQYLEEIERAMQREVHFLGQANGRTISPKQIIAKLKEL"
     gene            complement(826790..827131)
                     /locus_tag="HPSH112_RS03975"
                     /old_locus_tag="HPSH112_04080"
     CDS             complement(826790..827131)
                     /locus_tag="HPSH112_RS03975"
                     /old_locus_tag="HPSH112_04080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxoglutarate:acceptor oxidoreductase"
                     /protein_id="WP_001096889.1"
                     /translation="MAKMSAPDGVAVWVNEDRCKGCDICVSVCPAGVLGMGIEKERVL
                     GKVAKVAYPESCIGCMQCELNCPDFAIYVADRKDFKFAKVSKDAQERSEKVKANKYML
                     LEETILEGRGK"
     gene            complement(827307..828302)
                     /locus_tag="HPSH112_RS03980"
                     /old_locus_tag="HPSH112_04090"
     CDS             complement(827307..828302)
                     /locus_tag="HPSH112_RS03980"
                     /old_locus_tag="HPSH112_04090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000208803.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate lyase"
                     /protein_id="WP_000182685.1"
                     /translation="MTNKRVNTATNKIMTLNTFLDMFLLLFISVLFYLSIPIYPNKVV
                     VVPQGSLKKVFFSLKEQGVDINALDVLFLRLMGMPKKGYIDMGDGALRKGDFLVRLIK
                     AKAAYKSATLIPGESRYFFTQILSETYQLETSDLNQAYESIAPRLNGAVIEDGVIWPD
                     TYHLPLGEDAFKIMQTLIGQSMKKHEALSKQWLGYYYKEEWFEKIILASIVQKEAANI
                     EEMPLIASVIFNRLKKGMPLQMDGALNYQEFSHAKVTKERIKTDNTPYNTYKFKGLPK
                     NPVGSVSLEAIKAVIFPKKTDFLYFVKMPDKKHAFSATYKEHLKNINLSNNHFYD"
     gene            828220..831153
                     /locus_tag="HPSH112_RS03985"
                     /old_locus_tag="HPSH112_04095"
     CDS             828220..831153
                     /locus_tag="HPSH112_RS03985"
                     /old_locus_tag="HPSH112_04095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001042669.1"
                     /translation="MNKRRNISKKVFNVIILFVAVFTLLFVIHKTLSNGIHIQNLKIG
                     KLGISELYLKLNNKLSLEVERVDLSAFFHQKPTKKRLEVSDLIKNIRYGIWAVSYFEK
                     LKVKEIILDDKNKANIFFDGNKYELEFPGVKGEFSLEDDKNIKLKIINLLFKDIKVQV
                     DGNAHYSPKARKMAFNLIVKPLIEPSAAIYLQGLTDLKTIELKINTSPMKSLAFLKPL
                     FQRQSQKNLKTWIFDKIQFASFKIDNASIKANFTPSEFIPSLLENSVVKATLIKPSVV
                     FNDGLSPIKMDKTELIFKNKQLLIQPQKITYETMELNGSYATFSNLLEAPKLEVFLKT
                     TPNYYGDSIKDLLSAYKVVLPLDKISTPSSADLKLTLQFLKNTAPLFSVQGNVNLQEG
                     TLSLYNIPLYTQNASVNLDITQEYQYIYIETTHTRYENMLDLDAKIALDLNKKTLSLD
                     SLVHKIRFNTNNNINMRSYGLNNDPDNPQPTKFSLDLKSLHSIIQEGENSEAFRRKII
                     DTIKAQSEDKFTKDVFYATEDTLKNLSLNFDFSNPSHLQWSVPQLLLEGEFKDNAYVF
                     RIKDLKKIKPYSPIMKYFALEDGSLEVSTSDFVNIDFFAKDLKITLPIYHSNGMQFNS
                     LSLFGSINKDEISVYTPSKSISIKVKGDQKDIILNNIDLSIDDFLDSKMPAIAGLFSK
                     ERKEKPNSKEIQDEDIFISAKQRYEKAHKIIPISTRIHAKDVVLIYKKMPFPLENLDI
                     VAQDDRVKIDGNYKNGMIMADLVHGALYLKAHNFSGDYINTILQKDFVEGGLFTLIGA
                     LEDQVFNGELKFQNTSLKNFALMQNMINLINTIPSLIVFRNPHLGANGYQIKKGSVVF
                     GITKEYLGLEKIDLIGKTLDIAGNGIIELDKNKLDLNLEVSTIKALSNVLNKIPIVGY
                     LVLGKGGKITTNVNVKGTLDKPKTQVTLAADIIQAPFKILRRIFTPIDIIVDEVKKNI
                     DSKRK"
     gene            831155..831385
                     /locus_tag="HPSH112_RS03990"
                     /old_locus_tag="HPSH112_04100"
     CDS             831155..831385
                     /locus_tag="HPSH112_RS03990"
                     /old_locus_tag="HPSH112_04100"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_009112935.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000174157.1"
                     /translation="MTLNEAVKDKVYEIVEIANCDEALKKRFLSFGIHEGVQCTLLHY
                     SMKKATLSVKINRIQVALRSHEAQYLLIKESV"
     gene            831382..832038
                     /locus_tag="HPSH112_RS03995"
                     /old_locus_tag="HPSH112_04105"
     CDS             831382..832038
                     /locus_tag="HPSH112_RS03995"
                     /old_locus_tag="HPSH112_04105"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease III"
                     /protein_id="WP_000781703.1"
                     /translation="MKMGLKRAKTYQKAQQIKELLLKHYPNQTTQLHHKNPYELLVAT
                     ILSAQCTDARVNKITPKLFEKYPSVKDLALASLEEVKEIIKSVSYSNNKSKHLINMAQ
                     KVVRDFKGVIPSTQKELMSLDGVGQKTANVVLSVCFNANCIAVDTHVFRTTHRLGLSD
                     ANTPIKTEEELSDLFKDNLSKLHHALILFGRYTCKAKNPSCGACFLKEFCVSKASFKA
                     "
     gene            832120..832491
                     /locus_tag="HPSH112_RS04000"
                     /old_locus_tag="HPSH112_04110"
     CDS             832120..832491
                     /locus_tag="HPSH112_RS04000"
                     /old_locus_tag="HPSH112_04110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_000004851.1"
                     /translation="MSETESNKLKIAEKEKEKANKERELELSTYLEELICDYKNLLDM
                     EIVFSAELGSTQIPLLQILRFEKGSVIDLQKPAGESVDTFVNGRVIGKGEVMVFERNL
                     AIRLNEILDSNAIVYYLAKNS"
     gene            832488..833369
                     /locus_tag="HPSH112_RS04005"
                     /old_locus_tag="HPSH112_04115"
     CDS             832488..833369
                     /locus_tag="HPSH112_RS04005"
                     /old_locus_tag="HPSH112_04115"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001237742.1"
                     /translation="MRLLFLLLSATFMLLAEEKIPLNDDAPTKLVHWQNALKEVQPDS
                     NASATPPIKAVQTTLTFETPFNKTPKIMEVEGQKVIVLKNAKLDSKKTMDFKEASLNA
                     LEMFSYQNDIYLLSKKAKVELEIQASNSKDKKRIRFLFLPKGFHLAPPPNHEEKPQHA
                     NLASRDEKERAKSPLNTLELKPPLDLSHAYKALAVIVALLLILYIIKKKIVPAQGSFS
                     TKDLKLEISVLGRVDANHKIISIETNKERYLVLLSDKYSLLLDKISPKTSKEELIKEA
                     ENNIKNSKLGNLYAGKF"
     gene            833353..834300
                     /locus_tag="HPSH112_RS04010"
                     /old_locus_tag="HPSH112_04120"
     CDS             833353..834300
                     /locus_tag="HPSH112_RS04010"
                     /old_locus_tag="HPSH112_04120"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore-mediated iron transporter"
                     /protein_id="WP_001114827.1"
                     /translation="MPENSKLQPAKLGKNFDPVDHSNRNFFFSLILSVLLHWLIYFLF
                     EHRGDFFPSKPKLVKVDPKNLLILKRGHSQDPSKNTQGAPKPTLAGPQKPPTPPTPPI
                     PPTPPKPIEKPKPKPKPKPEPKKPNHKHKALKKVEKVEEKKVVEEKKEEKKIVEQKVE
                     QKKVEEKKPVKKEFDPNQLSFLPKEVAPPRQENNKGLDNQTRRDIDELYGEEFGDLGT
                     AEKDFIRNNLRDIGRITQKYLEYPQVAAYLGQDGTNAVEFYLHPNGDISDLKIIIGSE
                     YKMLDDNTLKTIQIAYKDYPRPKTKTLIRIRVRYYLGGN"
     gene            834304..835323
                     /locus_tag="HPSH112_RS04015"
                     /old_locus_tag="HPSH112_04125"
     CDS             834304..835323
                     /locus_tag="HPSH112_RS04015"
                     /old_locus_tag="HPSH112_04125"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_000406762.1"
                     /translation="MEITLFDPIDAHLHVRENALLKAVLRYSSEPFSVAVIMPNLSKP
                     LINTPTTLEYEEEILNHSSNFKPLMSLYFNDGLTLEELQRAQEKGIRFLKLYPKGMTT
                     NAQNGTSDLLGEKTLEILENAQKLGFILCIHAEQAGFCLDKEFLCHSVLETFALSFPK
                     LKIIIEHLSDWRSIALIEKHDNLYATLTLHHISMTLDDLLGGSLNPHCFCKPLIKTKK
                     DQERLLSLALKAHPKISFGSDSAPHFISKKHSANIPAGIFSAPILLPALCELFEKHNA
                     LENLQAFISDNAKKIYAPDNLPAKKVRLSKTPFIVPTHTLCLNEKIAILRGGETLSWN
                     IQEIA"
     gene            835299..836417
                     /locus_tag="HPSH112_RS04020"
                     /old_locus_tag="HPSH112_04130"
     CDS             835299..836417
                     /locus_tag="HPSH112_RS04020"
                     /old_locus_tag="HPSH112_04130"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000401294.1"
                     /translation="MEHSRNRLKHAAFFVGLFIVLFLIIMKHQTPPYAFLHNQTLSTK
                     SPPYFTQFTIPKPDGALSVHASALISLPNDNLLSAYFSGTKEGARDVTISANLFDSKI
                     NRWSEAFIILTKEELSYYSHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQL
                     ESALEPIHFKFVQKLSLSPFLNLSHLIRNKPLNTTDGGFMLPLYHELATQYPLLLKFD
                     KHNNPRELLRPNALNHQLQPSLTPFKDCAVMAFRNHSFKDSLMLETCKTPTAWQKPML
                     TNLKNLNDALNLINLNKELYLIHNPSDSSLRRKELLLSKLENSNSFKTLKILDKANEV
                     SYPSYSLNSHFIDIVYTYNRSHIKHIRFNMAYLKSLLK"
     gene            836424..836978
                     /locus_tag="HPSH112_RS04025"
                     /old_locus_tag="HPSH112_04135"
     CDS             836424..836978
                     /locus_tag="HPSH112_RS04025"
                     /old_locus_tag="HPSH112_04135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000469859.1"
                     /translation="MFIHSSYTLSFVWLFLIFFFFKNKPLGLRFSLSFVSVILSNTAF
                     KDSLSLNAFLSSFTAPLSPFSCLLILSYALFSCRLLQKPPLETLQSYSVMLFFNLLLL
                     IDILGFLPFSIYHHFMASLIFSALFCGSLFLSSPLLGVIALVALSSSLLMRSNFQILD
                     SLLDFPLLLFVFFKTLSLVKKRLY"
     gene            836984..839011
                     /locus_tag="HPSH112_RS04030"
                     /old_locus_tag="HPSH112_04140"
     CDS             836984..839011
                     /locus_tag="HPSH112_RS04030"
                     /old_locus_tag="HPSH112_04140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerol--membrane-oligosaccharide
                     glycerophosphotransferase"
                     /protein_id="WP_000839035.1"
                     /translation="MKSLSHALFSLFLKGFYFTFFMSLLFVFNRIGFILYTGYYKHAL
                     KNPIFDEIIKTLFNGARYDNRVVSSLAILFIIIGLLGLFAPKHQTKMLNITAYFSIAI
                     ILFLNIANIVYYGIYGNVFDENLLEFLHEDTLTILKMSGEYPIFSSFSLFVILSVLIS
                     FIYFKLQNALFKPNVYQATKPLKTFILFTLFALMQMFYINAQLSFVGASLDLSIEPAK
                     DPFLMKITPGAFRNLYLLARNYRQSHNLKFSDFAKGSPLEVAKNYFNLKENPSNNLYE
                     LLSQTSRNNSNQTIQHVFYIVSESLSSWHFDPKFDAIGLTSALQDLVKKEHAYMLSAF
                     IESAPRTVKSLDVQITGLPYINDNNLVNSGVILPSFPMAIGNITKTLGYRNNFYYGGS
                     GIWNKLTSFTKKQGFHALYFNNHLLEFAKNKPYPKPIESNWGVHDNILFDYILENTNP
                     NEKTFSMVMTLSNHAIKNVNLKAFGVPLEKIQKFVENTPKAENLPDANSLGHIYWYDK
                     VVVNFIQKASQKFPNSLFIITGDHFDRSYEYAKNDLYTIKSVPLILFAPTLKPEKISQ
                     VGSHLDIAPTIVELVAPKGFQFVSFGKPLFSNNTTNPPSHPNYALGYEAIATKDYFYN
                     PSLGLRYLNENYKEQKDKQNDKIEASQFYQQLESLKALSYYLLYHGANLKD"
     gene            839084..839962
                     /locus_tag="HPSH112_RS04035"
                     /old_locus_tag="HPSH112_04145"
     CDS             839084..839962
                     /locus_tag="HPSH112_RS04035"
                     /old_locus_tag="HPSH112_04145"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional methylenetetrahydrofolate
                     dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="WP_080024706.1"
                     /translation="MSMPNTGVVLLDGQALAYDIEKDLKNKIQIITAQTHKRPKLAVI
                     LVGKDPASITYVNMKIKACERVGMDFDLKTLQENITEAKLLSLIKDYNTDQNISGVLV
                     QLPLPRHIDTKMVLEAIDPNKDVDGFHPLNIGKLCTQKESFLPATPMGVMRLLEHYHI
                     EIKGKDVAIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKP
                     DLIKASMLKKGAVVVDIGINHLNDGRIVGDVDFNNAQKVAGFITPVPKGVGPMTIVSL
                     LENTLIAFEKQQRKGL"
     gene            839963..840835
                     /locus_tag="HPSH112_RS04040"
                     /old_locus_tag="HPSH112_04150"
     CDS             839963..840835
                     /locus_tag="HPSH112_RS04040"
                     /old_locus_tag="HPSH112_04150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000670686.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S26 family signal peptidase"
                     /protein_id="WP_000670701.1"
                     /translation="MKFLRSVYAFCSSWVGTITIVLLVIFFIAQAFIIPSRSMVGTLY
                     EGDMLFVKKFSYGIPIPKIPWIELPVMPDFKNNGHLIEGDRPKRGEVVVFIPPHEKKS
                     YYVKRNFAIGGDEVLFTNEGLYLHPFESDTDKNYIAKHYPNAMTKEFMGKIFVLNPYK
                     SEHPGIHYQKDNETFHLMEQLATQGAEANISMQLIQMEGEKVFYKKINNDEFFMIGDN
                     RDNSSDSRFWGSVAYKNIVGSPWIVYFSLSLKNSLEMDAENNPKKRYLVRWERMFKSV
                     EGLEKIIKKEKATP"
     gene            840844..841542
                     /locus_tag="HPSH112_RS04045"
                     /old_locus_tag="HPSH112_04155"
     CDS             840844..841542
                     /locus_tag="HPSH112_RS04045"
                     /old_locus_tag="HPSH112_04155"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="site-2 protease family protein"
                     /protein_id="WP_001159416.1"
                     /translation="MQFFDSSLESFITTLMKILALLIAIIGHEIMHGLSAFLFGDRSA
                     KDANRLSLNPIRHLDMMGSVLLPALLLIFQAPFLFGWAKPVPVDMRYIVSQKGSLACV
                     VVSLAGVAYNFILAVLLASITHLSFQKLGINALSINELNLYQLALVTFLIQGILYNLV
                     LGVFNSLPIPPLDGSKALGFLALHFKSAFLLEWFSKMERYGLLVVFIFLFIPPLSEFF
                     IHAPTRFLFYLLLS"
     gene            841563..842018
                     /locus_tag="HPSH112_RS04050"
                     /old_locus_tag="HPSH112_04160"
     CDS             841563..842018
                     /locus_tag="HPSH112_RS04050"
                     /old_locus_tag="HPSH112_04160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase B"
                     /protein_id="WP_001039768.1"
                     /translation="MNKPLKPSQIFIGSDHAGLHLAEFVQHFLEDKDFKIQAFLPAMR
                     VDYPDYAKLVCQKVLENAQSYGILVCATGIGMSMGANRFKGIRAALCLDAYMAKMTRL
                     HNNANVLCLGEKISGIGVVESILEAFFSTEFEQGRHVLRIQKLDESLKS"
     gene            842071..842403
                     /locus_tag="HPSH112_RS04055"
                     /old_locus_tag="HPSH112_04165"
     CDS             842071..842403
                     /locus_tag="HPSH112_RS04055"
                     /old_locus_tag="HPSH112_04165"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000495089.1"
                     /translation="MFTQWFIITIAIVFILYMGVRTFFFKTVAKRQERTNASMKLTLQ
                     EAEILIQKHQLQLQRALGNIDILTQEMSSLKTELKALKQRNSEYKGESDKYKNRIKEL
                     EQKIEALL"
     gene            842461..843000
                     /locus_tag="HPSH112_RS04060"
                     /old_locus_tag="HPSH112_04170"
     CDS             842461..843000
                     /locus_tag="HPSH112_RS04060"
                     /old_locus_tag="HPSH112_04170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenine phosphoribosyltransferase"
                     /protein_id="WP_001006144.1"
                     /translation="MNETLKEELLQSIREVKDYPKKGILFKDITTLLNYPKLFSKLID
                     ALKKRYLALNIDFIVGIEARGFILGSALAYALGVGFVPVRKKGKLPAHTLSQSYSLEY
                     GSDSIEIHSDAFRGVKGVRVVLIDDLLATGGTALASLELIKALQAECIEACFLIGLKE
                     LPGIQLLEERVKTFCLLEC"
     gene            843015..843593
                     /locus_tag="HPSH112_RS04065"
                     /old_locus_tag="HPSH112_04175"
     CDS             843015..843593
                     /locus_tag="HPSH112_RS04065"
                     /old_locus_tag="HPSH112_04175"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_000393397.1"
                     /translation="MEEYIIDLWNQHAATWGYLILFGWSILEGEIGLILAGIASYTGH
                     MHLGLAILVAGIGGFVGDQIYFYIGRTNKAYIQKKLEKQRRKLALAHLLLQKHGWFII
                     FIQRYMYGMRTIIPISIGLTRYSALKFAIINLISAMVWASITIILAWCLGEELLHALE
                     WLKKHPYALILLLVSFLALVLWYFQYYSKKNR"
     gene            843641..845131
                     /locus_tag="HPSH112_RS04070"
                     /old_locus_tag="HPSH112_04180"
     CDS             843641..845131
                     /locus_tag="HPSH112_RS04070"
                     /old_locus_tag="HPSH112_04180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl aminopeptidase"
                     /protein_id="WP_000912792.1"
                     /translation="MLKIKLEKTTFENAKAECGLVFIINKDFDHAWVKNKELLETFKY
                     EGEGVFLDQENKILYAGVKEDDVHLLRESACLAVRALKKLAFKSVKVGVYTCGVHSKD
                     NALLENLKALFLGLKLGLYEYDTFKSNKKESVLKEAIVALELHKPCEKTCANSLEKSA
                     KEALKYAEIMTESLNIVRDLVNTPPMIGTPVYMAEVAQKVAKENHLEIHVHDEKFLEE
                     KKMNAFLAVNKASLSVNPPRLIHLVYKPKKAKKKIALVGKGLTYDCGGLSLKPADYMV
                     TMKADKGGGSAVIGLLNALAKLGVEAEVHGIIGATENMIGPAAYKPDDILISKEGKSI
                     EVRNTDAEGRLVLADCLSYAQDLSPDVIVDFATLTGACVVGLGEFTSAIMGHNEELKN
                     LFETSGLESGELLAKLPFNRHLKKLIESKIADVCNISSSRYGGAITAGLFLNEFIRDE
                     FKDKWLHIDIAGPAYVEKEWDVNSFGASGAGVRACTAFVEEFLKKA"
     gene            845133..846233
                     /locus_tag="HPSH112_RS04075"
                     /old_locus_tag="HPSH112_04185"
     CDS             845133..846233
                     /locus_tag="HPSH112_RS04075"
                     /old_locus_tag="HPSH112_04185"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_000524533.1"
                     /translation="MGLSVGIVGLPNVGKSSTFNALTKTQNAESANYPFCTIEPNKAI
                     VNVPDRRLDALAQIIKPERILHSVVEFVDIAGLIKGASKGEGLGNQFLANIKECEVIL
                     QVVRCFEDDNITHVNDKIDPLNDIEIIELELILADIATLDKRIDRLQKALKSSKDAKN
                     LLECALSLKTHLEELKPAKTFPLNASEAFLELDKELRFLSNKKMIYAANVGEEDLNAL
                     NEHAKKVQNYAKDQNSEFVALCAKLEEEMVSMSEDEVKEFLQSLGVEESGLEKTIRLS
                     FKELGLINYFTAGVKEVRSWTIKKGSSAPVAAGVIHKDFEKGFIRAETISYDDFIAYK
                     GEAGAKEKGALRIEGKDYIVQDGDVLHFRFNV"
     gene            846372..847139
                     /locus_tag="HPSH112_RS04080"
                     /old_locus_tag="HPSH112_04190"
     CDS             846372..847139
                     /locus_tag="HPSH112_RS04080"
                     /old_locus_tag="HPSH112_04190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fe-S oxidoreductase"
                     /protein_id="WP_014662248.1"
                     /translation="MPLELFEKVCEEAALLTQIITLHVLGDPCKLNNLNHYLNTAKRF
                     SLKVDLVTSGVYWHDFETLLHDAIYQISISLDAGLDNHNKINQHRYIQKILEFCRYKF
                     EKNSEVFLNLRIQDSTLEKHQNLIKPFLESFECVSLEGLKTQGRARLFKKSFLNIQKT
                     FKWPNLNAQNPLNQKSKIPYCYGLIKQIAILSNGVVVPCCMDTQANISLGDLNHTPLK
                     DVLKSQKAMAIKTHFLKGEALELLCKNCSYPLIRYKK"
     gene            complement(847266..848312)
                     /locus_tag="HPSH112_RS04085"
                     /old_locus_tag="HPSH112_04195"
     CDS             complement(847266..848312)
                     /locus_tag="HPSH112_RS04085"
                     /old_locus_tag="HPSH112_04195"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AI-2E family transporter"
                     /protein_id="WP_000647319.1"
                     /translation="MKAQYFFWILFLIGFYWMIYLYQDFLMDALIAGLLCVGFFQVKV
                     FLDKRFFNIASSFLCVLVLASVLIVPLYFIVYKSSNIIFEINFEKFSALIKWLKGTIT
                     ENLSHFPTIHDGVSKFLENFNATSITGYLLKISSYVGKYSLKLITDALFILGLLFFFF
                     YYGERFYRYFLGVLPLGINQSKKIFEEVAGILRIVLLTSLITVILEGVAFGAMIVWFG
                     HDGWSLGILYGLASLVPAVGGALIWIPIAIYELYHGNVNEAIFIALYSILLISVLIDS
                     VIKPILIVFIKKRIFKTTLKINEMLIFFSMIAGISQFGFWGIIVGPTITAFFIALLRL
                     YENYFIQNDQKACE"
     gene            848428..849249
                     /locus_tag="HPSH112_RS04090"
                     /old_locus_tag="HPSH112_04200"
     CDS             848428..849249
                     /locus_tag="HPSH112_RS04090"
                     /old_locus_tag="HPSH112_04200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="WP_000232456.1"
                     /translation="MVFYKYSGSGNDFLIVQSFKKKDFSNLAKQVCHRHEGFGADGLV
                     VVLPSKDYDYEWDFYNSDGSKAGMCGNASRCVGLFAYQHAIASKNHVFLAGKREISIC
                     IEEPNIIESNLGNYKILDTIPALRCEKFFTNDSVLENIPTFYLIDTGVPHLVGFVKNK
                     EWLNSLNTLELRALRHAFNANINIAFIENKETIFLQTYERGVEDFTLACGTGMAAVFI
                     AARIFYNTPEKAALIPKSNESLELSLKNDEIFYKGAVRYIGMSVLDMSVFENGCF"
     gene            849356..850003
                     /locus_tag="HPSH112_RS04095"
                     /old_locus_tag="HPSH112_04205"
     CDS             849356..850003
                     /locus_tag="HPSH112_RS04095"
                     /old_locus_tag="HPSH112_04205"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_001148294.1"
                     /translation="MQALKSLLEVITKLQNLGGYLMHIAIFIIFIWIGGLKFVPYEAE
                     GIAPFVANSPFFSFMYKFEKPAYKQHKMSESQSMQEEMQDDPKIVENKEWHKENRTYL
                     VAEALGITIMILGILVLLGLWMPLMGVIGGLLVAGMTITTLSFLFTTPEVFVNQHFPW
                     LSGAGRLVVKDLALFAGGLFVAGFDAKRYLEGKGFCLMNRSSVGIKTKCSSGCCS"
     gene            complement(850027..850254)
                     /locus_tag="HPSH112_RS04100"
                     /old_locus_tag="HPSH112_04210"
     CDS             complement(850027..850254)
                     /locus_tag="HPSH112_RS04100"
                     /old_locus_tag="HPSH112_04210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207359.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000418249.1"
                     /translation="MELENKNIKPGRKRVAVDELKRNFSVTFYLSKDEHDVLRRLADE
                     EVESVNSFVKRHILKTIIYKKGANQDSSSRL"
     gene            850427..851677
                     /locus_tag="HPSH112_RS04105"
                     /old_locus_tag="HPSH112_04215"
     CDS             850427..851677
                     /locus_tag="HPSH112_RS04105"
                     /old_locus_tag="HPSH112_04215"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207358.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000996919.1"
                     /translation="MAINTFLKHSFLVCLLAVNSYAFDWNIFKYNLGFNMFIMDHEGS
                     TPYWVNTNTNLKTRLTPNFGIQFYTKGVEQSLTVGAYFFQNFHNYSTNFPYRWGPTMY
                     YKARGKRFTFYGGIFPRKNLLGRYGLNIFAPYYWFIDPNARGFLLQFQNHYSPSKPYY
                     GHAEFMLDWFGGNCYNTCKFGRNPYGNAMDRFQMNGSVAYNFFKDLLGIGGYFVLFHN
                     EDKYLLNGADGMQFNEKKAIDNNNIYLMDRLYFNAYIGTSLLDIAPFMEKLNASFGMV
                     SESSRLRQIHKNVPFMNSVGGQFDVEIQYKGFGIHNLFFFAKTPEMPFYNQYQYVEMY
                     CTPSYCPTPIYRGVPFFQANMYNRFDLYYNWKNDFASVRINFVLNAMRGGFDRSLPWS
                     ESYQVYMTVAFDPYNLINKIARKK"
     gene            851778..851990
                     /locus_tag="HPSH112_RS04110"
                     /old_locus_tag="HPSH112_04220"
     CDS             851778..851990
                     /locus_tag="HPSH112_RS04110"
                     /old_locus_tag="HPSH112_04220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_001117778.1"
                     /translation="MPGIKVREGDAFDEAYRRFKKQTDRNLVVTECRARRFFESKTEK
                     RKKQKISAKKKVLKRLYMLRRYESRL"
     gene            852029..852772
                     /locus_tag="HPSH112_RS04115"
                     /old_locus_tag="HPSH112_04225"
     CDS             852029..852772
                     /locus_tag="HPSH112_RS04115"
                     /old_locus_tag="HPSH112_04225"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-[acyl-carrier-protein] reductase"
                     /protein_id="WP_001160832.1"
                     /translation="MQFTGKNVLITGASKGIGAEIAKTLASMGLKVWINYRSNAEVAD
                     ALKNELEEKGYKAAVIKFDAASESDFIEAIQTIVQSDGGLSYLVNNAGVVRDKLAIKM
                     KTEDFHHVIDNNLTSAFIGCREALKVMSKSRFGSVVNIASIIGERGNMGQTNYSASKG
                     GMIAMSKSFAYEGALRNIRFNSVTPGFIETDMNATLKDELKADYVKNIPLNRLGSAKE
                     VAEAVAFLLSDHSSYITGETLKVNGGLYM"
     gene            853003..853239
                     /locus_tag="HPSH112_RS04120"
                     /old_locus_tag="HPSH112_04230"
     CDS             853003..853239
                     /locus_tag="HPSH112_RS04120"
                     /old_locus_tag="HPSH112_04230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_001163091.1"
                     /translation="MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIM
                     ALEEKFGIEIPDEQAEKIVNVGDVVKYIEDNKLA"
     gene            853553..854791
                     /locus_tag="HPSH112_RS04125"
                     /old_locus_tag="HPSH112_04235"
     CDS             853553..854791
                     /locus_tag="HPSH112_RS04125"
                     /old_locus_tag="HPSH112_04235"
                     /EC_number="2.3.1.41"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207353.1"
                     /note="FabF; beta-ketoacyl-ACP synthase II, KASII;
                     catalyzes a condensation reaction in fatty acid
                     biosynthesis: addition of an acyl acceptor of two carbons
                     from malonyl-ACP; required for the elongation of
                     short-chain unsaturated acyl-ACP; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl-[acyl-carrier-protein] synthase
                     II"
                     /protein_id="WP_014534225.1"
                     /translation="MRRIVVTGMGMINSLGLNKEDSFLAIAKGECGIKNIESFDASAF
                     PVRIAGEITDFDPTEVMNPKDVKKAGRFIQLALKATREAMKDSGILDAHNRCPEELAN
                     RMGVSSGSGIGGLGNIEANSIFCFEKGPRKVNPFFITSALVNMIGGFTSIEFGIKGPN
                     LSSVTACAAGTHAIIEAVKTILLNGADRMLVVGAESTICPVGIGGFASIKALSTRNDE
                     PKKASRPFDKDRNGFVMGEGAGALVLEEYESAKKRGAKIYAEFAGYGESGDANHITAP
                     APEGEGAFRAMKMALEMAKVEVGYVNAHGTSTHYNDWYESIALKNVFGSKEKVPPVSS
                     TKGQIGHCLGAAGALEAVISIMAMNQGILPPTINQETPDPECDLDYIPNAAREKQVGA
                     VMSNSFGFGGTNGVVIFKKA"
     gene            854814..855752
                     /locus_tag="HPSH112_RS04130"
                     /old_locus_tag="HPSH112_04240"
     CDS             854814..855752
                     /locus_tag="HPSH112_RS04130"
                     /old_locus_tag="HPSH112_04240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase carboxyl transferase
                     subunit alpha"
                     /protein_id="WP_001029386.1"
                     /translation="MAIYLDFENHIKEIQNEIELALIRGDEDAKEILEKRLDKEVKSI
                     YSNLTDFQKLQLARHPDRPYAMDYIDLILKDKYEVFGDRHYNDDKAIVCFIGKIDNVP
                     VVVIGEEKGRGTKNKLLRNFGMPNPCGYRKALKMAKFAEKFNLPILMLVDTAGAYPGI
                     GAEERGQSEAIAKNLQEFASLKVPTISVIIGEGGSGGALAIAVADKLAMMEYSIFSVI
                     SPEGCAAILWDDPSKTEVAIKAMKITPRDLKEAGLIDDIILEPSKGAHRDKFSAANTI
                     KEYFLDALRTIQQDPHFLDNRYQKLMSLGSFVESMN"
     gene            complement(855787..855966)
                     /locus_tag="HPSH112_RS08085"
                     /old_locus_tag="HPSH112_04245"
     CDS             complement(855787..855966)
                     /locus_tag="HPSH112_RS08085"
                     /old_locus_tag="HPSH112_04245"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000792621.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049760587.1"
                     /translation="MKNLALLLLSVSYKKILHFLRSDSKELIQAVFLKRSLGGILVVG
                     GNYFKIPLISLREWV"
     gene            855996..856352
                     /locus_tag="HPSH112_RS04135"
                     /pseudo
     CDS             855996..856352
                     /locus_tag="HPSH112_RS04135"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001947629.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(856391..857212)
                     /locus_tag="HPSH112_RS04140"
     CDS             complement(856391..857212)
                     /locus_tag="HPSH112_RS04140"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000792854.1"
                     /translation="MKNLFLAFIVGGTLLSADALNDKIENLMGERAYHTNKLFLERLF
                     KNRKDFYAMGRLDSLKLLNTLKENGLLSFNFNKPSMLKITFKASSNPLAFAKSINNSL
                     SMMGYSYVLPIKMQSSLGENIFSYELKTEYVLDPNILIETMKRHGFDFTDIRRVSLKE
                     WEYDFSLQEVKLPSARALVLSSDPVEFKEASGKYWLSVNQNAYLKISSNNPLWQPKVI
                     FYDENLKIIQIIAKENRQQEIALNLLDGVRFIHITDAKNPIILKNGISVVFDAMP"
     gene            complement(857209..858183)
                     /locus_tag="HPSH112_RS04145"
                     /old_locus_tag="HPSH112_04250"
     CDS             complement(857209..858183)
                     /locus_tag="HPSH112_RS04145"
                     /old_locus_tag="HPSH112_04250"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_000434911.1"
                     /translation="MEQHKKSLENLDLTDVQNISKDISGAALEELSLKNLDKNLQILK
                     EVGVAEICKATKIASKNIHSILEKRYESLSRVRARGFIQILEREYKIDLSAWMKEFDK
                     VCVFKESVSEEKNQETDPEETAKKPLKVELDYSINQANTSLSKKSSKWKPFVLILGVI
                     VIVLAVVIIQNSSSLKEEREQESAIKSGTKKNSFNKANLAEENKPETTPKPEEKQEKQ
                     TEQDKQEKEAIKEYPNTIYIIPKRDIWVEVIDLDEKKNSFQKVFKKNYSLETKNHRLL
                     LRFGHGYLILKNNNQAQNYNDNKARRFLYEPAKGLTLINEAQYKELQQ"
     gene            complement(858196..858879)
                     /locus_tag="HPSH112_RS04150"
                     /old_locus_tag="HPSH112_04255"
     CDS             complement(858196..858879)
                     /locus_tag="HPSH112_RS04150"
                     /old_locus_tag="HPSH112_04255"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (guanosine(2251)-2'-O)-methyltransferase RlmB"
                     /protein_id="WP_001149302.1"
                     /translation="MQAVIYGKQVIMHILNSHQEKLQEIYLSKEIDKKLFFALKKACP
                     NIIKVDNKKAQSLAKGGNHQGVLAKVELPLAVPLKEIKKAQKLLVLCGITDVGNIGGI
                     FRSAYCLGMDGVILDFAKELAYEGIVRSSLGLMYDLPFSVAPNTLDLINELKTSGFLC
                     LGASMQGSSQVENLSLKKCTLFLGSEHEGLSKKILAKMDTILSVKMRRDFDSLNVSVA
                     AGILMDKIN"
     gene            complement(858892..859755)
                     /locus_tag="HPSH112_RS04155"
                     /old_locus_tag="HPSH112_04260"
     CDS             complement(858892..859755)
                     /locus_tag="HPSH112_RS04155"
                     /old_locus_tag="HPSH112_04260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA (cytidine-2'-O-)-methyltransferase"
                     /protein_id="WP_000965310.1"
                     /translation="MLYFLPTPIGNLADITLRALEVLGRCEVFLCEDTRVSKRLLHLF
                     TQNPIISHSFPNIATQKREFIAFHSHNDQEFLNKVELSFFDKEIAVMSDAGMPSLSDP
                     GMSLVAHALKHDIPYDVLPGANALTTAFCASGFLEGRFFYAGFLPHKSKERRLKIAKI
                     LNALAYLEEKTPVVFYESPHRLLETLKDLNDLAKGMHLFAAKELTKLHQQYYLGEISQ
                     IIERLQQSNIQGEWVLVLLNEKKIEPCLGLSALLELDLPPKIKAKIEAAMTQKNAKEL
                     YFQRLLEEKNQ"
     gene            complement(859780..859983)
                     /locus_tag="HPSH112_RS04160"
                     /old_locus_tag="HPSH112_04265"
     CDS             complement(859780..859983)
                     /locus_tag="HPSH112_RS04160"
                     /old_locus_tag="HPSH112_04265"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207346.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31"
                     /protein_id="WP_000715282.1"
                     /translation="MKKGIHPEYIPCKVTCVTSGKEIEVLSTRPEMRIDISSFCHPFY
                     TGSDKIADTAGRVEKFKQRYNLK"
     gene            860245..861561
                     /locus_tag="HPSH112_RS04165"
                     /old_locus_tag="HPSH112_04270"
     CDS             860245..861561
                     /locus_tag="HPSH112_RS04165"
                     /old_locus_tag="HPSH112_04270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_001004684.1"
                     /translation="MNENAPAHKSPHKVKTHTPVSGYHIEDLRTYPTEKLLEIANKLK
                     VENPQEFKRQDLMFEILKTQVTQGGYILFTGILEIMPDGYGFLRGFDGSFSDGHNDTY
                     VSPSQIRRFALRNGDIVTGQVRSPKDQEKYYALLKIEAINYLPSDEIKNRPLFDNLTP
                     LFPDEPIKLEYEPTKVTGRMLDLFSPVGKGQRALIVAPPRTGKTELMKELAQGITSNH
                     PEVELIILLVDERPEEVTDMQRSVKGQVFSSTFDLPANNHIRIAELVLERAKRRVEMG
                     KDVVVLLDSITRLARAYNAVTPSSGKVLSGGVDANALHRPKRFFGAARNIEEGGSLTI
                     IATTLIETGSRMDEVIFEEFKGTGNSEIVLARNIADRRIYPAFDILKSGTRKDNILLG
                     KDRLTKVWVLRNVMQQMDDIEALSFVYSKMQQTKDNEEFLNLMNEK"
     gene            861598..862365
                     /locus_tag="HPSH112_RS04170"
                     /old_locus_tag="HPSH112_04275"
     CDS             861598..862365
                     /locus_tag="HPSH112_RS04170"
                     /old_locus_tag="HPSH112_04275"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_207344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_000690404.1"
                     /translation="MKIGVFDSGVGGFSVLKSLLKVQSFDEIIYYGDSARVPYGTKDP
                     TTIKQFGLEALDFFKPHKIELLIVACNTASALALEEMQKHSKIPIVGVIEPSILAIKQ
                     QVKDKNAPILVLGTKATIQSNAYDNALKQQGYLNVSHLATSLFVPLIEENILEGELLE
                     TCMRYYFTPLEILPEVVILGCTHFPLIAHQIEGYFMEHFALSTPPLLIHSGDAIVEYL
                     QQKYALKKNACTFPKVEFHASGDVVWLEKQAKEWLKL"
     gene            complement(862330..862604)
                     /locus_tag="HPSH112_RS08290"
                     /old_locus_tag="HPSH112_04280"
                     /pseudo
     CDS             complement(862330..862604)
                     /locus_tag="HPSH112_RS08290"
                     /old_locus_tag="HPSH112_04280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001864714.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(862696..865695)
                     /locus_tag="HPSH112_RS04175"
                     /old_locus_tag="HPSH112_04285"
     CDS             complement(862696..865695)
                     /locus_tag="HPSH112_RS04175"
                     /old_locus_tag="HPSH112_04285"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001262943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_001262943.1"
                     /translation="MANETIDQTKKPDQTPIVDKNDNKAIKNPTKKNQFFSKLTDLFA
                     LGKKQSSDLEETLNQEPRSNVEQNIATTTNMQGLPQARDLLDGRGNFPKFTLGDMEML
                     DVEGIADIDPNYKFSQLLVHSNVLSSMSMGSHSNMEPEKVSLLYGDNGGPEARHDWNA
                     TVGYKNQQGNNVATLINMHLKNGSGLVIAGNEGGINNPSFYLYKKDQLTGLEQALSQE
                     EIQNKVDFMEFLAQNSTKLDNLSEKEKEKFQTEIGNFQKDPKAYLDTLGSDHIAFVSK
                     KDNKHLALVTDFGNGELSYTLKDYGKEQDRALDRETKTTFQGNLKDDGVMFVNYSNFK
                     YTNASKSPNEGIGATNGVSHLEANFSKVAIFNLPKLNGLVLSNHPVRQNLEDKVIAKG
                     LSPKEANKLVKDFLNSNKELVGKVSSFNKAVAEAKNTGNYGGVKKAQKDLEKSIRKRE
                     HLEKEVTKKIESKSGNKNKMEAKAQANSQKDEIFALINQETYKEARNASYDQNLEGIR
                     RELSDKIENINKNLKDFNKSFDALKSGNNKDFSKVEETLKALKSSVKDLGINPEWISK
                     VENLSTALNEFKNGKNKDFSKVTQAKSDLENSIKDAIVNQEITDKVDNLNQAVLVAKT
                     ACNFSMLDQALADLKNFSTDQKLDQKNESFNVGKDSDLQKSVKNRVNGTLVGNGLSKT
                     EATTLTGKISGIKKELNEKFANFNNNNGLKNSAEPIYAQVNKKKTGQVTSPEGSIYDQ
                     VAKDVSAKIDKLNKIASASKGVDDFSGLGLGRLATRLDGREPIYVTIDDLGGPYTLKM
                     HAGDDNLRSKVGLSRDQELTQKIGNLNQAVLEAKAGLFVNPQQMTHLEQMMHGLKDST
                     KKNVVNLWFEGAKKVPTSLQAKLDNYATNSHIHINSNVKNGAINEKATGMLTQKNPEW
                     LKLVNDKIVAHNVGSVPLSDYDKIGFNQKNMKGYSDSFKFSTKFNNAVKNIKSGFEQF
                     LTDCFSTGSYSPKKAEYGVTKSGFQKS"
     gene            866101..866328
                     /locus_tag="HPSH112_RS04180"
                     /old_locus_tag="HPSH112_04290"
     CDS             866101..866328
                     /locus_tag="HPSH112_RS04180"
                     /old_loc