GenomeNet

Database: RefSeq
Entry: NC_017741
LinkDB: NC_017741
Original site: NC_017741 
LOCUS       NC_017741            1663456 bp    DNA     circular CON 11-JUN-2013
DEFINITION  Helicobacter pylori Shi112 chromosome, complete genome.
ACCESSION   NC_017741
VERSION     NC_017741.1  GI:386753519
DBLINK      Project: 162207
            BioProject: PRJNA162207
KEYWORDS    RefSeq.
SOURCE      Helicobacter pylori Shi112
  ORGANISM  Helicobacter pylori Shi112
            Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
            Helicobacteraceae; Helicobacter.
REFERENCE   1  (bases 1 to 1663456)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-APR-2012) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   2  (bases 1 to 1663456)
  AUTHORS   Kersulyte,D., Cabrera,L., Pacheco,R., Herrera,P., Rodriguez,C.,
            Gilman,R.H. and Berg,D.E.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2012) Molecular Microbiology, Washington
            University Medical School, 4940 Parkview Place, Saint Louis, MO
            63110, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP003474.
            Annotation was added by the NCBI Prokaryotic Genomes Automatic
            Annotation Pipeline Group. Information about the Pipeline can be
            found here:
            http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html. Please be
            aware that the annotation is done automatically with little or no
            manual curation.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1663456
                     /organism="Helicobacter pylori Shi112"
                     /mol_type="genomic DNA"
                     /strain="Shi112"
                     /isolation_source="gastric antrum of Amerindian resident"
                     /host="Homo sapiens"
                     /db_xref="taxon:1163740"
                     /country="Peru: Amazonian viillage of Shimaa"
     gene            complement(11..427)
                     /gene="nusB"
                     /locus_tag="HPSH112_00005"
                     /db_xref="GeneID:12772366"
     CDS             complement(11..427)
                     /gene="nusB"
                     /locus_tag="HPSH112_00005"
                     /note="COG0781 Transcription termination factor"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusB"
                     /protein_id="YP_006226738.1"
                     /db_xref="GI:386753520"
                     /db_xref="GeneID:12772366"
                     /translation="MATRTQARGAVVELLYAFESGNEEIKKIASSMLEEKKIKNNQLA
                     FALSLFNGVLEKINEIDALIEPHLKDWDFKRLGSMEKAILRLGAYEIGFTPTQNPIII
                     NECIELGKLYAEPNTPKFLNAILDSLSKKLAQKPLN"
     misc_feature    complement(32..418)
                     /gene="nusB"
                     /locus_tag="HPSH112_00005"
                     /note="Transcription termination factor NusB (N
                     protein-Utilization Substance B). NusB plays a key role in
                     the regulation of ribosomal RNA biosynthesis in eubacteria
                     by modulating the efficiency of transcriptional
                     antitermination. NusB along with other Nus...; Region:
                     Terminator_NusB; cd00619"
                     /db_xref="CDD:238342"
     misc_feature    complement(order(404..406,416..418))
                     /gene="nusB"
                     /locus_tag="HPSH112_00005"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238342"
     gene            complement(429..899)
                     /gene="ribH"
                     /locus_tag="HPSH112_00010"
                     /db_xref="GeneID:12772368"
     CDS             complement(429..899)
                     /gene="ribH"
                     /locus_tag="HPSH112_00010"
                     /note="COG0054 Riboflavin synthase beta-chain"
                     /codon_start=1
                     /transl_table=11
                     /product="6,7-dimethyl-8-ribityllumazine synthase"
                     /protein_id="YP_006226739.1"
                     /db_xref="GI:386753521"
                     /db_xref="GeneID:12772368"
                     /translation="MQIIEGKLHLQGNEKVAILTSRFNHIITDRLQEGAIDCFKRHGG
                     DENLLDIVLVPGAYELPFILERLLGSEKYDGVCVLGAIIRGGTPHFDYVSAEATKGIA
                     NAMLKYSMPVSFGVLTTDNVEQAIERAGSKAGNKGFEAMSTLIELLSLCQTLKG"
     misc_feature    complement(456..854)
                     /gene="ribH"
                     /locus_tag="HPSH112_00010"
                     /note="lumazine synthase (6,7-dimethyl-8-ribityllumazine
                     synthase, LS), catalyzes the penultimate step in the
                     biosynthesis of riboflavin (vitamin B2); type-I; Region:
                     Lumazine_synthase-I; cd09209"
                     /db_xref="CDD:187742"
     misc_feature    complement(order(459..464,471..473,483..485,492..494,
                     516..518,528..530,540..542,546..548,552..554,558..560,
                     570..575,582..596,600..608,612..620,624..629,633..635,
                     639..644,648..650,681..683,693..695,699..707,711..719,
                     723..728,735..746,831..833,849..851))
                     /gene="ribH"
                     /locus_tag="HPSH112_00010"
                     /note="homopentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187742"
     misc_feature    complement(order(483..485,492..494,516..518,549..563,
                     630..635,639..641,645..662,723..734,828..833))
                     /gene="ribH"
                     /locus_tag="HPSH112_00010"
                     /note="active site"
                     /db_xref="CDD:187742"
     gene            complement(909..1739)
                     /locus_tag="HPSH112_00015"
                     /db_xref="GeneID:12772370"
     CDS             complement(909..1739)
                     /locus_tag="HPSH112_00015"
                     /EC_number="2.5.1.55"
                     /note="COG2877 3-deoxy-D-manno-octulosonic acid (KDO)
                     8-phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxyphosphooctonate aldolase"
                     /protein_id="YP_006226740.1"
                     /db_xref="GI:386753522"
                     /db_xref="GeneID:12772370"
                     /translation="MKTSKTKTPKSVLIAGPCVIESLENLRSIATKLQPLANNERLDF
                     YFKASFDKANRTSLESYRGPGLEKGLEMLQTIKDEFGYKILTDVHESYQASAAAKVAD
                     ILQIPAFLCRQTDLIVEVSQTNAIINIKKGQFMNPKDMQYSVLKALKTRDSSIQNPTY
                     ETALKNGVWLCERGSSFGYGNLVVDMRSLKIMREFAPVIFDATHSVQMPGGANGKSSG
                     DSSFAPILARAAAAVGIDGLFAETHVDPKNALSDGANMLKPDELEHLVADMLKIQNLF
                     "
     misc_feature    complement(915..1706)
                     /locus_tag="HPSH112_00015"
                     /note="2-dehydro-3-deoxyphosphooctonate aldolase;
                     Provisional; Region: PRK05198"
                     /db_xref="CDD:235363"
     gene            complement(1726..2391)
                     /locus_tag="HPSH112_00020"
                     /db_xref="GeneID:12772372"
     CDS             complement(1726..2391)
                     /locus_tag="HPSH112_00020"
                     /note="COG0288 Carbonic anhydrase"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_006226741.1"
                     /db_xref="GI:386753523"
                     /db_xref="GeneID:12772372"
                     /translation="MKAFLGALEFQENEYEELKEFYESLKTKQKPHTLFISCVDSRVV
                     PNLITGTKPGELYAIRNMGNVIPPKTSYKESLSTMASIEYAIVHVGIQNLIICGHSDC
                     GACGSIHLINDETTKAKTPYIADWIQFLEPIKEELKNHPQFSSHFAKRSWLTERLNVR
                     LQLNNLLSYDFIQERVMNNELKIFGWHYIIETGRIYNYNFESHFFEPIEETIKQRKSH
                     ENF"
     misc_feature    complement(1798..2376)
                     /locus_tag="HPSH112_00020"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeB; cd00884"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(1828..1830,2086..2088,2095..2097,
                     2125..2127,2140..2142,2221..2223,2230..2232,2266..2274,
                     2278..2280,2299..2301,2305..2307))
                     /locus_tag="HPSH112_00020"
                     /note="active site clefts [active]"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(2086..2088,2095..2097,2272..2274,
                     2278..2280))
                     /locus_tag="HPSH112_00020"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238449"
     misc_feature    complement(order(1807..1809,1813..1815,1819..1824,
                     1828..1830,2014..2016,2140..2145,2152..2157,2212..2214,
                     2218..2220,2224..2232,2245..2256,2260..2262,2266..2277))
                     /locus_tag="HPSH112_00020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238449"
     gene            2513..3196
                     /locus_tag="HPSH112_00025"
                     /db_xref="GeneID:12772380"
     CDS             2513..3196
                     /locus_tag="HPSH112_00025"
                     /EC_number="4.1.1.23"
                     /note="COG0284 Orotidine-5'-phosphate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="orotidine 5'-phosphate decarboxylase"
                     /protein_id="YP_006226742.1"
                     /db_xref="GI:386753524"
                     /db_xref="GeneID:12772380"
                     /translation="MQLCVALDLEKKEDNLSLLQELKGLDLWAKVGLRSFIRDGAVFL
                     DEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLEVDMLTVHLSSAKSALTILMQRL
                     NALKKRPLIMGVSTLTSFSEEEFLSVYNAPLKTQAIKLSVMGKESGIDGVVCSVFESL
                     AVKEALGKGFLTLTPGIRLDKNDKEDQERVANAKEAKQNLSDFIVVGRPIYQAKEPRE
                     VVLELLKDC"
     misc_feature    2519..3181
                     /locus_tag="HPSH112_00025"
                     /note="Orotidine 5'-phosphate decarboxylase (ODCase) is a
                     dimeric enzyme that decarboxylates orotidine
                     5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP),
                     an essential step in the pyrimidine biosynthetic pathway.
                     In mammals, UMP synthase...; Region:
                     OMP_decarboxylase_like; cd04725"
                     /db_xref="CDD:240076"
     misc_feature    order(2528..2530,2534..2536,2600..2602,2606..2608,
                     2687..2689,2693..2695,2861..2866,3035..3037,3131..3136)
                     /locus_tag="HPSH112_00025"
                     /note="active site"
                     /db_xref="CDD:240076"
     misc_feature    order(2606..2608,2612..2617,2690..2695,2699..2704,
                     2711..2716,2723..2728,2771..2779,2810..2812,2861..2863,
                     2918..2920,3134..3136)
                     /locus_tag="HPSH112_00025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240076"
     gene            3197..4027
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /db_xref="GeneID:12772382"
     CDS             3197..4027
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /EC_number="6.3.2.1"
                     /note="COG0414 Panthothenate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate--beta-alanine ligase"
                     /protein_id="YP_006226743.1"
                     /db_xref="GI:386753525"
                     /db_xref="GeneID:12772382"
                     /translation="MRALETITALREYRKSLKESVGFVPTMGALHKGHQSLIERSLKE
                     NSHTIVSVFVNPTQFGANEDFSAYPRPLEKDLALCEGLGVNAVFVPKTSEMYPYEIEQ
                     RLKLYAPTFLSHSLEGAMREGHFDGVVQVVLKLFHLVNPTRAYFGKKDAQQLLIIQHL
                     VQDLLLDIEIVPCEIVRDSDNLALSSRNVYLNATQRKQALAIPKALENIKQAIDKGEK
                     ACEKLKKLGLGILETLEVDYLEFCNHKLEPLKTIEPTNTLVLVAARVGKTRLLDNLWV
                     "
     misc_feature    3197..4018
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /note="Pantoate-beta-alanine ligase; Region: PanC;
                     cd00560"
                     /db_xref="CDD:185673"
     misc_feature    order(3269..3280,3287..3289,3293..3298,3305..3307,
                     3359..3361,3368..3370,3398..3400,3578..3580,3587..3592,
                     3632..3637,3641..3646,3653..3655,3716..3724,3746..3757)
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /note="active site"
                     /db_xref="CDD:185673"
     misc_feature    order(3269..3277,3287..3289,3296..3298,3305..3307,
                     3368..3370,3587..3592,3632..3637,3641..3646,3653..3655,
                     3719..3724,3743..3748)
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:185673"
     misc_feature    order(3269..3271,3275..3277,3359..3361,3368..3370,
                     3587..3592,3599..3601,3653..3655)
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /note="pantoate-binding site; other site"
                     /db_xref="CDD:185673"
     misc_feature    3287..3298
                     /gene="panC"
                     /locus_tag="HPSH112_00030"
                     /note="HXXH motif; other site"
                     /db_xref="CDD:185673"
     gene            complement(4041..4116)
                     /locus_tag="HPSH112_t08182"
                     /db_xref="GeneID:12772593"
     tRNA            complement(4041..4116)
                     /locus_tag="HPSH112_t08182"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:12772593"
     gene            complement(4180..4256)
                     /locus_tag="HPSH112_t08184"
                     /db_xref="GeneID:12772595"
     tRNA            complement(4180..4256)
                     /locus_tag="HPSH112_t08184"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:12772595"
     gene            complement(4297..4372)
                     /locus_tag="HPSH112_t08186"
                     /db_xref="GeneID:12772629"
     tRNA            complement(4297..4372)
                     /locus_tag="HPSH112_t08186"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12772629"
     gene            complement(4414..4488)
                     /locus_tag="HPSH112_t08188"
                     /db_xref="GeneID:12772793"
     tRNA            complement(4414..4488)
                     /locus_tag="HPSH112_t08188"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:12772793"
     gene            complement(4499..4574)
                     /locus_tag="HPSH112_t08190"
                     /db_xref="GeneID:12772794"
     tRNA            complement(4499..4574)
                     /locus_tag="HPSH112_t08190"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:12772794"
     misc_feature    complement(5073..6942)
                     /note="potential frameshift: common BLAST hit:
                     gi|208433984|ref|YP_002265650.1| outer membrane protein"
     gene            complement(7342..8982)
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /db_xref="GeneID:12772795"
     CDS             complement(7342..8982)
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="COG0459 Chaperonin GroEL (HSP60 family)"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin GroEL"
                     /protein_id="YP_006226744.1"
                     /db_xref="GI:386753526"
                     /db_xref="GeneID:12772795"
                     /translation="MAKEIKFSDSARNLLFEGVRQLHDAVKVTMGPRGRNVLIQKSYG
                     APSITKDGVSVAKEIELSCPVANMGAQLVKEVASKTADAAGDGTTTATVLAYSIFKEG
                     LRNITAGANPIEVKRGMDKAAEAIINELKKASKKVGGKEEITQVATISANSDHNIGKL
                     IADAMEKVGKDGVITVEEAKGIEDELDVVEGMQFDRGYLSPYFVTNAEKMTAQLDNAY
                     ILLTDKKISSMKDILPLLEKTMKEGKPLLIIAEDIEGEALTTLVVNKLRGVLNIAAVK
                     APGFGDRRKEMLKDIAVLTGGQVISEELGLTLENAEVEFLGKAGRIVIDKDNTTIVDG
                     KGHSHDVKDRVAQIKTQIASTTSDYDKEKLQERLAKLSGGVAVIKVGAASEVEMKEKK
                     DRVDDALSATKAAVEEGIVIGGGAALIRAAQKVHLNLHDDEKVGYEIIMRAIKAPLAQ
                     IAINAGYDGGVVVNEVQKHEGHFGFNASNGKYVDMFKEGIIDPLKVERIALQNAVSVS
                     SLLLTTEATVHEIKEEKATPAMPDMGGMGGMGGMGGMM"
     misc_feature    complement(7390..8982)
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(7423..8976)
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(7426..7446,7453..7455,7615..7617,
                     7828..7830,7834..7836,8215..8217,8299..8301,8395..8397,
                     8758..8760,8767..8769,8779..8781,8803..8805,8809..8811,
                     8839..8841,8845..8850,8863..8865,8869..8880,8911..8913,
                     8962..8964,8974..8976))
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(7507..7509,7513..7515,7630..7632,
                     7741..7743,7792..7794,8536..8538,8713..8715,8725..8727,
                     8887..8895))
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(7591..7593,7600..7605,7609..7611,
                     7636..7638,7690..7692,8659..8661))
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(7756..7761,7861..7863,8407..8409,
                     8428..8430,8563..8565))
                     /gene="groEL"
                     /locus_tag="HPSH112_00045"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(9005..9361)
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /db_xref="GeneID:12772796"
     CDS             complement(9005..9361)
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /note="COG0234 Co-chaperonin GroES (HSP10)"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="YP_006226745.1"
                     /db_xref="GI:386753527"
                     /db_xref="GeneID:12772796"
                     /translation="MKFQPLGERVLVERLEEENKTSSGIIIPDNAKEKPLMGVVKAVS
                     HKISEGCKCVKEGDVIAFGKYKGAEIVLDGVEYMVLELEDILGIVSSGSCCHTNSHDH
                     KHAKEHESCCHDHKKH"
     misc_feature    complement(9095..9358)
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(9098..9106,9152..9154,9158..9160,
                     9173..9175,9203..9205,9251..9256,9335..9337,9344..9346,
                     9350..9352,9356..9358))
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(9269..9310)
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(9227..9229)
                     /gene="groES"
                     /locus_tag="HPSH112_00050"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            9636..11315
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /db_xref="GeneID:12772797"
     CDS             9636..11315
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /EC_number="2.7.7.-"
                     /note="COG0358 DNA primase (bacterial type)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="YP_006226746.1"
                     /db_xref="GI:386753528"
                     /db_xref="GeneID:12772797"
                     /translation="MILKSSIDRLLQTIDIVEIISSYVDLRKSGSNYMACCPFHEERS
                     ASFSVNQVKGFYHCFGCGASGDSIKFVMEFEKLSFVEALEKLAHRFNVALEYDKGVYY
                     DHKEDYHLLEMVSSLYQEELFNAPFFLNYLQKRGLSIESIRAFKLGLCTNRIDYGIEN
                     KGLNKDKLIELGVLGKSDKKDRTYLRFLDRIMFPIYSPSAQVVGFGGRTLKEKAAKYI
                     NSPQNKLFDKSSLLYGYHLAKEHIYKQKQVIVTEGYLDVILLHQAGFKNAIATLGTAL
                     TPSHLPLLKKGEPEILLSYDGDKAGRNAAYKASLMLAKEQRRGGVILFENNLDPADMI
                     ANGQIETLKNWLSRPMAFIEFVLRHMAGSYLLDDPLEKDKALKEMLGFLKNFSLLLQS
                     EYKPLIASLLQAPLHVLGIRERVSFQPFYPKTEKPNHAQKLVNAPSTLSLEFLEKLVI
                     RYLLEDRSLLDLAVGYIHSGVFLHKKQEFDALCQEKLDDPKLVALLLDANLPLKKGGF
                     EKELRLLILRYFERQLKEIPKSSLPFSEKMIFLKKARQAIMKLKQGELVAI"
     misc_feature    9636..11303
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="DNA primase; Validated; Region: dnaG; PRK05667"
                     /db_xref="CDD:235551"
     misc_feature    9639..9932
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="CHC2 zinc finger; Region: zf-CHC2; pfam01807"
                     /db_xref="CDD:110780"
     misc_feature    9987..10352
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:254701"
     misc_feature    10371..10607
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="TOPRIM_DnaG_primases: The topoisomerase-primase
                     (TORPIM) nucleotidyl transferase/hydrolase domain found in
                     the active site regions of proteins similar to Escherichia
                     coli DnaG. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_DnaG_primases; cd03364"
                     /db_xref="CDD:173784"
     misc_feature    order(10389..10394,10401..10403,10521..10523,10527..10529,
                     10533..10535)
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="active site"
                     /db_xref="CDD:173784"
     misc_feature    order(10389..10391,10521..10523)
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173784"
     misc_feature    order(10395..10400,10416..10421,10449..10451)
                     /gene="dnaG"
                     /locus_tag="HPSH112_00055"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173784"
     gene            11312..12364
                     /locus_tag="HPSH112_00060"
                     /db_xref="GeneID:12772798"
     CDS             11312..12364
                     /locus_tag="HPSH112_00060"
                     /note="COG0482 Predicted
                     tRNA(5-methylaminomethyl-2-thiouridylate)
                     methyltransferase, contains the PP-loop ATPase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="argininosuccinate synthase"
                     /protein_id="YP_006226747.1"
                     /db_xref="GI:386753529"
                     /db_xref="GeneID:12772798"
                     /translation="MKPIKALALFSGGLDSLLSMKLLIDQGIEVSALHFNIGFGGNKD
                     KREYFENATAQIGAKLLVCDIREQFFNDVLFKPKYGYGKYFNPCIDCHANMFRNAFYK
                     MLELNADFVLSGEVLGQRPKSQRKEALNQVRKLVREVGEEARFDPILDRTQASGEKPQ
                     FLDELLLRPMSAKLLEPTFMEKKGWVDREKLLDVSGRGRSRQLQMIKDYGLKYYEKPG
                     GGCLLTDIQVSNKIKNLKEYREMVFEDSVIVKNGRYFILPNNARLVVARNEEENHKLD
                     IQHPLMDKIELLSCKGPLSLVDKNASKEDKELAGRIALGYAKTLKNQAYLIQIGDEKR
                     ELYPLDKESAREYLFA"
     misc_feature    11312..12337
                     /locus_tag="HPSH112_00060"
                     /note="Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
                     methyltransferase, contains the PP-loop ATPase domain
                     [Translation, ribosomal structure and biogenesis]; Region:
                     TrmU; COG0482"
                     /db_xref="CDD:223558"
     misc_feature    11324..11944
                     /locus_tag="HPSH112_00060"
                     /note="ThiI is required for thiazole synthesis in the
                     thiamine biosynthesis pathway. It belongs to the Adenosine
                     Nucleotide Hydrolysis suoerfamily and predicted to bind to
                     Adenosine nucleotide; Region: ThiI; cd01712"
                     /db_xref="CDD:238845"
     misc_feature    order(11336..11344,11348..11359,11414..11416,11420..11422)
                     /locus_tag="HPSH112_00060"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238845"
     gene            12456..13283
                     /locus_tag="HPSH112_00065"
                     /db_xref="GeneID:12772799"
     CDS             12456..13283
                     /locus_tag="HPSH112_00065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226748.1"
                     /db_xref="GI:386753530"
                     /db_xref="GeneID:12772799"
                     /translation="MQEFLGFGVVGNFAGHLEQAGESHSFINMKSEEKDAPKGLFPFY
                     IPYENCYLGRCCIDNHKIILPNDPNLRVQAEPEIALECDVKYDEKHFVTKLVPNFFMA
                     FNDTSVRNLDATKLSQKKNFSPASKGMGKKLPIDRFVYGGVCNNFSIASFLKYNNVWR
                     IYGENSKLIKYEFFYQKLLDWIKDRLNYQQDGDSLEALRPFLEHHNFPTKMIFAIGAT
                     PYMPFAQEHFLQKGDEVAIVAYNHLQYSFEKIQNLLEENALQTKEHANLSYVYQIVE"
     gene            13431..13712
                     /locus_tag="HPSH112_00070"
                     /db_xref="GeneID:12772800"
     CDS             13431..13712
                     /locus_tag="HPSH112_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="ComB2 competence protein"
                     /protein_id="YP_006226749.1"
                     /db_xref="GI:386753531"
                     /db_xref="GeneID:12772800"
                     /translation="MSAHFLKIIFLVGMCVSSLFAEGLEGFFNALEAQLKSPIAKGIL
                     MVIFIGIAIYVWRNLDRWKEILFTILGVVFGIFLFFKAPSLANWFMGIF"
     misc_feature    <13503..13697
                     /locus_tag="HPSH112_00070"
                     /note="TrbC/VIRB2 family; Region: TrbC; pfam04956"
                     /db_xref="CDD:252903"
     gene            13712..13975
                     /locus_tag="HPSH112_00075"
                     /db_xref="GeneID:12772801"
     CDS             13712..13975
                     /locus_tag="HPSH112_00075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226750.1"
                     /db_xref="GI:386753532"
                     /db_xref="GeneID:12772801"
                     /translation="MIILSASVKNLREISVKEKFLWLNAKSYLISVFAPFILLPWIDL
                     LSAFLLYLGFLALFSVLEFFDEDIADIIIARSKIKTKTKCYRA"
     gene            13977..16340
                     /locus_tag="HPSH112_00080"
                     /db_xref="GeneID:12772802"
     CDS             13977..16340
                     /locus_tag="HPSH112_00080"
                     /note="COG3451 Type IV secretory pathway, VirB4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226751.1"
                     /db_xref="GI:386753533"
                     /db_xref="GeneID:12772802"
                     /translation="MLEKLLSAIKQKVSNYFLGVLPKSYSMSEENNILGLYDEHFLLT
                     KNENLVGILRLEGVSYTHLSTEQLQDLFTERQMALDSLEKVVARLVVKRRKIDHQQNI
                     QSDSKYLQAILNQFENKEVYENQYFLVLESAHSLQGVLEHKKKSLMHANRENFKDILS
                     YKAHFLQETLKSLEIQLKNYAPKLLSSKEVLNFYAEYINGFDLPLKPLVGGYLSDSYI
                     ASSITFEKDYFIQESFNQKTYNRLIGIKAYESERITSIAIGALLYQETPLDIIFSIEP
                     MSVNKTLSFLKERAKFSMSNLVKNELLEYQELVKTKRLSMQKFALNILIKAPSLEDLD
                     AQTSLVLGLLFKENLVGVIETFGLKGGYFSFFPERIHLNHRLRFLTSKALACLMVFER
                     QNLGFKANSWGNSPLSVFKNLDYSPFLFNFHNQEVSHNNAKEIARVNGHTLIIGATGS
                     GKSTLISFLMMSALKYQNMRLLAFDRMQGLYSFTKFFKGHYHDGKSFSINPFCLEPNL
                     QNLEFLQSFFLSMFDLAPSRDKEALEDMNAISGAIKSLYETLYPKDFSLLDFKETLKR
                     TSSNQLGLSLEPYLNNPLFNALNDAFNSNAFLNVINLDTITQNPKDLGLLAYYLFYKI
                     LEESRKNDSGFLVFLDEFKSYVENDLLNAKINALITQARKANGVVVLALQDIYQLSGV
                     KNAHSFLSNMGTLILYPQKNARELKHHFNVPLSETEISFLENTPLYARQVLVKNLGNR
                     SSNMIDVSLESLGRYLKIFNSDSSHVNKVKALQKDYPTEWREKLLKS"
     misc_feature    14037..16331
                     /locus_tag="HPSH112_00080"
                     /note="type IV secretion/conjugal transfer ATPase, VirB4
                     family; Region: VirB4_CagE; TIGR00929"
                     /db_xref="CDD:233193"
     misc_feature    14499..15101
                     /locus_tag="HPSH112_00080"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     misc_feature    15288..16100
                     /locus_tag="HPSH112_00080"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(15312..15317,15327..15335)
                     /locus_tag="HPSH112_00080"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(15315..15317,15327..15335,15393..15395,15399..15404,
                     15894..15899)
                     /locus_tag="HPSH112_00080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    15882..15896
                     /locus_tag="HPSH112_00080"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            16661..18001
                     /locus_tag="HPSH112_00085"
                     /db_xref="GeneID:12772803"
     CDS             16661..18001
                     /locus_tag="HPSH112_00085"
                     /note="COG3014 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226752.1"
                     /db_xref="GI:386753534"
                     /db_xref="GeneID:12772803"
                     /translation="MDLEHFNTLYYEESPKKAYEYSKQFTKKKKNALLWDLQNGLSAL
                     YARDYKTSLGVLDQAEQRFDKTQSAFTRGAGYVGATMINDNVRAYGGNIYEGVLINYY
                     KAIDYMLLNDSANARVQFNRANERQRRAKEFYYEEVQKAIKEIDSSKKHNINMERSRA
                     EVSEILNNTYSNLDKYEAYQGLLNPAVSYLSGLFYALNGDKNKGLGYLNEAYGISQSP
                     FVAKDLVFFKNPNRSYFTWIIIEDGKEPQKSEFKIDVPIYAIDSIYNVSVALPKLEKG
                     EAFYQNFTLKDGEKVTPFDTLASIDAVVSSEFRKQLPYIITRAILSATFKVGMQAVAN
                     YYLGFVGGLVTSLYSGVSTFADTRNTSIFAHKIYLMRIKNKAFENYEVQADSIDAFSF
                     SLKPCKRSLENPKVIDARELLSGFVTAPQIFCSNRHNILYVRSFKNGFVLNRLK"
     misc_feature    16661..17941
                     /locus_tag="HPSH112_00085"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3014"
                     /db_xref="CDD:225559"
     gene            18097..19062
                     /locus_tag="HPSH112_00090"
                     /db_xref="GeneID:12772804"
     CDS             18097..19062
                     /locus_tag="HPSH112_00090"
                     /note="COG0835 Chemotaxis signal transduction protein"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheV"
                     /protein_id="YP_006226753.1"
                     /db_xref="GI:386753535"
                     /db_xref="GeneID:12772804"
                     /translation="MTDSLAGIDQVTSLHKNNELQLLCFRLGKNKGLYAVNVFKIREV
                     VKYHGNLTVISHENNSLVEGLIIIRELTIPLIDMKKWFYYDSQNKNKDLRPYRIEKEK
                     GEDDIVMICEFSRWTIGVRIYEADRILSKKWTEMEQSAGLGGSAGNNKLVSRTRYFDG
                     RLVQVVDIEKMLIDVFPWIEDEKHSDLETLSKIHSNQCVLLADDSPSVLKTMQMILDK
                     LGVKHIDFINGKTLLEHLFNPTTDVSSIGLIITDLEMPEASGFEVIKQVKNNPLTSKI
                     PIVVNSSMSGSSNEDMARSLKADDFISKSNPKDIQRVVKQFLESA"
     misc_feature    18151..18609
                     /locus_tag="HPSH112_00090"
                     /note="CheW-like domain. CheW proteins are part of the
                     chemotaxis signalling mechanism in bacteria. CheW
                     interacts with the methyl accepting chemotaxis proteins
                     (MCPs) and relays signals to CheY, which affects flageller
                     rotation. This family includes CheW and...; Region:
                     CheW_like; cd00588"
                     /db_xref="CDD:238331"
     misc_feature    18694..19050
                     /locus_tag="HPSH112_00090"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(18703..18708,18850..18852,18874..18876,18949..18951,
                     18997..18999,19006..19011)
                     /locus_tag="HPSH112_00090"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    18850..18852
                     /locus_tag="HPSH112_00090"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(18859..18864,18868..18876)
                     /locus_tag="HPSH112_00090"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    19006..19011
                     /locus_tag="HPSH112_00090"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            19059..20276
                     /locus_tag="HPSH112_00095"
                     /db_xref="GeneID:12772805"
     CDS             19059..20276
                     /locus_tag="HPSH112_00095"
                     /note="COG0019 Diaminopimelate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxynorspermidine decarboxylase"
                     /protein_id="YP_006226754.1"
                     /db_xref="GI:386753536"
                     /db_xref="GeneID:12772805"
                     /translation="MKKYSAIPTPCYVLESERLEKNAKILEIVRQQSGAKVLLALKGY
                     AFWREFGILRQKLNGCCASGLYEAKLAFEEFGGRESRKEICVYSPAFKEAEMSAILPL
                     ATSIIFNSFYQYATYKDRILDKNKQLENLGLSPIKMGLRINPLYSEVTPAIYNPCSKV
                     SRLGVTPSEFEKGVKEHGLEGVSGLHFHTHCEQNADALCRTLEHVERHFKPYLENMEW
                     VNFGGGHHITRSDYDVNLLIQTIKDFKERYHDIEVVLEPGEAIGWQCGFLIASVIDIV
                     KNDQEIAILDASFSAHMPDCLEMPYRPSILKVSVENDEELVEVEKGENQGAFSYFLGG
                     PTCLAGDFMGSFSFETPLKRGDKIVFQDMLHYTIVKNNSFNGVPLPSLARLDQQGFKI
                     LKNFSYEDYKNRN"
     misc_feature    19077..20273
                     /locus_tag="HPSH112_00095"
                     /note="carboxynorspermidine decarboxylase; Region: nspC;
                     TIGR01047"
                     /db_xref="CDD:233247"
     misc_feature    19083..20216
                     /locus_tag="HPSH112_00095"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Carboxynorspermidine Decarboxylase; Region:
                     PLPDE_III_CANSDC; cd06829"
                     /db_xref="CDD:143502"
     misc_feature    order(19083..19085,19182..19184,19245..19250,19254..19259,
                     19335..19337,19383..19385,19392..19394,19404..19406,
                     19521..19532,19875..19886,19902..19904,19908..19910,
                     19914..19916,19923..19925,20058..20060,20064..20072,
                     20079..20081,20163..20171,20178..20186)
                     /locus_tag="HPSH112_00095"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143502"
     misc_feature    order(19176..19178,19182..19184,19239..19241,19320..19322,
                     19479..19481,19620..19622,19629..19631,19725..19730,
                     19824..19835,20067..20072,20154..20156,20166..20168,
                     20178..20180)
                     /locus_tag="HPSH112_00095"
                     /note="active site"
                     /db_xref="CDD:143502"
     misc_feature    order(19176..19178,19182..19184,19239..19241,19320..19322,
                     19479..19481,19620..19622,19629..19631,19725..19730,
                     19824..19835,20067..20069,20154..20156)
                     /locus_tag="HPSH112_00095"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143502"
     misc_feature    order(19182..19184,20067..20069)
                     /locus_tag="HPSH112_00095"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143502"
     misc_feature    order(19629..19631,19833..19835,20067..20072,20154..20156,
                     20166..20168,20178..20180)
                     /locus_tag="HPSH112_00095"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143502"
     gene            complement(20286..20858)
                     /locus_tag="HPSH112_00100"
                     /db_xref="GeneID:12772806"
     CDS             complement(20286..20858)
                     /locus_tag="HPSH112_00100"
                     /note="COG0671 Membrane-associated phospholipid
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A 1-phosphatase"
                     /protein_id="YP_006226755.1"
                     /db_xref="GI:386753537"
                     /db_xref="GeneID:12772806"
                     /translation="MKRFLFKQKFCESLPKSFSKTLLALSLGLILLGIFAPFPKVPKH
                     KSVPLVFHFTEHYARFIPTILSVAIPLIQRDAIGLFQVANASIATTLLTHTTKRALNN
                     ATINDQRLGERPYGGNFNMPSGHSSMVGLAVAFLMRRYSFKKYWWLLPLVPLTMLARI
                     YLDAHTTGAVLAGLGIGMLCVSLFTSPKKP"
     misc_feature    complement(20289..20858)
                     /locus_tag="HPSH112_00100"
                     /note="lipid A 1-phosphatase; Reviewed; Region: PRK09597"
                     /db_xref="CDD:181978"
     misc_feature    complement(20289..20756)
                     /locus_tag="HPSH112_00100"
                     /note="Membrane-associated phospholipid phosphatase [Lipid
                     metabolism]; Region: PgpB; COG0671"
                     /db_xref="CDD:223743"
     misc_feature    complement(order(20352..20354,20364..20366,20382..20384,
                     20484..20492,20520..20522,20568..20570))
                     /locus_tag="HPSH112_00100"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            complement(20869..22440)
                     /locus_tag="HPSH112_00105"
                     /db_xref="GeneID:12772807"
     CDS             complement(20869..22440)
                     /locus_tag="HPSH112_00105"
                     /note="COG2194 Predicted membrane-associated,
                     metal-dependent hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A phosphoethanolamine transferase"
                     /protein_id="YP_006226756.1"
                     /db_xref="GI:386753538"
                     /db_xref="GeneID:12772807"
                     /translation="MTPLFHLKFLKPLSCLQAGLLYSLIFGVLYHFPLFAYVYKESNQ
                     VSFIAMIVVVLFCVNGTLFLTLGLISIHLMRLSAIVFSLLNSIAFYFISAYGVFLNKS
                     MMGNVLNTNTHELLGFLSVKLFIVIVVFGVLPGYVIYKIPLKNSSKKAPFLAILALVF
                     IFIASALMNAKNWLWFDKHAKFIGGLILPFAYSVNAFRVSALKFFAPTIKPLPLFSPN
                     RSHSFVVLVIGESARKHNYALYGYKKPTTPKLSKRLADNELTLFDAISCATYTTASLE
                     CILDSSFKNSLNAYENLPTYLTKAGIKVFWYSANDGEKNVKVTSYLKNYELIQKCPNC
                     EAIAPYDESLLYNLPDLLKEHSNENVLLILHLAGSHGPNYDNKVPLNFRVFKPYCSSA
                     DLSSCSKESLINAYDNTIFYNDYLLDKIISMLKNAKQPALMIYLSDHGESLGEGAYYL
                     HGIPKSIAPKEQYEIPFIVYANEPFKEKHSIIQTQTPINQNVVFHSILGVFEDFKNPS
                     AVYRPSLDLLKHKKE"
     misc_feature    complement(20872..22440)
                     /locus_tag="HPSH112_00105"
                     /note="lipid A phosphoethanolamine transferase; Reviewed;
                     Region: PRK09598"
                     /db_xref="CDD:236581"
     misc_feature    complement(21820..22281)
                     /locus_tag="HPSH112_00105"
                     /note="Domain of unknown function (DUF1705); Region:
                     DUF1705; pfam08019"
                     /db_xref="CDD:149223"
     misc_feature    complement(20938..21771)
                     /locus_tag="HPSH112_00105"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     gene            22485..22706
                     /locus_tag="HPSH112_00110"
                     /db_xref="GeneID:12772808"
     CDS             22485..22706
                     /locus_tag="HPSH112_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226757.1"
                     /db_xref="GI:386753539"
                     /db_xref="GeneID:12772808"
                     /translation="MGILWFILRLLGWLARALKRVCYKIFHAPWLGYGANEGHGMKRK
                     SGKRKNSKRSFKPLEISFSWFKVVFLRER"
     gene            complement(22806..24869)
                     /locus_tag="HPSH112_00115"
                     /db_xref="GeneID:12772809"
     CDS             complement(22806..24869)
                     /locus_tag="HPSH112_00115"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein HopD"
                     /protein_id="YP_006226758.1"
                     /db_xref="GI:386753540"
                     /db_xref="GeneID:12772809"
                     /translation="MKKKFLSLTLGSLLVSTLSAEDNGFFVSAGYQIGESSQMVKNTK
                     GIQDLSDSYERLNHLLTSYSALNTLIRQSTDSNAINNARTNLDASAKNLISDKASSPA
                     YQAVLLALNAAAGLWQVMSYAISPCGPGKDSNKNGGVQTFENTPTNQWGGTTITCNTT
                     GYEPGPYSIISTENYAKINKAYQIIQKAFGASGKDIPALSDTNTELKFTINGSNNSNN
                     NKEEIITKNNAQILLEQASTIITTLNSACPWINNGGKGGASSGSLWEGIHLKGDGSAC
                     GIFKNEISAIQDMIKNAQIAVEQSKIVATNAQNQDNLDTGKAFNPYKDADFSQSMFAN
                     ARAQVEILNRVQAVVKDFERIPAAFVKDSLGVCHEVQNGHLRGTPSGTVTSNTWGAGC
                     AYVGETVTNLKNSIAHFGDQAQQIHNAQDLAYTLANFSSQYKKLGEHYDSITAAISSL
                     PDAQSLQNVVSKKTNPNSPQGIQDNYYIDSNIHSQVQSRTQELGSNPFRRAGLIAAST
                     TNNGAMNGIGFQVGYKQFFGKNKRWGARYYGFVDYNHTYNKSQFFNASSDVWTYGVGS
                     DLLVNFINDKATKHNKISFGAFGGIQLAGTSWLNSQFVNLANVNNYYKAKINTSNFQF
                     LFNLGLRTNLARNKRRGADHSAQHGMELGVKIPTINTNYYSLLGTTLQYRRLYSVYLN
                     YVFAY"
     misc_feature    complement(22809..23318)
                     /locus_tag="HPSH112_00115"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            25098..25316
                     /locus_tag="HPSH112_00120"
                     /db_xref="GeneID:12772810"
     CDS             25098..25316
                     /locus_tag="HPSH112_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226759.1"
                     /db_xref="GI:386753541"
                     /db_xref="GeneID:12772810"
                     /translation="MNGGSYKKGVFNFDGFGFAVIYCKNDFLNFLKRGVLQPFFPKTQ
                     GFACKSGVKFWLHAVKLPLAWWRDASLL"
     gene            complement(25393..26673)
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /db_xref="GeneID:12772811"
     CDS             complement(25393..26673)
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /EC_number="2.3.3.1"
                     /note="COG0372 Citrate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="type II citrate synthase"
                     /protein_id="YP_006226760.1"
                     /db_xref="GI:386753542"
                     /db_xref="GeneID:12772811"
                     /translation="MSVTLINNENNERYEFETIECTRGPKAVDFSKLFETTGFFSYDP
                     GYSSTAGCQSKISYINGKKGELYYRGHRIEDLVAKYKYVDVCKLLLTGELPKNQEESL
                     EFELELRHRSFVHESLLNMFSAFPTNAHPMAKLSSGVSILSTLYSTHQNMHTEEDYQT
                     MARRIVAKIPTLAAICYRNEVGAPIIYPDIARSYVENILFMLRGYPYSRLKHTTQGEV
                     EITPLEVEAFDKILTLHADHSQNASSTTVRNVASTGVHPYAAISAGISALWGHLHGGA
                     NEKVLLQLEEIGDVKNVDKYIARVKDKNDNFKLMGFGHRVYKSYDPRAKILKGLKDEL
                     HQKGVKMDERLSEIAAKVEEIALKDEYFIERNLYPNVDFYSGTILRALKIPVRFFTPV
                     FVIGRTVGWCAQLLEHVKSPQARITRPRQVYVGD"
     misc_feature    complement(25399..26628)
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="Escherichia coli (Ec) citrate synthase (CS)
                     GltA_like. CS catalyzes the condensation of acetyl
                     coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate
                     and coenzyme A (CoA), the first step in the citric acid
                     cycle (TCA or Krebs cycle). The overall CS...; Region:
                     EcCS_like; cd06114"
                     /db_xref="CDD:99867"
     misc_feature    complement(25399..26601)
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="Citrate synthase [Energy production and
                     conversion]; Region: GltA; COG0372"
                     /db_xref="CDD:223449"
     misc_feature    complement(order(25399..25425,25429..25431,25726..25731,
                     25843..25848,25852..25869,25873..25878,25897..25899,
                     25906..25917,25924..25926,25936..25941,25948..25962,
                     26239..26247,26254..26256,26263..26265,26275..26277,
                     26287..26289,26299..26307,26311..26316,26323..26325,
                     26356..26361,26368..26373,26380..26382,26389..26400,
                     26422..26424,26437..26439,26449..26451,26458..26469,
                     26503..26505,26509..26559))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(25420..25422,25429..25431,25483..25485,
                     25495..25497,25558..25560,25564..25566,25573..25575,
                     25579..25581,25705..25707,25720..25722,25729..25752,
                     25837..25839,25846..25848,25852..25860,25951..25953,
                     25960..25962,26533..26535))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="active site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(25483..25485,25564..25566,25705..25707,
                     25729..25743,25747..25752,25855..25860,25951..25953,
                     25960..25962,26533..26535))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="citrylCoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(26104..26106,26170..26172,26182..26184,
                     26236..26238,26329..26349,26353..26355))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="NADH binding [chemical binding]; other site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(26056..26061,26101..26139,26290..26307,
                     26314..26340))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="cationic pore residues; other site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(25420..25422,25483..25485,25495..25497,
                     25558..25560,25705..25707,25732..25734,25852..25857,
                     25951..25953,25960..25962))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="oxalacetate/citrate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(25429..25431,25558..25560,25564..25566,
                     25573..25575,25579..25581,25720..25722,25729..25731,
                     25735..25752,25837..25839,25846..25848,25855..25860))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="coenzyme A binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:99867"
     misc_feature    complement(order(25558..25560,25732..25734,25855..25857))
                     /gene="gltA"
                     /locus_tag="HPSH112_00125"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:99867"
     gene            26871..28148
                     /locus_tag="HPSH112_00130"
                     /db_xref="GeneID:12772812"
     CDS             26871..28148
                     /locus_tag="HPSH112_00130"
                     /note="COG0538 Isocitrate dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase"
                     /protein_id="YP_006226761.1"
                     /db_xref="GI:386753543"
                     /db_xref="GeneID:12772812"
                     /translation="MAYNPKILQKPKEGEEITIKDNKLHVPNHPIIPFIEGDGIGSDI
                     TPAMIKVVDSAVQKAYKGEKKIAWYEVFVGEKCYQKFKDHKELSPEEQWLLPDTIEAI
                     NHYKVSIKGPLTTPIGEGFRSLNVALRQKMDLYVCLRPVRWYGSPSPVKEPQKVDMVI
                     FRENSEDIYAGIEWQEGSAEAKKLIHFLQNELKVKKIRFPESSGIGVKPISKEGTERL
                     VRKAIEYAIDNDKPSVTFVHKGNIMKYTEGAFMKWGYALAQKEFNAQVIDKGPWCSLK
                     NPKTGKEIIIKDMIADAFLQQILLRPSEYSVIATMNLNGDYISDALAAMVGGIGIAPG
                     ANLNDTVGMFEATHGTAPKYAGLDKVNPGSIILSAEMMLRHMGWVEAADLIVSAMEKA
                     IKGKKVTYDFARLMDGAKEVKCSEFASVMIENM"
     misc_feature    26901..28145
                     /locus_tag="HPSH112_00130"
                     /note="Isocitrate/isopropylmalate dehydrogenase; Region:
                     Iso_dh; cl00445"
                     /db_xref="CDD:260425"
     gene            28220..28747
                     /locus_tag="HPSH112_00135"
                     /db_xref="GeneID:12772813"
     CDS             28220..28747
                     /locus_tag="HPSH112_00135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226762.1"
                     /db_xref="GI:386753544"
                     /db_xref="GeneID:12772813"
                     /translation="MIKFVRNVVLFILTAIFLALMLLVSYCMPHYSAAVISGVEVKRM
                     NENENTPNNKEVKTLARDVYFVQTYDPKDKKSVTVYRNEDTRFSFPFYFKFNSADISA
                     LAQSLVNQQVEVKYYGWRINLFNMFPNVIFLKPLKESADISKPIFSWILYALLLMGFF
                     ISVSSVCTLFKSKAH"
     misc_feature    28232..28729
                     /locus_tag="HPSH112_00135"
                     /note="Protein of unknown function (DUF1523); Region:
                     DUF1523; pfam07509"
                     /db_xref="CDD:116129"
     gene            complement(28724..29380)
                     /locus_tag="HPSH112_00140"
                     /db_xref="GeneID:12772814"
     CDS             complement(28724..29380)
                     /locus_tag="HPSH112_00140"
                     /note="COG0132 Dethiobiotin synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthetase"
                     /protein_id="YP_006226763.1"
                     /db_xref="GI:386753545"
                     /db_xref="GeneID:12772814"
                     /translation="MLFISATNTNAGKTTCARLLAQYCNACGVRTILLKPIETGVNDT
                     TNHFSDAHLFLQDNRLLDRSLTLKDISFYRYAKASAPLIAQQEENQNAPIDTNDLIQR
                     LQNFTKTYDLVIVEGAGGLCVPITLEENMLDLALKLKAKILVISHDNLGLINDCLLND
                     FLLKSHQLDYKIAINLRENNAAFHSVSLPYIKLFNERSNNPIVIFQQSLKELMSFALK
                     "
     misc_feature    complement(28757..29380)
                     /locus_tag="HPSH112_00140"
                     /note="Dethiobiotin synthetase [Coenzyme metabolism];
                     Region: BioD; COG0132"
                     /db_xref="CDD:223210"
     misc_feature    complement(28796..29377)
                     /locus_tag="HPSH112_00140"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     gene            complement(29384..29704)
                     /locus_tag="HPSH112_00145"
                     /db_xref="GeneID:12772815"
     CDS             complement(29384..29704)
                     /locus_tag="HPSH112_00145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226764.1"
                     /db_xref="GI:386753546"
                     /db_xref="GeneID:12772815"
                     /translation="MVENSKKEKVSKTLLAKVLANTTDTDASYCFISDLAVQLDNISP
                     RVSKSIITAQAESVRLTYALIDKVLYNSLHNILSFIFDNVKLPQTKNALTAQIFDGAY
                     QFKG"
     gene            29883..30296
                     /locus_tag="HPSH112_00150"
                     /db_xref="GeneID:12772816"
     CDS             29883..30296
                     /locus_tag="HPSH112_00150"
                     /note="COG0589 Universal stress protein UspA and related
                     nucleotide-binding proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="putative universal stress global response
                     regulator UspA"
                     /protein_id="YP_006226765.1"
                     /db_xref="GI:386753547"
                     /db_xref="GeneID:12772816"
                     /translation="MNILFGISDTQECYNAIKFAVKLAHSLKEVRFTLLHVSMEVFIY
                     SESGMMDYGQTEALEEEKAKALLKQFEDAFKKENIECESVLKSGDLIDVVLDMAKDYD
                     LLLIGASESNLLYRLFISHQNSLVEQSSIPVVIAK"
     misc_feature    29886..30290
                     /locus_tag="HPSH112_00150"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(29898..29906,29991..29993,30198..30203,30207..30212,
                     30240..30248)
                     /locus_tag="HPSH112_00150"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            30311..30586
                     /locus_tag="HPSH112_00155"
                     /db_xref="GeneID:12772817"
     CDS             30311..30586
                     /locus_tag="HPSH112_00155"
                     /note="COG2127 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease adapter protein ClpS"
                     /protein_id="YP_006226766.1"
                     /db_xref="GI:386753548"
                     /db_xref="GeneID:12772817"
                     /translation="MKMYDIPTPTMAQVIMVDDPITTAEFVISALRDFFDKSLEEAQA
                     LTSSIHRDGEGVCGVYPYDIARHRAAWVRDKARELDLPLKLLVEEIR"
     misc_feature    <30326..30580
                     /locus_tag="HPSH112_00155"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2127"
                     /db_xref="CDD:225038"
     gene            30586..32808
                     /locus_tag="HPSH112_00160"
                     /db_xref="GeneID:12772818"
     CDS             30586..32808
                     /locus_tag="HPSH112_00160"
                     /note="COG0542 ATPases with chaperone activity,
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent C1p protease ClpA"
                     /protein_id="YP_006226767.1"
                     /db_xref="GI:386753549"
                     /db_xref="GeneID:12772818"
                     /translation="MAKFNQDLNEVLNRALNLALDLNHALCTTEHVLLVILEHESGAK
                     MIGALERDDYDRLKQILKDYLLQYVPLKSDPAKMPARSFVLLRMLKRMYASGFESVGV
                     EELLILMLDHPDCYASKLMDSFGIARLYSNPALLDLDNHGIPNDTNNEEAPKNTPLKK
                     YAKNLSALAQDNALDPVIGREEEILRVIEILGRRKKNNPLLIGEAGVGKTSIAEALAL
                     KIVQKEVPEFLQEYEVYSLDLALMVAGAKYRGDFEKRLKKTLKEIQENGRIILFIDEI
                     HTLLGAGNTNAGSLDAANILKPVLTDGSLKCLGATTFEEYRSVFEKDKAFNRRFSVIK
                     VEEPSKEACYLILKKIAPLYEEHHQVRYDESVFKACVDLTSYYMHDRFLPDKAIELLD
                     EVGSRKKISPKKGKKISVDDVKEALAIKLKIPKMRLSSDKKALLRNLEKSLKNKIFAQ
                     AEAINLVSNAIKIQHCGLSAKNKPVGSFLFVGPSGVGKTELAKELALNLNLHFERFDM
                     SEYKEAHSVAKLIGSPSGYVGFEQGGLLVNAIKKHPHCLLLLDEIEKAHSNVYDLLLQ
                     VMDNATLSDNLGNQASFKHVILIMTSNVGSKDKDALGFFSAKNTKYDKAVRELLTPEL
                     RSRIDAIVPFNTLGLEDFERIVSVELDKLKALALEQDIALKFHKEVLKFIAQKSYQTT
                     LGAREIKKIIHNEIKTPLSNLLLLQSFKKPCKIACLLEKNQLVLKEIKRAQKVKENDF
                     "
     misc_feature    30592..32778
                     /locus_tag="HPSH112_00160"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    31117..31599
                     /locus_tag="HPSH112_00160"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    31192..31215
                     /locus_tag="HPSH112_00160"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(31195..31218,31405..31407,31519..31521)
                     /locus_tag="HPSH112_00160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    31393..31410
                     /locus_tag="HPSH112_00160"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    31570..31572
                     /locus_tag="HPSH112_00160"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    31927..32403
                     /locus_tag="HPSH112_00160"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    32029..32052
                     /locus_tag="HPSH112_00160"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(32032..32055,32236..32238,32362..32364)
                     /locus_tag="HPSH112_00160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    32224..32241
                     /locus_tag="HPSH112_00160"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    32494..32730
                     /locus_tag="HPSH112_00160"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            32798..33148
                     /locus_tag="HPSH112_00165"
                     /db_xref="GeneID:12772819"
     CDS             32798..33148
                     /locus_tag="HPSH112_00165"
                     /EC_number="4.1.1.11"
                     /note="COG0853 Aspartate 1-decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate alpha-decarboxylase"
                     /protein_id="YP_006226768.1"
                     /db_xref="GI:386753550"
                     /db_xref="GeneID:12772819"
                     /translation="MTFEMLYSKIHRATITDANLNYVGSITIDEDLAKFAKLREGMKV
                     EIVDVNNGERFSTYVILGKKRGEICVNGAAARKVAIGDVVIILAYASMNEDEINAHKP
                     CIVLVDEKNEILEK"
     misc_feature    32807..33130
                     /locus_tag="HPSH112_00165"
                     /note="Aspartate alpha-decarboxylase or L-aspartate
                     1-decarboxylase, a pyruvoyl group-dependent  decarboxylase
                     in beta-alanine production; Region: Asp_decarbox; cd06919"
                     /db_xref="CDD:132994"
     misc_feature    order(32807..32818,32822..32824,32828..32833,32855..32866,
                     32906..32908,32912..32914,32921..32926,32936..32938,
                     32942..32944,32951..32953,32957..32971,33014..33019,
                     33023..33028,33050..33052,33062..33070,33095..33097)
                     /locus_tag="HPSH112_00165"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132994"
     misc_feature    order(32822..32824,32828..32830,32867..32872,32969..32971)
                     /locus_tag="HPSH112_00165"
                     /note="active site"
                     /db_xref="CDD:132994"
     gene            33159..33452
                     /locus_tag="HPSH112_00170"
                     /db_xref="GeneID:12772820"
     CDS             33159..33452
                     /locus_tag="HPSH112_00170"
                     /note="COG0718 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226769.1"
                     /db_xref="GI:386753551"
                     /db_xref="GeneID:12772820"
                     /translation="MDFSQLGGLLDGMKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNG
                     VGELVDLQIDDSLLEDKEAMQIYLMSALNDGYKAVEENRKNLAFNMLGNFAKL"
     misc_feature    33159..33449
                     /locus_tag="HPSH112_00170"
                     /note="hypothetical protein; Provisional; Region:
                     PRK03762"
                     /db_xref="CDD:179646"
     gene            33452..34447
                     /locus_tag="HPSH112_00175"
                     /db_xref="GeneID:12772821"
     CDS             33452..34447
                     /locus_tag="HPSH112_00175"
                     /note="COG0265 Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226770.1"
                     /db_xref="GI:386753552"
                     /db_xref="GeneID:12772821"
                     /translation="MFHKALIILLVFLNGLGAYDFKHCQAFFKKASLQNGGVALKELP
                     KGVYLYYSKTYPKHAKVIKSDPFVGLYLLQSAPSEYFYTLRDLDKDALIRPMASIGDK
                     EAIEARLLSKQQGYDRYAQISQEIQKNGVISNICYQMLGLGVGGNGFIETKFIKHFLN
                     QKEPYYGDIGVRLEEDNKRLVVAQFDPFFPKNPFLKNDEILAINHQKIHSLAEFEWVV
                     SNLKYQSLVKVSIKRNHKIKEVTLKVNKRYGGFLLKDTFLERYGIALDKRFTITKIGS
                     HLPKGLDFLKLGDRILWVNRKNVASNPKALREALSVPKIELLVWREGFEFYIKVR"
     misc_feature    33950..34183
                     /locus_tag="HPSH112_00175"
                     /note="PDZ domain; Region: PDZ_2; pfam13180"
                     /db_xref="CDD:257548"
     misc_feature    order(33953..33964,33968..33970,34103..34105,34112..34117)
                     /locus_tag="HPSH112_00175"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238080"
     misc_feature    <34304..34441
                     /locus_tag="HPSH112_00175"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     gene            34453..35508
                     /locus_tag="HPSH112_00180"
                     /db_xref="GeneID:12772822"
     CDS             34453..35508
                     /locus_tag="HPSH112_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone oxidoreductase subunit"
                     /protein_id="YP_006226771.1"
                     /db_xref="GI:386753553"
                     /db_xref="GeneID:12772822"
                     /translation="MKNDAYEIILSWFITPLTAILGRFAEFFLYTLHAQLVFNSVVAL
                     AFMLFAYRSLKEQNFFSTSALTEALLFVGFFALFNYALKNPMRFYEFFQNAIFIAPNM
                     IAQSLSQSLSNFSNHALSLDFIFNHGFYALSFISDLSHNEMSVWLFLSILQGLFLSVL
                     FAIIILVYLEVHVWCSLGVLFLAFGFFKTWRSVVVACLKKCFALGFYKPFLLLVGFLN
                     VSVTKALIDAHVQEKQDLSLLLVVALFLCCVFIIGVPFFINALFRVQNSFKETYKLAT
                     NLSANLSQNALNSLQYITTPPASSSVSASMSGGVSKEKETHSPTFKVETTQLDVKIPN
                     FKQKKVKKDTINTKNEI"
     misc_feature    34453..35505
                     /locus_tag="HPSH112_00180"
                     /note="Type IV secretory pathway, TrbL components
                     [Intracellular trafficking and secretion]; Region: TrbL;
                     COG3846"
                     /db_xref="CDD:226365"
     gene            35634..36377
                     /locus_tag="HPSH112_00185"
                     /db_xref="GeneID:12772823"
     CDS             35634..36377
                     /locus_tag="HPSH112_00185"
                     /note="COG3736 Type IV secretory pathway, component VirB8"
                     /codon_start=1
                     /transl_table=11
                     /product="comB8 competence protein"
                     /protein_id="YP_006226772.1"
                     /db_xref="GI:386753554"
                     /db_xref="GeneID:12772823"
                     /translation="MKEKPFNSEQLAFLEELLSHQEKHLENKLSGFSVSDLDMQSVFR
                     LERNRLKIAYKLLGLMSFIALILAIVLISVLPLQKTEHHFVDFLNQDKHYAIIQRADK
                     SISSNEALARSLIGAYVLNRESINRIDDKSRYELVRLQSSSKVWQRFEDLIKTQNSIY
                     AQSHLEREVHIVNIAIYQQDNNPIASVSIAAKLMNENKLVYEKRYKIALSYLFDTPDF
                     DYASMPKNPTGFKITRYSITEIAPTNRGD"
     misc_feature    35658..36374
                     /locus_tag="HPSH112_00185"
                     /note="Type IV secretory pathway, component VirB8
                     [Intracellular trafficking and secretion]; Region: VirB8;
                     COG3736"
                     /db_xref="CDD:226259"
     gene            36377..37333
                     /locus_tag="HPSH112_00190"
                     /db_xref="GeneID:12772824"
     CDS             36377..37333
                     /locus_tag="HPSH112_00190"
                     /note="COG3504 Type IV secretory pathway, VirB9
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="comB9 competence protein"
                     /protein_id="YP_006226773.1"
                     /db_xref="GI:386753555"
                     /db_xref="GeneID:12772824"
                     /translation="MRKVLYALVGFLLAFSALKADDFLEEANETAPANLNHPMQDLNA
                     IQGSFFDKNRSKMSNTLNIDYFQGQTYKIRLRYAMATLLFFSKPISDFVLGDKVGFDA
                     KILESNDRILLIKPLQIGVDSNVSVIDNEGKIFSFYVFSTTFTSSKHPNLQVFIEDKN
                     YYSNAFMKPQNKENTLENTPTNNSKPLKEETKEEETITIGDSTNAMKIVKKDIQKGYR
                     ALKSSQRKWYCLGICSKKSKLSLMPEEIFNDKQFTYFKFDKKLALSKFPVIYKVVDGY
                     DNPVNTRIVGDYIIAEDVSAKWTLRLGKDYLCIRFIKKGKDE"
     misc_feature    37094..37306
                     /locus_tag="HPSH112_00190"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    order(37100..37117,37271..37273,37286..37306)
                     /locus_tag="HPSH112_00190"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            37326..38462
                     /locus_tag="HPSH112_00195"
                     /db_xref="GeneID:12772825"
     CDS             37326..38462
                     /locus_tag="HPSH112_00195"
                     /note="COG2948 Type IV secretory pathway, VirB10
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="comB10 competence protein"
                     /protein_id="YP_006226774.1"
                     /db_xref="GI:386753556"
                     /db_xref="GeneID:12772825"
                     /translation="MNKWLKGALVFVGGFATIITISLIYHQKPKAPLNNQPNLLNDDE
                     VKYPLQDYTFTQNPQPTNTESSKDATIKALQEQLKAALKALNSKEMNSSKEETFNSPP
                     IDLKTNTTPPKKDFSLKQLDLLASRITPFKQSPKNYEENLIFPMDNPKGIDGFTNLKE
                     KDIATNENKLLRTITADKMIPAFLITPISSQIAGKVIAQVESDIFAHMGKAVLIPKGS
                     KVIGYYSNNNKMGEYRLDIVWSRIITPHGINIMLTNAKGADIKGYNGLVGELIERNFQ
                     RYGVPLLLSTLTNGLLIGITSALNNRGNKEYATNFFGDYLLLQLMRQSGMGINQVVNQ
                     ILRDKSKIAPIVVIREGSRVFISPNTDIFFPIPKENEVIAEFLK"
     misc_feature    37326..38444
                     /locus_tag="HPSH112_00195"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    37839..38417
                     /locus_tag="HPSH112_00195"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            38534..39946
                     /locus_tag="HPSH112_00200"
                     /db_xref="GeneID:12772826"
     CDS             38534..39946
                     /locus_tag="HPSH112_00200"
                     /note="COG0836 Mannose-1-phosphate guanylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-1-phosphate guanyltransferase"
                     /protein_id="YP_006226775.1"
                     /db_xref="GI:386753557"
                     /db_xref="GeneID:12772826"
                     /translation="MKIKNILLSGGSGKRLWPLSRSLYPKQFLKLFGNESLFELSFKR
                     NASLVDETLIVCNEKHYFLALEEIESEIKNKSVGFLLESLSKNTANAIALSALMSERE
                     DSLIVTPSDHLIKDIQAYGNAIKKAIDLAQKGFLVTFGINIEKPNTEFGYIESPNGLD
                     VKHFIEKPSLEKAIEFQKSGGFYFNSGMFVFQAGVFLDELKKHAPTILKGCERAFESL
                     ERASFFEKKIARLSEKSMQDLEDVSVDIALMQQSHKIKMVGLNAKWSDLGNFNALFEE
                     VANDPKENVSLNQTPVFAKESQNNLVFSHKVSALLGVENLAIIDTKDALLIAHKDKAK
                     DLKALVSEVEANNQELLQTHTKVYRPWGSYEVLHESGCYKVKILEVKPNARLSLQKHF
                     HRSEHWVVISGMASVELDRQSFELQANESTYIPKNTLHRLANYGKIPLTIIEVQVGEY
                     VGEDDIVRVDDDFNRQNQGK"
     misc_feature    38540..39352
                     /locus_tag="HPSH112_00200"
                     /note="GDP-M1P_Guanylyltransferase catalyzes the formation
                     of GDP-Mannose; Region: GDP-M1P_Guanylyltransferase;
                     cd02509"
                     /db_xref="CDD:133003"
     misc_feature    38549..39928
                     /locus_tag="HPSH112_00200"
                     /note="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase; Region:
                     GMP_PMI; TIGR01479"
                     /db_xref="CDD:233431"
     misc_feature    order(38555..38557,38561..38563,38864..38866)
                     /locus_tag="HPSH112_00200"
                     /note="Substrate binding site; other site"
                     /db_xref="CDD:133003"
     misc_feature    39464..39916
                     /locus_tag="HPSH112_00200"
                     /note="Mannose-6-phosphate isomerase; Region:
                     MannoseP_isomer; pfam01050"
                     /db_xref="CDD:144587"
     gene            39961..41106
                     /locus_tag="HPSH112_00205"
                     /db_xref="GeneID:12772827"
     CDS             39961..41106
                     /locus_tag="HPSH112_00205"
                     /note="COG1089 GDP-D-mannose dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-D-mannose dehydratase"
                     /protein_id="YP_006226776.1"
                     /db_xref="GI:386753558"
                     /db_xref="GeneID:12772827"
                     /translation="MKEKIALITGVTGQDGSYLAEYLLNLGYEVHGLKRRSSSINTSR
                     IDHLYEDLHSEHKRRFFLHYGDMTDSSNLIHLIATTKPTEIYNLAAQSHVKVSFETPE
                     YTANADGIGTLRILEAMRILGLEKKTRFYQASTSELYGEVLETPQNENTPFNPRSPYA
                     VAKMYAFYITKNYREAYNLFAVNGILFNHESKVRGETFVTRKITRAASAIAYNLTDCL
                     YLGNLDAKRDWGHAKDYVKMMHLMLQAPIPQDYVIATGKTTSVRDFVKMSFEFIGISL
                     EFQNTGVKEIGLIKSVDEKRANALKLNLSHLKTGQIVVRIDERYFRPTEVDLLLGDPT
                     KAEKELGWVREYDLKELVKDMLEYDLKECQKNLYLQDGGYILRNFYE"
     misc_feature    39970..41049
                     /locus_tag="HPSH112_00205"
                     /note="GDP-mannose 4,6-dehydratase; Region: gmd;
                     TIGR01472"
                     /db_xref="CDD:233427"
     misc_feature    39976..41043
                     /locus_tag="HPSH112_00205"
                     /note="GDP-mannose 4,6 dehydratase, extended (e) SDRs;
                     Region: GDP_MD_SDR_e; cd05260"
                     /db_xref="CDD:187570"
     misc_feature    order(39988..40005,40063..40071,40153..40161,40222..40230,
                     40234..40236,40279..40281,40357..40365,40435..40437,
                     40447..40449,40516..40530)
                     /locus_tag="HPSH112_00205"
                     /note="NADP-binding site; other site"
                     /db_xref="CDD:187570"
     misc_feature    order(39994..39999,40063..40080,40087..40092,40150..40158,
                     40162..40176,40180..40188,40192..40194,40228..40239,
                     40246..40248,40252..40263,40273..40278,40288..40290,
                     40297..40302,40309..40311,40318..40323,40414..40425,
                     40429..40434,40441..40446,40450..40455,40462..40467,
                     40471..40479,40483..40491,40549..40554,40927..40932)
                     /locus_tag="HPSH112_00205"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(40234..40242,40363..40371,40435..40437,40522..40524,
                     40549..40557,40564..40566,40615..40626,40633..40635,
                     40639..40641,40741..40743,40918..40920,40924..40926,
                     40933..40938)
                     /locus_tag="HPSH112_00205"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(40252..40254,40261..40263,40273..40278,40285..40290,
                     40297..40302,40309..40311,40414..40425,40429..40434,
                     40441..40446,40450..40455,40462..40467,40471..40479,
                     40483..40491,40927..40932)
                     /locus_tag="HPSH112_00205"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(40282..40284,40363..40365,40435..40437,40447..40449)
                     /locus_tag="HPSH112_00205"
                     /note="active site"
                     /db_xref="CDD:187570"
     gene            41099..42031
                     /locus_tag="HPSH112_00210"
                     /db_xref="GeneID:12772828"
     CDS             41099..42031
                     /locus_tag="HPSH112_00210"
                     /note="COG0451 Nucleoside-diphosphate-sugar epimerases"
                     /codon_start=1
                     /transl_table=11
                     /product="nodulation protein (nolK)"
                     /protein_id="YP_006226777.1"
                     /db_xref="GI:386753559"
                     /db_xref="GeneID:12772828"
                     /translation="MNEIILITGAYGMVGQNTALYLKKNKPDVTLLTPKKSELYLLDK
                     DNVQAYLKEYKPTGIIHCAGRVGGIVANMNDLSAYMVENLLMGLYLFSSALDLGVKKA
                     INLASSCAYPKFAPNPLKESDLLNGSLEPTNEGYALAKLSVMKYCEYVSAEKGVFYKT
                     LVPCNLYGEFDKFEEKIAHMIPGLIARMHTAKLKNEKEFAMWGDGTARREYLNAKDLA
                     RFISLAYENIASIPSVMNVGSGVDYSIEEYYKMVAQVLDYKGAFVKDLSKPVGMQQKL
                     MDISKQKALKWELEIPLEQGIKEAYEYYLKLLEV"
     misc_feature    41111..42013
                     /locus_tag="HPSH112_00210"
                     /note="GDP-fucose synthetase, extended (e) SDRs; Region:
                     GDP_FS_SDR_e; cd05239"
                     /db_xref="CDD:187550"
     misc_feature    41114..42016
                     /locus_tag="HPSH112_00210"
                     /note="GDP-4-keto-6-deoxymannose-3,
                     5-epimerase-4-reductase; Region: PLN02725"
                     /db_xref="CDD:178326"
     misc_feature    order(41123..41125,41129..41140,41198..41200,41213..41224,
                     41282..41290,41294..41296,41354..41356,41411..41419,
                     41504..41506,41516..41518,41585..41590,41594..41596)
                     /locus_tag="HPSH112_00210"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187550"
     misc_feature    order(41345..41347,41417..41419,41504..41506,41516..41518)
                     /locus_tag="HPSH112_00210"
                     /note="active site"
                     /db_xref="CDD:187550"
     misc_feature    order(41417..41419,41504..41506,41591..41593,41648..41650,
                     41699..41701,41723..41725)
                     /locus_tag="HPSH112_00210"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187550"
     gene            complement(42111..42215)
                     /locus_tag="HPSH112_00215"
                     /db_xref="GeneID:12772829"
     CDS             complement(42111..42215)
                     /locus_tag="HPSH112_00215"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226778.1"
                     /db_xref="GI:386753560"
                     /db_xref="GeneID:12772829"
                     /translation="MLQKSGLDDKKALGIESEAHTKPLLMAQSLFKAK"
     gene            complement(42309..43307)
                     /locus_tag="HPSH112_00220"
                     /db_xref="GeneID:12772830"
     CDS             complement(42309..43307)
                     /locus_tag="HPSH112_00220"
                     /note="COG0309 Hydrogenase maturation factor"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein"
                     /protein_id="YP_006226779.1"
                     /db_xref="GI:386753561"
                     /db_xref="GeneID:12772830"
                     /translation="MDSVTLACGNGGKETNALIERVFMPYLKEFIVAFDEDAPKFEAS
                     GEYCVSTDSFVITPLIFNGGDIGKLCVCGSANDVSVQGGEPLYLNMGFILEEGLEIPL
                     LKQILQSIQKELLKANLKLLSLDTKVVPKGSVDKLFINTTCIGKTIKPGISSRHLKQD
                     QAIIISDTIANHGASLFAMRHEIKLKTNLESDCQLLYPLLKPLFLSDLKIHALRDATR
                     GGLASVLNEWANSSKVKIVIEEEKIPLKEETKGICEILGLEPYALANEGVFVLAINQK
                     DAPKALEILKSNEKAKNACVIGGVFENPYPSVVLKNAWGFERILEMPEGELLPRIC"
     misc_feature    complement(42408..43280)
                     /locus_tag="HPSH112_00220"
                     /note="HypE (Hydrogenase expression/formation protein).
                     HypE is involved in Ni-Fe hydrogenase biosynthesis.  HypE
                     dehydrates its own carbamoyl moiety in an ATP-dependent
                     process to yield the enzyme thiocyanate. The N-terminal
                     domain of HypE is related to the...; Region: HypE;
                     cd02197"
                     /db_xref="CDD:100033"
     misc_feature    complement(order(42654..42656,42663..42668,42888..42890,
                     42894..42896,42912..42914,42918..42920,42927..42929,
                     42933..42935,43041..43043,43077..43079,43149..43154,
                     43158..43175,43260..43268))
                     /locus_tag="HPSH112_00220"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100033"
     misc_feature    complement(42312..43265)
                     /locus_tag="HPSH112_00220"
                     /note="hydrogenase expression/formation protein HypE;
                     Region: hypE; TIGR02124"
                     /db_xref="CDD:233738"
     misc_feature    complement(order(42654..42659,43077..43079,43152..43154))
                     /locus_tag="HPSH112_00220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100033"
     gene            complement(43310..45562)
                     /locus_tag="HPSH112_00225"
                     /db_xref="GeneID:12772831"
     CDS             complement(43310..45562)
                     /locus_tag="HPSH112_00225"
                     /note="COG0068 Hydrogenase maturation factor"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HypF"
                     /protein_id="YP_006226780.1"
                     /db_xref="GI:386753562"
                     /db_xref="GeneID:12772831"
                     /translation="MNKITLFGVVQGVGMRPFIYTLAQKLELVGFVRNTQAALEIVLP
                     AHKTESFLNALKKGLPPLALVEKIIISPYDKTLKSNGFRILESKNHPLNLLSQIPKDL
                     GVCEDCLREIRDKNSPYFHYAFNSCAKCGARYSLLNALPYDRENSALKPFKLCEFCAF
                     VYKDANNKRFHIQGISCKKCGITLSYKRFKNDDALLECAKDIQKGKIIALKGLGGFAL
                     LCDARNFQTIERLRLLKNRPLKPFALMFKDLNTAKQHAFLSVLECESLNSTSAPILLA
                     RKKPDTQLAPNIAKNSPFYGVILPYTPLHALLLDLLDFPIIFTSANFSSLPLASDEAE
                     IDSLSFIFDFKLTHNRAIIHRIDDSIAQHVDNAIRPMRLARGFAPLYLTLPKRSNDSQ
                     KKILALGAEQKGHFSLLDSETSILLLSPFCGDLSVLENEKHFKETLNFFLKTYDFKPT
                     ILVCDKHQNYTTTQMACGFNTPLLQVQHHHAHFLASILDALLQDPHLNHPFIGIVWDG
                     SGAYENKIYGAECFVGDFERIEETARFEEFLLLGGEKAIKEPKRLVLEIALKHQLNKL
                     LKRVQKHFKEDELEIFQQMHDRGIQSIATNSIGRLFDIVAFSLDLVGTISFEAESGQV
                     LENLALQSDEIAFYPFKIKNSVVCLKDFYQAFEKDLGVLEPERIAKKFFNSLVEIITA
                     LIAPFKEHVVVCSGGVFCNQLLCEQLAKRLRGLKRQYFFHKHFPPNDSSIPIGQALMA
                     YFNPTIIKKG"
     misc_feature    complement(45308..45556)
                     /locus_tag="HPSH112_00225"
                     /note="Acylphosphatase; Region: Acylphosphatase;
                     pfam00708"
                     /db_xref="CDD:250072"
     misc_feature    complement(43340..45460)
                     /locus_tag="HPSH112_00225"
                     /note="[NiFe] hydrogenase maturation protein HypF; Region:
                     hypF; TIGR00143"
                     /db_xref="CDD:232844"
     misc_feature    complement(45152..45253)
                     /locus_tag="HPSH112_00225"
                     /note="HypF finger; Region: zf-HYPF; pfam07503"
                     /db_xref="CDD:254243"
     misc_feature    complement(45008..45103)
                     /locus_tag="HPSH112_00225"
                     /note="HypF finger; Region: zf-HYPF; pfam07503"
                     /db_xref="CDD:254243"
     misc_feature    complement(44447..44965)
                     /locus_tag="HPSH112_00225"
                     /note="Telomere recombination; Region: Sua5_yciO_yrdC;
                     pfam01300"
                     /db_xref="CDD:250518"
     gene            complement(45559..46551)
                     /locus_tag="HPSH112_00230"
                     /db_xref="GeneID:12772832"
     CDS             complement(45559..46551)
                     /locus_tag="HPSH112_00230"
                     /note="COG2957 Peptidylarginine deiminase and related
                     enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226781.1"
                     /db_xref="GI:386753563"
                     /db_xref="GeneID:12772832"
                     /translation="MKRMLAEFEKIQAILMAFPHEFGDWAYCIKEARESFLNIIQTIA
                     KHAKVLVCVHTNDTIGYETLKNLPGVEIARIDTNDTWARDFGAISIENHGVLECLDFG
                     FNGWGLKYPSNLDNRVNFKLKNLGFLKHPLKTMPYILEGGSIESDGAGSILTNTQCLL
                     EKNRNPHLNQHEIENMLKKELGAKQVLWYSYGYLKGDDTNSHTDTLARFLDKDTIVYS
                     ACEDKNDEHYTALKKMQEELKTFKKPDKTPYKLIPLEIPKAIFDENQQRLPATYVNFL
                     LCNDALIVPTYNDPKDALILETLKQHTPLEVIGVDCNTLIKQHGSLHCVTMQLY"
     misc_feature    complement(45562..46551)
                     /locus_tag="HPSH112_00230"
                     /note="Peptidylarginine deiminase and related enzymes
                     [Amino acid transport and metabolism]; Region: COG2957"
                     /db_xref="CDD:225505"
     gene            complement(46603..47301)
                     /locus_tag="HPSH112_00235"
                     /db_xref="GeneID:12772833"
     CDS             complement(46603..47301)
                     /locus_tag="HPSH112_00235"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine specific DNA methyltransferase"
                     /protein_id="YP_006226782.1"
                     /db_xref="GI:386753564"
                     /db_xref="GeneID:12772833"
                     /translation="MIQIHHANAFEIIKDFYQQNLKVDAIITDPPYNISVKNNFSTLK
                     SAKRQGIDFGEWDKNFRLLEWIKRYAPLVNPNGCMVIFCSYRFISYIVDFLEENGFVV
                     KDFIQWVKNNPMPRNINRRYVQDTEFALWAVKKKAKWVFNKPKNEKYLRPLILKSPVV
                     GGLERVKHPTQKSLALMEKIISIHTNPNDIVLDPFMGSGTTGLACKHLKRNFIGIESE
                     REYFQIAKKRLNLF"
     misc_feature    complement(46621..47235)
                     /locus_tag="HPSH112_00235"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(47298..48143)
                     /locus_tag="HPSH112_00240"
                     /db_xref="GeneID:12772834"
     CDS             complement(47298..48143)
                     /locus_tag="HPSH112_00240"
                     /note="COG0270 Site-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="cytosine specific DNA methyltransferase"
                     /protein_id="YP_006226783.1"
                     /db_xref="GI:386753565"
                     /db_xref="GeneID:12772834"
                     /translation="MIIGGPPCQGFSNKGKNLGLKDPRNFLFLEYIEIVKALKPEIFI
                     IENVKNLISCAKGYFLEEIKERLNALGYQLSYQILNAKDYGVPQNRERAFIVGASRFS
                     FDFNLLEPSQSVNVQDAISDLAYLCSNEGAFESDYLNPIQSSYQALMRKDSPKLYNHQ
                     ATNHSQAALEKLKLINKEQGKECLPKNLHGKQQFKSTWGRLNWNKVSPTIDTRFDTPS
                     NGTNSHPELHRSITPREAARIQSFSDNYIFYGNKTSVCKQIGNAVPPLLALALGKAIL
                     KSLRK"
     misc_feature    complement(47301..>48143)
                     /locus_tag="HPSH112_00240"
                     /note="Site-specific DNA methylase [DNA replication,
                     recombination, and repair]; Region: Dcm; COG0270"
                     /db_xref="CDD:223348"
     misc_feature    complement(order(47361..47363,47508..47513,47517..47522,
                     47541..47543,47547..47549,47868..47870,47874..47876,
                     47997..48002,48006..48008,48072..48074,48090..48092,
                     48099..48110,48117..48122,48129..48131))
                     /locus_tag="HPSH112_00240"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(47361..47363,47868..47870,47874..47876,
                     48000..48002,48006..48008,48108..48110,48120..48122,
                     48129..48131))
                     /locus_tag="HPSH112_00240"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            complement(48218..49717)
                     /locus_tag="HPSH112_00245"
                     /db_xref="GeneID:12772835"
     CDS             complement(48218..49717)
                     /locus_tag="HPSH112_00245"
                     /note="COG0591 Na+/proline symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="proline permease (putP)"
                     /protein_id="YP_006226784.1"
                     /db_xref="GI:386753566"
                     /db_xref="GeneID:12772835"
                     /translation="MGHVVLSTPIVTMFVAYSLLMLYIGFYFYRQNETTADYFLGDRS
                     MGPIISALSAGASDMSGWLLMGLPGALYVGGLINSHIAIGLSLGALINWVFVAKRLRI
                     YTSVIANSITISDYFETRFSDDKHILRLISAFVILIFFIFYISSGLVSGAKLFEATFG
                     IQYTYALSIGTLIIVSYTFLGGYKAVCWTDLIQGLLMMSALIVVPIVMIIHLGGIGEG
                     IKIIREIKPENLSFLQGSSMVAIISSLAWGLGYFGQPHILVRFMSIRSIKDVPKATTI
                     GISWMVISLIGACVMGLLGVAYAHKFDLSLEDPEKIFIVMSQLLFNPWITGILLSAIL
                     AAVMSTASSQLLVSSSTIAEDFYATIFNKDAPQKLVMVISRLSVLGVACIAFFISTDR
                     NASILSIVSYAWAGFGASFGSVILFSLFWSRMTRIGAIAGMLSGASTVILYDKFGKSF
                     LDIYEIVPGFIVASIAIVVFSLFSSVRAGTKEAFETMLKEIKEIESLKY"
     misc_feature    complement(48299..49687)
                     /locus_tag="HPSH112_00245"
                     /note="Na(+)/proline cotransporter PutP and related
                     proteins; solute binding domain; Region: SLC5sbd_PutP;
                     cd11475"
                     /db_xref="CDD:212045"
     misc_feature    complement(order(48698..48703,48710..48712,49541..49543,
                     49550..49552))
                     /locus_tag="HPSH112_00245"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212045"
     gene            complement(49744..53301)
                     /locus_tag="HPSH112_00250"
                     /db_xref="GeneID:12772836"
     CDS             complement(49744..53301)
                     /locus_tag="HPSH112_00250"
                     /note="COG0506 Proline dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Proline/pyrroline-5-carboxylate dehydrogenase"
                     /protein_id="YP_006226785.1"
                     /db_xref="GI:386753567"
                     /db_xref="GeneID:12772836"
                     /translation="MQKIIDDSLELAKKLQDSISNHLSEQEKAFHSKMQKLLNNPENK
                     VMLIELMDRSFRCLDNKARFEMIEHVLDKYKSREIFSSFEKLLLMGFLSFGKMLPDMS
                     VPFFVNKIRSDTKAMVLDQEESQLKERILKRKNEKIILNVNFIGEEVLGEEEASARFE
                     KYSQALKSNYIQYISIKITTIFSQINILDFEYSKKEIVKRLDALYALALEEEKKQGMP
                     KFINLDMEEFRDLELTVESFMESIAKFDLNAGIVLQAYIPDSYEYLKKLHAFSKERVL
                     KGLKPIKIRFVKGANMESEETIASVKDWALPTFSNKQDTDSNYNKMLDFVLEGDNYKY
                     IHIGAASHNIFEIAYVYTRIHALNDPVVLEHFSFEMLEGMSLQASQELKEMHKLILYA
                     PVCDEAHFNNAIAYLVRRLDENTSSDNFMKAFFNLKVGTSEWEDQEQRFLNSLKGIAT
                     LDNATHRTQDRNAKQSGHTTYPNHSFKNESDTDFILKANREWAKKVREKMHNAPILEL
                     YPEMDGRFEDPNLTPLEVFDKIHHKKIASVHLADREAILKALEVAKSDKNRFSQKSFT
                     EIHALMSQTAQIFRERRGDLIGISALEVGKTFAETDAEVSEAIDFLEFYPYSLRVLQE
                     QNKKTKFTPKGVGVVIAPWNFPVGISVGTIAAPLAAGNRVIYKPSSLSSVTGYKLCEC
                     FWDAGVPRDALIYLPSKGSDISEHLLKDESIKFAILTGGEDTAYKMLEANPTLALSAE
                     TGGKNATIVSKMADRDQAIKNVIHSAFSNSGQKCSATSLLVLEKEVYEDENFKKTLID
                     ATLSLSVGDPFDFKNKIGTLADKPNEKVIKAIDELKSYENYEIPVSFVNDNPYLMKPS
                     IKYGTKKGDFTHQTELFTPILSVMKAQDLDEAIDIVNSTGYGLTSALESLDEREWEYY
                     LKRIEAGNIYINKPTTGAIVLRQPFGGVKKSAVGFGRKVGIFNYITQFVNIHQEEEDE
                     NALKNPLSEALEGLTQKGYDEHTHELRRAIFMAKSYAYHYKHEFSQAKDYVKIRGEDN
                     LFSYTKVKSVGYRITEKDTLSDMLGVALACLISQIPLTLSIENERANKDLSFFLECLK
                     ALRANAPIVYESLQKFSEKLNAFNRVRYLKSDLDLLHEQASALGIVLATAKPCLNGRF
                     ELLYYHLERSVSISYHRYGNLGSRVLRQPTCHKSCCAEK"
     misc_feature    complement(52153..53301)
                     /locus_tag="HPSH112_00250"
                     /note="Proline dehydrogenase [Amino acid transport and
                     metabolism]; Region: PutA; COG0506"
                     /db_xref="CDD:223580"
     misc_feature    complement(52696..>53271)
                     /locus_tag="HPSH112_00250"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4399; cl19827"
                     /db_xref="CDD:268180"
     misc_feature    complement(52018..52947)
                     /locus_tag="HPSH112_00250"
                     /note="Proline dehydrogenase; Region: Pro_dh; pfam01619"
                     /db_xref="CDD:250750"
     misc_feature    complement(50362..51885)
                     /locus_tag="HPSH112_00250"
                     /note="Delta(1)-pyrroline-5-carboxylate dehydrogenase,
                     PutA; Region: ALDH_PutA-P5CDH; cd07125"
                     /db_xref="CDD:143443"
     misc_feature    complement(order(50485..50487,50530..50532,50977..50988,
                     51082..51084,51367..51372,51481..51483))
                     /locus_tag="HPSH112_00250"
                     /note="Glutamate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143443"
     misc_feature    complement(order(51130..51132,51139..51141,51148..51150,
                     51202..51204,51292..51297,51301..51303,51379..51384))
                     /locus_tag="HPSH112_00250"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:143443"
     misc_feature    complement(order(50980..50982,50989..50991,51082..51084,
                     51370..51372))
                     /locus_tag="HPSH112_00250"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143443"
     gene            53629..53838
                     /locus_tag="HPSH112_00255"
                     /db_xref="GeneID:12772837"
     CDS             53629..53838
                     /locus_tag="HPSH112_00255"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226786.1"
                     /db_xref="GI:386753568"
                     /db_xref="GeneID:12772837"
                     /translation="MKTIKNGIMIGTLGALLLSGCSSFDAQRFACLPKDHSLKDASTK
                     KEVQYTPKGFFDPYSSNLNHWDSTF"
     misc_feature    53632..>53763
                     /locus_tag="HPSH112_00255"
                     /note="hypothetical protein; Provisional; Region:
                     PRK04081"
                     /db_xref="CDD:235218"
     gene            complement(54023..54163)
                     /locus_tag="HPSH112_00260"
                     /db_xref="GeneID:12772838"
     CDS             complement(54023..54163)
                     /locus_tag="HPSH112_00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226787.1"
                     /db_xref="GI:386753569"
                     /db_xref="GeneID:12772838"
                     /translation="MIRGSRPSNLSSNFLKRSVRSLRDFKSSSLFKDSSLLGRGGGSS
                     RA"
     gene            54378..55205
                     /locus_tag="HPSH112_00265"
                     /db_xref="GeneID:12772839"
     CDS             54378..55205
                     /locus_tag="HPSH112_00265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226788.1"
                     /db_xref="GI:386753570"
                     /db_xref="GeneID:12772839"
                     /translation="MNALKNSQQVLENEKAELKTEKDNLTKANAELKTEKERLTKEKT
                     ELTEKNKELDDQVGLLKGQIKSLEQSQQVLKNENTDLDNKITDLSKENQNLTKEKTEL
                     TEKNQKLTTEKDNLTTDLSNAKIQAIQANQEKDKLEQKHAPYKKLEKLYEVFLEVKGC
                     LNFNFVEKTHSAMDLIASVLSDSKYYLESLYNKASQELSDRKSDKGEKLAELFDLLFE
                     YVKDNKFERLKEPSAYDPTCKKLYPEQNTSGKMQRVVLIGYTYDKKTTHYTIVDMGS"
     misc_feature    54387..>54725
                     /locus_tag="HPSH112_00265"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     gene            55207..56031
                     /locus_tag="HPSH112_00270"
                     /db_xref="GeneID:12772840"
     CDS             55207..56031
                     /locus_tag="HPSH112_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226789.1"
                     /db_xref="GI:386753571"
                     /db_xref="GeneID:12772840"
                     /translation="MGTFIEKCFGFYQVREELEARISELEDENENLINENTRLLASKE
                     QLTKENTELLREKDNLIKENTELKTDKDNLNNQLNASQMQVNELKNAHQVLEKEKDEL
                     LKDKDNLTKEKAELTEKNQKLTTEKDNLTKANAELKKENDKLNHQVIALTKEQDSLKY
                     EKELCANLEKDNQQLTDKLKKLESAQKNLENSKNQLLQAREKIAKENTELEREMARLK
                     SLEATDKSELDLQNRRFKSAIEDLKRQNRKLEEENIALKERVDGLKEQLSKQPKPQ"
     misc_feature    <55252..56013
                     /locus_tag="HPSH112_00270"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     gene            58477..59040
                     /locus_tag="HPSH112_00285"
                     /db_xref="GeneID:12772841"
     CDS             58477..59040
                     /locus_tag="HPSH112_00285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226790.1"
                     /db_xref="GI:386753572"
                     /db_xref="GeneID:12772841"
                     /translation="MITKNAYAFVVIEEKVMAFKQDKGLIPIFEGFVPLKEGFLKHFK
                     ERCNLEFLESLDLLFLYDKPSAHEIFSLCKELKNSIWDRKLVVALVEALEGFKDWNLS
                     LKIEDKRSNSLGNGAKKLLTNADLESSHQKIVIDSMKTYHQSQQEKYKRERGQVKETP
                     AQTPPSYGGGSIRISGDKKPDSNEENF"
     gene            59056..59316
                     /locus_tag="HPSH112_00290"
                     /db_xref="GeneID:12772842"
     CDS             59056..59316
                     /locus_tag="HPSH112_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226791.1"
                     /db_xref="GI:386753573"
                     /db_xref="GeneID:12772842"
                     /translation="MSKVQMDTEEVREFVNHLERFKELLNDEVNGLSSHFNNLDSWQD
                     ARRDKFSEVLDNLKSTFNEFDEAAQEQIAWLKERIRVLEEDY"
     misc_feature    59065..59286
                     /locus_tag="HPSH112_00290"
                     /note="Proteins of 100 residues with WXG; Region: WXG100;
                     cl02005"
                     /db_xref="CDD:261146"
     gene            61090..61515
                     /locus_tag="HPSH112_00305"
                     /db_xref="GeneID:12772843"
     CDS             61090..61515
                     /locus_tag="HPSH112_00305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226792.1"
                     /db_xref="GI:386753574"
                     /db_xref="GeneID:12772843"
                     /translation="METIPTNSELNWEFVEPLNDNALSGLEDQLKMGLSDAFKDFVKR
                     SNYGFSQWRSFMVGNKSYTFKHVLNFNLEGKGLFIDFMKSLKEWLKPEEIIFANDGYG
                     GYYLLNTASGVALFLDTDDGSKHALLHLKMFLKKLESRG"
     misc_feature    61138..61491
                     /locus_tag="HPSH112_00305"
                     /note="SMI1 / KNR4 family; Region: SMI1_KNR4; smart00860"
                     /db_xref="CDD:214864"
     gene            61517..61867
                     /locus_tag="HPSH112_00310"
                     /db_xref="GeneID:12772844"
     CDS             61517..61867
                     /locus_tag="HPSH112_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226793.1"
                     /db_xref="GI:386753575"
                     /db_xref="GeneID:12772844"
                     /translation="MFSHKVYLEGCTLELRKICDDFAENAMQDDLGQKLRDEVLEDML
                     KIAHDLENLEQDTQYQRRRIDEQIEEAKSLMKKIDMNFHSQSEIDKLMREAKEHEKEA
                     NRRYDEYLKSKDKE"
     misc_feature    <61637..>61843
                     /locus_tag="HPSH112_00310"
                     /note="Domain of unknown function (DUF4337); Region:
                     DUF4337; pfam14235"
                     /db_xref="CDD:258426"
     misc_feature    61864..64290
                     /note="potential frameshift: common BLAST hit:
                     gi|384888720|ref|YP_005763022.1| ATP-binding protein"
     gene            61864..62844
                     /locus_tag="HPSH112_00315"
                     /db_xref="GeneID:12772845"
     CDS             61864..62844
                     /locus_tag="HPSH112_00315"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_006226794.1"
                     /db_xref="GI:386753576"
                     /db_xref="GeneID:12772845"
                     /translation="MIGINTLLQKLDDALDKVVHQKEPESFLKPIVSEIEEYQKNIRQ
                     IQAQFTDAPQFNEMKAYPQFLSCGLLEIKGKNGANMDFCLPKVYPFPPKSLYIEHEKD
                     GQFLREMLMRLLSSTPLVQLEVILVDALSLGGIFNLARRLLDKGNDFIYQQRILTESN
                     ETEEALKHLYEYLKVNLQQKLAGYKDFAHYNEDKEDKLPLKALFLSGVDALSSDALYY
                     LEKIMRFGSKNGVLSFVNLESESNKSAEDLKRYAEFFKDRTSFERLKYLNVEVINDHG
                     IQSRHMKDFATKIKAYYEQKKAVKRELKDLQREQEFWTKSSQSKVSVPVG"
     misc_feature    62551..>62841
                     /locus_tag="HPSH112_00315"
                     /note="replicative DNA helicase; Provisional; Region:
                     PRK07004"
                     /db_xref="CDD:235907"
     gene            62863..64290
                     /locus_tag="HPSH112_00320"
                     /db_xref="GeneID:12772846"
     CDS             62863..64290
                     /locus_tag="HPSH112_00320"
                     /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
                     related proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_006226795.1"
                     /db_xref="GI:386753577"
                     /db_xref="GeneID:12772846"
                     /translation="MCFEIGEAQNHTLICGRSGSGKSNFLHGLIQNLAFYYAPNEVQL
                     FLLDYKEGVEFNAYTNPTILEHARLVGVASSVGFGVSFLSWLDKEMKKRGERFKQFNV
                     KDLSAYREHGEMPRLIVVIDGFQVLFSDSTTKEKERVEAYLTTILKKGRSYGVHLILG
                     TQTMRSSGITSLMSQIANRIALPMDAEDSDSILSDDVACELVRPEGIFNNNGGHKKYH
                     TKMSIPKAPDDFTPFIKKIHKEFNQRNLAPIEHRIYNGETPLKMPDTLKANEMRLHLG
                     KKVDYEQKDLIVEFENSESHLLVVSQDLSSRIALMKLFAQNFKTANKELLFYNAEKRL
                     ARELDELEKHHITPMQSPLMSVLDTAMNPNSVLMIDNLNEAKELHDKIGVEKLRSFLE
                     KATDNEQYCIIFVHDLKQINVNHNLDKLKELLNNHFKQRLAFVCNGENLNAIRKDLPL
                     LTNKLNAHLINTSKDSHAEFRPFSL"
     misc_feature    <62866..64284
                     /locus_tag="HPSH112_00320"
                     /note="DNA segregation ATPase FtsK/SpoIIIE and related
                     proteins [Cell division and chromosome partitioning];
                     Region: FtsK; COG1674"
                     /db_xref="CDD:224588"
     misc_feature    62893..63348
                     /locus_tag="HPSH112_00320"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     gene            complement(64360..65157)
                     /locus_tag="HPSH112_00325"
                     /db_xref="GeneID:12772847"
     CDS             complement(64360..65157)
                     /locus_tag="HPSH112_00325"
                     /note="COG0829 Urease accessory protein UreH"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreH"
                     /protein_id="YP_006226796.1"
                     /db_xref="GI:386753578"
                     /db_xref="GeneID:12772847"
                     /translation="MNTYAQESKLRLKTKIGADGRCVIEDNFFTPPFKLMAPFYPKDD
                     LAEIMLLAVSPGMMRGDAQDMQLNIGPNCKLRITSQSFEKIHNTEDGFASREMHIVVG
                     ENAFLDFAPFPLIPFENAHFKGNTTISLHSSSQLLYSEIIVAGRVARNELFQFNRLHT
                     KISILQDEKPIYYDNTILDPKTTNLNNMCMFDGYTHYLNLVLVNCPIELSGVRECIGE
                     NEGVDGAVSEIASSHLCVKALAKGSEPLLHLREKIARSITQTITQKI"
     misc_feature    complement(64381..65157)
                     /locus_tag="HPSH112_00325"
                     /note="Urease accessory protein UreH [Posttranslational
                     modification, protein turnover, chaperones]; Region: UreH;
                     COG0829"
                     /db_xref="CDD:223899"
     gene            complement(65157..65756)
                     /locus_tag="HPSH112_00330"
                     /db_xref="GeneID:12772848"
     CDS             complement(65157..65756)
                     /locus_tag="HPSH112_00330"
                     /note="COG0378 Ni2+-binding GTPase involved in regulation
                     of expression and maturation of urease and hydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein"
                     /protein_id="YP_006226797.1"
                     /db_xref="GI:386753579"
                     /db_xref="GeneID:12772848"
                     /translation="MVKIGVCGPVGSGKTALIEALTRHMSKDYDMAVITNDIYTKEDA
                     EFMCKNSVMPRDRIIGVETGGCPHTAIREDASMNLEAVEEMHGRFPNLELLLIESGGD
                     NLSATFNPELADFTIFVIDVAEGDKIPRKGGPGITRSDLLVINKIDLAPYVGADLKVM
                     ERDSKKMRGEKPFIFTNIRAKEGLDDVIAWIKRNALLED"
     misc_feature    complement(<65631..65753)
                     /locus_tag="HPSH112_00330"
                     /note="GTPase SAR1 and related small G proteins [General
                     function prediction only]; Region: COG1100"
                     /db_xref="CDD:224025"
     misc_feature    complement(65184..65744)
                     /locus_tag="HPSH112_00330"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cd00882"
                     /db_xref="CDD:206648"
     misc_feature    complement(65712..65735)
                     /locus_tag="HPSH112_00330"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(65220..65228,65313..65315,65319..65324,
                     65562..65564,65709..65729))
                     /locus_tag="HPSH112_00330"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    complement(65634..65636)
                     /locus_tag="HPSH112_00330"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(65616..65624)
                     /locus_tag="HPSH112_00330"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(65562..65573)
                     /locus_tag="HPSH112_00330"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(order(65475..65480,65562..65567))
                     /locus_tag="HPSH112_00330"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(65313..65324)
                     /locus_tag="HPSH112_00330"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    complement(65220..65228)
                     /locus_tag="HPSH112_00330"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     gene            complement(65785..66528)
                     /locus_tag="HPSH112_00335"
                     /db_xref="GeneID:12772849"
     CDS             complement(65785..66528)
                     /locus_tag="HPSH112_00335"
                     /note="COG0830 Urease accessory protein UreF"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreF"
                     /protein_id="YP_006226798.1"
                     /db_xref="GI:386753580"
                     /db_xref="GeneID:12772849"
                     /translation="MKSTKKSVGMPPKTPKDNNAHVDNEFLILQVNDAVFPIGSYTHS
                     FGLETYIQQKKVTNKESALEYLKANLSSQFLYTEMLSLKLTYESTLQQDLKKILGIEE
                     IITLSTSPMELRLANQKLGNRFIKTLQAMNELDMGEFFNAYAQKTKDPTHATSYGVFA
                     ASLGIELKKALRHYLYAQTSNMVINCVKSVPLSQNDGQKILLSLQSPFNQLIEKTLEL
                     DESHLCVASVQNDIKAMQHESLYSRLYMS"
     misc_feature    complement(65788..66474)
                     /locus_tag="HPSH112_00335"
                     /note="Urease accessory protein UreF [Posttranslational
                     modification, protein turnover, chaperones]; Region: UreF;
                     COG0830"
                     /db_xref="CDD:223900"
     gene            complement(66557..67069)
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /db_xref="GeneID:12772850"
     CDS             complement(66557..67069)
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /note="COG2371 Urease accessory protein UreE"
                     /codon_start=1
                     /transl_table=11
                     /product="urease accessory protein UreE"
                     /protein_id="YP_006226799.1"
                     /db_xref="GI:386753581"
                     /db_xref="GeneID:12772850"
                     /translation="MIIERLIGNLRDLNPLDFSVDYVDLEWFETRKKIARFKTRQGKD
                     MAIRLKDAPKLGLSQGDILFKEEKEIIAVNILDSEVIHIQAKSVAEVAKICYEIGNRH
                     AALYYGESQFEFKTPFEKPTLALLEKLGVQNHVLSSKLDSKDRLTVSMPHSEPNFKVS
                     LASDFKVVMK"
     misc_feature    complement(66614..67069)
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /note="urease accessory protein UreE; Provisional; Region:
                     ureE; PRK13261"
                     /db_xref="CDD:237322"
     misc_feature    complement(66650..67069)
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /note="UreE urease accessory protein. UreE is a
                     metallochaperone assisting the insertion of a Ni2+ ion in
                     the active site of urease, an important step in the in
                     vivo assembly of urease, an enzyme that hydrolyses urea
                     into ammonia and carbamic acid. The...; Region: UreE;
                     cd00571"
                     /db_xref="CDD:238320"
     misc_feature    complement(order(66743..66745,66761..66766,66770..66775,
                     66779..66787))
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238320"
     misc_feature    complement(order(66713..66715,66764..66766))
                     /gene="ureE"
                     /locus_tag="HPSH112_00340"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238320"
     gene            complement(67071..67658)
                     /locus_tag="HPSH112_00345"
                     /db_xref="GeneID:12772851"
     CDS             complement(67071..67658)
                     /locus_tag="HPSH112_00345"
                     /note="COG1138 Cytochrome c biogenesis factor"
                     /codon_start=1
                     /transl_table=11
                     /product="urea transporter"
                     /protein_id="YP_006226800.1"
                     /db_xref="GI:386753582"
                     /db_xref="GeneID:12772851"
                     /translation="MLGLVLLYVGIVLISNGICGLTKVDPKSTAVMNFFVGGLSIVCN
                     VVVITYSALNPTAPVEGAEDIAQVSHHLTSFYGPATGLLFGFTYLYAAINHTFGLDWR
                     PYSWYSLFVAINTIPAAILSHYSDMLDDHKVLGITEGDWWAIIWLAWGVLWLTAFIEN
                     ILKIPLGKFTPWLAIIEGILTAWIPAWLLFIQHWA"
     misc_feature    complement(67077..67652)
                     /locus_tag="HPSH112_00345"
                     /note="UreI/AmiS family, proton-gated urea channel and
                     putative amide transporters; Region: UreI_AmiS_like;
                     cd13404"
                     /db_xref="CDD:259831"
     misc_feature    complement(order(67089..67091,67098..67100,67308..67310,
                     67317..67322,67329..67331,67338..67343,67350..67355,
                     67359..67361,67389..67394,67401..67403,67410..67415,
                     67422..67427,67431..67436,67515..67517,67521..67523,
                     67554..67556,67563..67568,67575..67580,67584..67589,
                     67602..67607,67626..67628,67635..67640,67647..67649))
                     /locus_tag="HPSH112_00345"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259831"
     misc_feature    complement(order(67200..67205,67212..67214,67395..67400,
                     67407..67409,67620..67622,67641..67643))
                     /locus_tag="HPSH112_00345"
                     /note="transport channel [chemical binding]; other site"
                     /db_xref="CDD:259831"
     misc_feature    complement(order(67212..67214,67407..67409,67641..67643))
                     /locus_tag="HPSH112_00345"
                     /note="constriction site 1 [chemical binding]; other site"
                     /db_xref="CDD:259831"
     misc_feature    complement(order(67200..67205,67395..67400,67620..67622))
                     /locus_tag="HPSH112_00345"
                     /note="constriction site 2 [chemical binding]; other site"
                     /db_xref="CDD:259831"
     gene            complement(67851..69560)
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /db_xref="GeneID:12772852"
     CDS             complement(67851..69560)
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /EC_number="3.5.1.5"
                     /note="COG0804 Urea amidohydrolase (urease) alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit beta"
                     /protein_id="YP_006226801.1"
                     /db_xref="GI:386753583"
                     /db_xref="GeneID:12772852"
                     /translation="MKKISRKEYASMYGPTTGDKVRLGDTDLIAEVEHDYTIYGEELK
                     FGGGKTLREGMSQSNNPSKEELDLIITNALIVDYTGIYKADIGIKDGKIAGIGKGGNK
                     DMQDGVKNNLSVGPATEALAGEGLIVTAGGIDTHIHFISPQQIPTAFASGVTTMIGGG
                     TGPADGTNATTITPGRRNLKFILRAAEEYSMNLGFLAKGNASNDASLADQIEAGAIGL
                     KIHEDWGTTPSAINHALDVADKYDVQVAIHTDTLNEAGCVEDTMAAIAGRTMHTYHTE
                     GAGGGHAPDIIKVAGEHNILPASTNPTIPFTVNTEAEHMDMLMVCHHLDKSIKEDVQF
                     ADSRIRPQTIAAEDTLHDMGIFSITSSDSQAMGRVGEVITRTWQTADKNKKEFGRLKE
                     EKGDNDNFRIKRYLSKYTINPAIAHGISEYVGSVEVGKVADLVLWSPAFFGVKPNMII
                     KGGFIALSQMGDANASIPTPQPVYYREMFAHHGKAKYDANITFVSQAAYDKGIKEELG
                     LERQVLPVKNCRNITKKDMQFNDTTAHIEVNSETYHVFVDGKEVTSKPANKVSLAQLF
                     SIF"
     misc_feature    complement(67854..69557)
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /note="urease subunit beta; Provisional; Region: ureB;
                     PRK13985"
                     /db_xref="CDD:184438"
     misc_feature    complement(67857..69554)
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /note="Urease alpha-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, fungi and plants. Their primary
                     role is to allow the use of...; Region: Urease_alpha;
                     cd00375"
                     /db_xref="CDD:238221"
     misc_feature    complement(order(67857..67871,68133..68135,68148..68156,
                     68160..68177,68241..68243,69186..69188,69243..69257,
                     69396..69404,69411..69413,69429..69431,69435..69446,
                     69489..69491,69495..69497,69501..69506,69522..69524,
                     69543..69545,69549..69554))
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /note="subunit interactions [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238221"
     misc_feature    complement(order(68463..68468,68475..68477,68595..68597,
                     68724..68726,68739..68741,68817..68819,68898..68900,
                     68904..68906,69054..69056,69147..69149,69153..69155))
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /note="active site"
                     /db_xref="CDD:238221"
     misc_feature    complement(68562..68612)
                     /gene="ureB"
                     /locus_tag="HPSH112_00350"
                     /note="flap region; other site"
                     /db_xref="CDD:238221"
     gene            complement(69564..70280)
                     /locus_tag="HPSH112_00355"
                     /db_xref="GeneID:12772853"
     CDS             complement(69564..70280)
                     /locus_tag="HPSH112_00355"
                     /EC_number="3.5.1.5"
                     /note="COG0831 Urea amidohydrolase (urease) gamma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="urease subunit alpha"
                     /protein_id="YP_006226802.1"
                     /db_xref="GI:386753584"
                     /db_xref="GeneID:12772853"
                     /translation="MKLTPKELDKLMLHYAGELARKRKEKGIKLNYVEAVALISAHIM
                     EEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEA
                     SGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREK
                     TFGKRLDIASGTAVRFEPGEEKSVELIDIGGSRRIFGFNALVDRQADNESKKIALHRA
                     KERGFHGAKSDDNYVKTIKE"
     misc_feature    complement(69606..70280)
                     /locus_tag="HPSH112_00355"
                     /note="urease subunit alpha; Provisional; Region:
                     PRK13986"
                     /db_xref="CDD:184439"
     misc_feature    complement(69981..70271)
                     /locus_tag="HPSH112_00355"
                     /note="Urease gamma-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, archaea, fungi and plants. Their
                     primary role is to allow the use...; Region: Urease_gamma;
                     cd00390"
                     /db_xref="CDD:238229"
     misc_feature    complement(order(70029..70031,70035..70037,70050..70052,
                     70065..70067,70161..70163,70182..70190,70212..70214,
                     70224..70226,70251..70256))
                     /locus_tag="HPSH112_00355"
                     /note="alpha-gamma subunit interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238229"
     misc_feature    complement(70065..70067)
                     /locus_tag="HPSH112_00355"
                     /note="beta-gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238229"
     misc_feature    complement(69672..69965)
                     /locus_tag="HPSH112_00355"
                     /note="Urease beta-subunit; Urease is a nickel-dependent
                     metalloenzyme that catalyzes the hydrolysis of urea to
                     form ammonia and carbon dioxide. Nickel-dependent ureases
                     are found in bacteria, archaea, fungi and plants. Their
                     primary role is to allow the use of...; Region:
                     Urease_beta; cd00407"
                     /db_xref="CDD:238238"
     misc_feature    complement(69963..69965)
                     /locus_tag="HPSH112_00355"
                     /note="gamma-beta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238238"
     misc_feature    complement(order(69687..69695,69699..69713,69768..69776,
                     69780..69782,69786..69788,69849..69851,69918..69935,
                     69939..69962))
                     /locus_tag="HPSH112_00355"
                     /note="alpha-beta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238238"
     gene            complement(70550..70625)
                     /locus_tag="HPSH112_t08192"
                     /db_xref="GeneID:12772854"
     tRNA            complement(70550..70625)
                     /locus_tag="HPSH112_t08192"
                     /product="tRNA-Val"
                     /db_xref="GeneID:12772854"
     gene            complement(70646..71119)
                     /gene="lspA"
                     /locus_tag="HPSH112_00360"
                     /db_xref="GeneID:12772855"
     CDS             complement(70646..71119)
                     /gene="lspA"
                     /locus_tag="HPSH112_00360"
                     /EC_number="3.4.23.36"
                     /note="COG0597 Lipoprotein signal peptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein signal peptidase"
                     /protein_id="YP_006226803.1"
                     /db_xref="GI:386753585"
                     /db_xref="GeneID:12772855"
                     /translation="MLKTTQKSLLVFIGVFFLIFGADQAIKYAILEGFRYESLIIDIV
                     LVFNKGVAFSLLSFLEGGLKYLQILLILGLFIFLMRQKELFKNHAIEFGMVFGAGVSN
                     VLDRFVHGGVVDYVYYHYGFDFAIFNFADVMIDVGVGVLLLRQFFFKQKQNKIKA"
     misc_feature    complement(70667..71116)
                     /gene="lspA"
                     /locus_tag="HPSH112_00360"
                     /note="lipoprotein signal peptidase; Reviewed; Region:
                     lspA; PRK00376"
                     /db_xref="CDD:234739"
     gene            complement(71113..72450)
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /db_xref="GeneID:12772856"
     CDS             complement(71113..72450)
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /EC_number="5.4.2.10"
                     /note="COG1109 Phosphomannomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucosamine mutase"
                     /protein_id="YP_006226804.1"
                     /db_xref="GI:386753586"
                     /db_xref="GeneID:12772856"
                     /translation="MKIFGTDGVRGKAGVKLTPMFVMRLGIAAGLYFKKHSKTNKILI
                     GKDTRKSGYMVENALVSALTSIGYNVIQIGPMPTPAIAFLTEDMRCDAGIMISASHNP
                     FEDNGIKFFNSYGYKLKEEEEKAIEEIFHDEELLHSSYKVGESVGSAKRIDDVIGRYI
                     VHLKHSFPKHLNLQSLRIVLDAANGAAYKVAPVVFSELGADVLVINDEPNGCNINEQC
                     GALHPNQLSQEVKKYRADLGFAFDGDADRLVVVDNLGNIVHGDKLLGVLGVYQKSKNA
                     LSSQAIVATSMSNLALKEYLKSQDLELKHCAIGDKFVSECMQLNKANFGGEQSGHIIF
                     SDYAKTGDGLVCALQVSALVLESKQVSSVALNPFELYPQSLINLNIQKKPPLESLKGY
                     SALLKELDKLEIRHLIRYSGTENKLRILLEAKDEKLLESKMQELKEFFEGHLC"
     misc_feature    complement(71116..72450)
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /note="phosphoglucosamine mutase; Provisional; Region:
                     glmM; PRK14324"
                     /db_xref="CDD:184621"
     misc_feature    complement(71143..72444)
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /note="GlmM is a bacterial phosphoglucosamine mutase
                     (PNGM) that belongs to the alpha-D-phosphohexomutase
                     superfamily. It is required for the interconversion of
                     glucosamine-6-phosphate and glucosamine-1-phosphate in the
                     biosynthetic pathway of...; Region: GlmM; cd05802"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(71197..71199,71212..71220,71224..71226,
                     71458..71460,71464..71466,71470..71472,71521..71529,
                     71590..71592,71710..71715,71719..71721,71725..71727,
                     72124..72126,72148..72156,72421..72423,72430..72432,
                     72436..72438))
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /note="active site"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(71197..71199,71212..71220,71224..71226,
                     71458..71460,71464..71466,71470..71472,71521..71523,
                     71527..71529,71590..71592,71710..71712,72154..72156,
                     72430..72432))
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100095"
     misc_feature    complement(order(71713..71715,71719..71721,71725..71727,
                     72154..72156))
                     /gene="glmM"
                     /locus_tag="HPSH112_00365"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100095"
     gene            72540..72809
                     /gene="rpsT"
                     /locus_tag="HPSH112_00370"
                     /db_xref="GeneID:12772857"
     CDS             72540..72809
                     /gene="rpsT"
                     /locus_tag="HPSH112_00370"
                     /note="COG0268 Ribosomal protein S20"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="YP_006226805.1"
                     /db_xref="GI:386753587"
                     /db_xref="GeneID:12772857"
                     /translation="MANHKSAEKRIRQTIKRTERNRFYKTKVKNIIKAVREAVAVNDV
                     TKAQERLKIANKELHKFVSKGILKKNTASRKVSRLNASVKKIALA"
     misc_feature    72540..72800
                     /gene="rpsT"
                     /locus_tag="HPSH112_00370"
                     /note="30S ribosomal protein S20; Reviewed; Region: rpsT;
                     PRK00239"
                     /db_xref="CDD:178943"
     gene            72924..73982
                     /gene="prfA"
                     /locus_tag="HPSH112_00375"
                     /db_xref="GeneID:12772858"
     CDS             72924..73982
                     /gene="prfA"
                     /locus_tag="HPSH112_00375"
                     /note="COG0216 Protein chain release factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="YP_006226806.1"
                     /db_xref="GI:386753588"
                     /db_xref="GeneID:12772858"
                     /translation="MSILAEKLSSILKRYDELTALLSSAEVVSDIKKLTELSKEQSSI
                     EEISVASKEYLSVLENIKENKELLEDKELSELAKEELKILEIKKSDLETAIKQLLIPK
                     DPNDDKNIYLELRAGTGGDEAGIFVGDLFKAYCRYADLKKWKVEIVSSSENSVGGYKE
                     IIALIKGKGVYSRLKFEAGTHRVQRVPETESQGRIHTSAITVAIMPEVDDVEVSINPS
                     DLKIEVFRAGGHGGQCVNTTDSAVRITHLPTNISVSMQDEKSQHKNKDKALKILKARL
                     YEKQIEEQQLANAKDRKEQVGSGDRSERIRTYNYPQNRLSEHRINLTLYSLEEIMLSG
                     NLDEVINPLIAHAQSQFE"
     misc_feature    72924..73973
                     /gene="prfA"
                     /locus_tag="HPSH112_00375"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     misc_feature    73110..73454
                     /gene="prfA"
                     /locus_tag="HPSH112_00375"
                     /note="This domain is found in peptide chain release
                     factors; Region: PCRF; smart00937"
                     /db_xref="CDD:214923"
     misc_feature    73539..73880
                     /gene="prfA"
                     /locus_tag="HPSH112_00375"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            74369..75112
                     /locus_tag="HPSH112_00380"
                     /db_xref="GeneID:12772859"
     CDS             74369..75112
                     /locus_tag="HPSH112_00380"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Outer membrane protein"
                     /protein_id="YP_006226807.1"
                     /db_xref="GI:386753589"
                     /db_xref="GeneID:12772859"
                     /translation="MKKVFLGMALAISVSMAEKSGAFLGGGFQYSNLENQNTTRTPGA
                     NNNTPIDTSMFGNNQRVTNTNNYGQMYGVDAMAGHKWFFGKTKRFGFRTYGYYSYNHA
                     NLSFVGSKLGIMDGASQVNNFTYGVGFDALYNFYESKEGYNTAGLFLGFGLGGDSFIV
                     QGESYLKSQMQICNNTAGCSASMNTSYFQMPVEFGFRSNFSKHSGIEVGFKLPLFTNQ
                     FYKERGVDGSVDVFYKRNFSIYFNYMINF"
     misc_feature    74588..75109
                     /locus_tag="HPSH112_00380"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            75354..77114
                     /locus_tag="HPSH112_00385"
                     /db_xref="GeneID:12772860"
     CDS             75354..77114
                     /locus_tag="HPSH112_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226808.1"
                     /db_xref="GI:386753590"
                     /db_xref="GeneID:12772860"
                     /translation="MKAIKILFMMTLSLNAISMNRALFDLKDSQLKGELTPKIVNFGG
                     YKSSTTEWGATALNYINAANGDAKKFSMLVEKMRFGSGILGNLRAHAHLRQALKLQKN
                     LKYCLKIIARDSFYSYRTGIYIPLGISLKDQKTAQKMLADLSVVGAYLKKQQENEKAQ
                     SPYYRSNNYYNSYYSPYYGMYGMYGMGMYGMYGMGMYDFYDFYDGMYGFYPNMFFMMQ
                     VQDYLMLENYMYAIDQEEILDHDASLNQLDTPTDDDRDDKDDKSLQQANLMSFYRDPK
                     FSKGIQTNRLNSALVNLDNSRMLKDNSLFHTKAMPTKSVDAITSQAKELNHLVGQIKE
                     MKQDGASPSKIDSVVNKAMEVRDKLDNNLNQLDNDLKDQKGLSSEQQAQVDKALDSVQ
                     QLSHSSDVVGNYLDGSLKIDDGDDRDDLNDAMNNPMQQPTQQTPTNNMGNTHANDSKD
                     QGGNALINPNTNTDDTHTDDTHTDDTRTDTNTTNDTSATDTPTDDTDDKDTGGMNNTG
                     DMNNTDTGNTDTGNTDTGNTDDMSNMNNGNDMGDDMNNANDMNDDMGNSNDDMGDMGD
                     MNDDMGGDMGDMGDMGDMGN"
     misc_feature    <76422..76535
                     /locus_tag="HPSH112_00385"
                     /note="Der GTPase activator (YihI); Region: YihI; cl01172"
                     /db_xref="CDD:260819"
     gene            77413..77499
                     /locus_tag="HPSH112_00390"
                     /db_xref="GeneID:12772861"
     CDS             77413..77499
                     /locus_tag="HPSH112_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226809.1"
                     /db_xref="GI:386753591"
                     /db_xref="GeneID:12772861"
                     /translation="METPFIPQLTPLKTLFKEPFALAFFRAF"
     gene            complement(77546..79567)
                     /locus_tag="HPSH112_00395"
                     /db_xref="GeneID:12772862"
     CDS             complement(77546..79567)
                     /locus_tag="HPSH112_00395"
                     /note="COG0840 Methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis transducer (tlpC)"
                     /protein_id="YP_006226810.1"
                     /db_xref="GI:386753592"
                     /db_xref="GeneID:12772862"
                     /translation="MRSTRIGSKIVMMVCAVVIAISAVMGVIISYKVESVLQSQATEL
                     LQKKAQLVSFKIQSIMKRIFIGANTLEKFLSDENSAINDTLKKHMLSEFLLANPHVLL
                     INAIYTDNNERIITAMNLDSKIAYPNTALNENMTNQIRSLKDITHSDPYYKEINGNKI
                     YGMDITLPLMGKNQKIIGALNLFLSIDAFYTDVVGKKKSNTFLMGKDGRLLINPNREI
                     QDKILSAINPDKRVAKAVEYYNQNEAGTLSYHSLSGNTETFLAIQPFDFFEEKGDNGN
                     QWRWAIGKYVNKSLVFKEATNTKYIIITTLILGVLVLALLVFIIVSSLITKRISRVNN
                     TLNDFFNLLNNPKNNHAISLTPPSAYDEIGQMQTSINENILKIQESIQADNQAIQNSI
                     EVTNHVENGDFTQEIACVPKNKDLQALRNTINSIIQYFRNQIGANIEALNNALEHYKN
                     LDFTHHIQNPKANMEKALNTLGQEISSMLKASLGFANALNHESKDLKTCVDDLTKTAH
                     KQERSLKNTTQSLEEITNIITTIDSKSQEMISQGEDIKSVVDMIRDIADQTNLLALNA
                     AIEAARAGEHGRGFAVVADEVRKLAERTQKSLSEIEANINILVQSIADNAESIKMQNK
                     GVENIHNSINALQQDVQDNLTIANHSLQVSAKIDGISQDILEDVSKKKF"
     misc_feature    complement(77570..78070)
                     /locus_tag="HPSH112_00395"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(77570..77572,77576..77581,77588..77593,
                     77597..77602,77609..77611,77618..77623,77630..77632,
                     77636..77641,77648..77653,77657..77662,77669..77671,
                     77690..77695,77702..77704,77711..77716,77753..77758,
                     77765..77770,77774..77779,77786..77791,77798..77800,
                     77807..77812,77819..77821,77828..77830,77840..77842,
                     77861..77863,77870..77872,77882..77884,77891..77896,
                     77903..77905,77912..77914,77921..77926,77933..77938,
                     77945..77947,77954..77959,77963..77965,77975..77980,
                     77984..77989,77996..77998,78005..78010,78017..78022,
                     78029..78031,78038..78043,78050..78052,78059..78064,
                     78068..78070))
                     /locus_tag="HPSH112_00395"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(77795..77896)
                     /locus_tag="HPSH112_00395"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(79721..80110)
                     /gene="rpsI"
                     /locus_tag="HPSH112_00400"
                     /db_xref="GeneID:12772863"
     CDS             complement(79721..80110)
                     /gene="rpsI"
                     /locus_tag="HPSH112_00400"
                     /note="COG0103 Ribosomal protein S9"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_006226811.1"
                     /db_xref="GI:386753593"
                     /db_xref="GeneID:12772863"
                     /translation="MRKIYATGKRKTAIAKVWLTPGKGELSINEQSLNQWLGGHEAIK
                     MKVMQPLLLTKQEQSVDIKAVVFGGGYSAQAEALRHGISKALNAYDIAFRAVLKPKGL
                     LTRDSRVVERKKYGKRKARRSPQFSKR"
     misc_feature    complement(79724..80104)
                     /gene="rpsI"
                     /locus_tag="HPSH112_00400"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            complement(80107..80532)
                     /gene="rplM"
                     /locus_tag="HPSH112_00405"
                     /db_xref="GeneID:12772864"
     CDS             complement(80107..80532)
                     /gene="rplM"
                     /locus_tag="HPSH112_00405"
                     /note="COG0102 Ribosomal protein L13"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_006226812.1"
                     /db_xref="GI:386753594"
                     /db_xref="GeneID:12772864"
                     /translation="MTKTAKVNEIVRDWVVLDAKDKVFGRLITEIAVLLRGKHRPFYT
                     PNVDCGDFVVVINANKVKFSGMKLEDKEYFTHSGYFGSTKSKTLQEMLEKTPEKLYHL
                     AVRGMLPKTKLGKAMIKKLKVYRDDKHPHTAQTSKKDAK"
     misc_feature    complement(80152..80493)
                     /gene="rplM"
                     /locus_tag="HPSH112_00405"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    complement(order(80164..80169,80176..80178,80188..80190,
                     80194..80196,80200..80208,80212..80220,80224..80232,
                     80248..80253,80335..80337,80341..80343,80425..80427,
                     80437..80439,80446..80448,80455..80460,80464..80466))
                     /gene="rplM"
                     /locus_tag="HPSH112_00405"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    complement(80248..80250)
                     /gene="rplM"
                     /locus_tag="HPSH112_00405"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            complement(80723..80911)
                     /locus_tag="HPSH112_00410"
                     /db_xref="GeneID:12772865"
     CDS             complement(80723..80911)
                     /locus_tag="HPSH112_00410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226813.1"
                     /db_xref="GI:386753595"
                     /db_xref="GeneID:12772865"
                     /translation="MQKEQEALEIAKKAVKIVFFLGLVVVLLMMINLYMLINQINASA
                     QMSHQIKKIEERLNQEQK"
     gene            complement(80918..82270)
                     /locus_tag="HPSH112_00415"
                     /db_xref="GeneID:12772866"
     CDS             complement(80918..82270)
                     /locus_tag="HPSH112_00415"
                     /note="COG0579 Predicted dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="malate:quinone oxidoreductase"
                     /protein_id="YP_006226814.1"
                     /db_xref="GI:386753596"
                     /db_xref="GeneID:12772866"
                     /translation="MSMEFDAVIIGGGVSGCATFYTLSEYSSLKRVAIVEKCSKLAQI
                     SSSAKANSQTIHDGSIETNYTPEKAKKVRLSAYKTRQYALNKGLQNEVIFETQKMAIG
                     VGDEECEFMKKRYESFKEIFVGLEEFDKQKIKELEPNVILGANGIDRHENIIGHGYQK
                     DWSTMNFAKLSENFVEEALKLKPNNQVFLNFKVKKIEKRNDTYAVISEDIEEVYAKFV
                     LVNAGSYALPLAQSMGYGLDLGCLPVAGSFYFVPDLLRGKVYTVQNPKLPFAAVHGDP
                     DAVIKGKTRIGPTALTMPKLERNKCWLKGISLELLKMDLNKDVFKIAFDLMSDKEIRN
                     YVFKNMVFELPIIGKRKFLKDAQKIIPSLSLEDLEYAHGFGEVRPQVLDKTKRKLELG
                     EKKICTHKGITFNMTPSPGATSCLQNALVDSQEIAAYLGESFELERFYKDLSPEELEN
                     "
     misc_feature    complement(80942..82267)
                     /locus_tag="HPSH112_00415"
                     /note="Malate:quinone oxidoreductase (Mqo); Region: Mqo;
                     cl17341"
                     /db_xref="CDD:266633"
     misc_feature    complement(80921..82264)
                     /locus_tag="HPSH112_00415"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: COG0579"
                     /db_xref="CDD:223652"
     gene            complement(82324..83697)
                     /locus_tag="HPSH112_00420"
                     /db_xref="GeneID:12772867"
     CDS             complement(82324..83697)
                     /locus_tag="HPSH112_00420"
                     /note="COG0791 Cell wall-associated hydrolases
                     (invasion-associated proteins)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226815.1"
                     /db_xref="GI:386753597"
                     /db_xref="GeneID:12772867"
                     /translation="MRYFLVVFLFLFVGCMQKDFTLKDLSLPQEASSYLASPQNGSNN
                     NQSIDPQALRENLKESYLKAWYSPWLDMKVKSNKKEVFWILKEMDKSTGYGEDLKPNA
                     KAFNDELIKSMDIEHYPSVKIKAVVARDSDVRAVPTNKPFYLSQKGYPFDRYQNSLIF
                     QGTPVLITHFNTDKTYAHIQSSFVYGWIKVSDLAYMHDKDIELLIHLKDYVMPIKDKI
                     PLYTDYGDFYTNARVGELFALIPQSQKTPEKPPKKELKAYGFLRDAKGYATLQSVILE
                     EKDFFVFPKAFNSENMAYFIDTMLGQKYGWGGLLGNRDCSAFTRDSFANFGILLPRNS
                     YAQSRYANNYVDLSSMKAKEKEDYILKNATPFGTLLYLKGHIMLYLGAHNHQAIVAHS
                     IWSVQTQKHFKTLSHKIGGVVITSLWLAEEHNGAFSKKKLLIDRVLGMSDLKDFVNKT
                     SSPLNAN"
     misc_feature    complement(83344..>83637)
                     /locus_tag="HPSH112_00420"
                     /note="NLPC_P60 stabilizing domain, N term; Region:
                     N_NLPC_P60; pfam12912"
                     /db_xref="CDD:257396"
     misc_feature    complement(83128..83277)
                     /locus_tag="HPSH112_00420"
                     /note="SH3 domain of the SH3b1 type; Region: SH3_6;
                     pfam12913"
                     /db_xref="CDD:205144"
     misc_feature    complement(82966..83109)
                     /locus_tag="HPSH112_00420"
                     /note="SH3 domain of SH3b2 type; Region: SH3_7; pfam12914"
                     /db_xref="CDD:257397"
     misc_feature    complement(82447..>82848)
                     /locus_tag="HPSH112_00420"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     misc_feature    complement(82387..82797)
                     /locus_tag="HPSH112_00420"
                     /note="NlpC/P60 family; Region: NLPC_P60; pfam00877"
                     /db_xref="CDD:189752"
     gene            complement(83718..85736)
                     /locus_tag="HPSH112_00425"
                     /db_xref="GeneID:12772868"
     CDS             complement(83718..85736)
                     /locus_tag="HPSH112_00425"
                     /note="COG0568 DNA-directed RNA polymerase, sigma subunit
                     (sigma70/sigma32)"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="YP_006226816.1"
                     /db_xref="GI:386753598"
                     /db_xref="GeneID:12772868"
                     /translation="MKKKANEEKAPKKAKAEAAQENKTKENNKAKESKIKEAKTKESK
                     IKETKAKEPVPVKKLSFNEALEELFANSLSDCVSYESIIQISAKVPTLAQVKKIKELC
                     QKYQKKLVSSSEYAKKLNAIDKIKKTEEKKKVLDEELEDGYDFLKEKDFLEWSRSDSP
                     VRMYLREMGDIKLLSKDEEIELSKQIRLGEDIILDAICSVPYLIDFIYAYKDALINRE
                     RRVKELFRSFDDDDENSVSNSKKDDDSEEYEENEERKKVVSEKDRKRVEKVQESFKAL
                     DKAKKEWLKALEAPVDEKEDELVRLLTLAYKRQTLKDRLYDLEPTSKLINELVKTMET
                     TLKSGDGFEKELKRLEYKLPLFNDTLIANHKKILANITSMTKEDIIAQVPEATMVSVY
                     MDLKKLFLTKEASEEGFDLDPNKLKEILEQIKRGKLISDRAKNKMAKSNLRLVVSIAK
                     RFTSRGLPFLDLIQEGNIGLMKAVDKFEHEKGFKFSTYATWWIKQAISRAIADQARTI
                     RIPIHMIDTINRINKVMRKHIQENGKEPDLEVVAEEVGLSLDKVKNVIKVTKEPISLE
                     TPVGNDDDGKFGDFVEDKNIVSSIDHIMREDLKVQIESVLDQLNEREKAVIRMRFGLL
                     DDESDRTLEEIGKELNVTRERVRQIESSAIKKLRSPQYGRILRNYLRI"
     misc_feature    complement(83727..85547)
                     /locus_tag="HPSH112_00425"
                     /note="RNA polymerase sigma factor RpoD; Validated;
                     Region: PRK05658"
                     /db_xref="CDD:235549"
     misc_feature    complement(85158..85265)
                     /locus_tag="HPSH112_00425"
                     /note="Sigma-70 factor, region 1.2; Region: Sigma70_r1_2;
                     pfam00140"
                     /db_xref="CDD:249622"
     misc_feature    complement(84216..84428)
                     /locus_tag="HPSH112_00425"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    complement(83958..84191)
                     /locus_tag="HPSH112_00425"
                     /note="Sigma-70 region 3; Region: Sigma70_r3; pfam04539"
                     /db_xref="CDD:146934"
     misc_feature    complement(83763..83942)
                     /locus_tag="HPSH112_00425"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    complement(order(83775..83777,83781..83786,83790..83798,
                     83802..83807,83811..83813,83841..83846,83877..83879,
                     83907..83909))
                     /locus_tag="HPSH112_00425"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            complement(85926..86621)
                     /locus_tag="HPSH112_00430"
                     /db_xref="GeneID:12772869"
     CDS             complement(85926..86621)
                     /locus_tag="HPSH112_00430"
                     /EC_number="3.2.2.9"
                     /note="COG0775 Nucleoside phosphorylase"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase"
                     /protein_id="YP_006226817.1"
                     /db_xref="GI:386753599"
                     /db_xref="GeneID:12772869"
                     /translation="MVQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYRNK
                     EIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHD
                     VDLSAFNHPLGFIPESAIFIETSESLNALAKKVANEQHIALKEGVIASGDQFVHSKER
                     KEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKANMSFDAFLEKSAQ
                     TSAKFLKSMVDKL"
     misc_feature    complement(85929..86612)
                     /locus_tag="HPSH112_00430"
                     /note="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase; Validated; Region: PRK05584"
                     /db_xref="CDD:180148"
     gene            complement(86632..87561)
                     /locus_tag="HPSH112_00435"
                     /db_xref="GeneID:12772870"
     CDS             complement(86632..87561)
                     /locus_tag="HPSH112_00435"
                     /note="COG0331 (acyl-carrier-protein)
                     S-malonyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl CoA-acyl carrier protein transacylase"
                     /protein_id="YP_006226818.1"
                     /db_xref="GI:386753600"
                     /db_xref="GeneID:12772870"
                     /translation="MQYALLFPGQGSQCIGMGKSFYESHTLAKELFERASNALKVDMK
                     KTLFEENELLKESAYTQPAIYLVSYIAYQLLNKQVNGGLKPVFALGHSLGEVSAVSLS
                     GALDFEKALKLTHQRGKMMQEACANKDASMMVVLGVSEESLLSLCQRTKNVWCANFNG
                     GMQVVLAGIKDDLKALEPTLKEMGAKRVVFLEMSVASHCPFLEPMIFKFQELLEKSLK
                     DKFHFEIISNATNEAYHNKAKAVELLSLQLTQPVRYQDCVKSNNDRVDVFFELGCGSV
                     LKGLNKRLSNKPTISVGDNKGLDEAIEFLEEYV"
     misc_feature    complement(86704..87561)
                     /locus_tag="HPSH112_00435"
                     /note="malonyl CoA-acyl carrier protein transacylase;
                     Region: fabD; TIGR00128"
                     /db_xref="CDD:232839"
     gene            87692..87783
                     /locus_tag="HPSH112_t08194"
                     /db_xref="GeneID:12772871"
     tRNA            87692..87783
                     /locus_tag="HPSH112_t08194"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12772871"
     gene            87987..88820
                     /locus_tag="HPSH112_00440"
                     /db_xref="GeneID:12772872"
     CDS             87987..88820
                     /locus_tag="HPSH112_00440"
                     /note="COG3839 ABC-type sugar transport systems, ATPase
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction enzyme R protein (hsdR)"
                     /protein_id="YP_006226819.1"
                     /db_xref="GI:386753601"
                     /db_xref="GeneID:12772872"
                     /translation="MKNHLPFNIFLQSLKISNRTLGFFTDWQKCLKNRNEISIALNHL
                     NFLLGKGAQELKSCIKSLFEEYPKAFNVLNILIAVRNKDEVVLDADGNFYPLHSYFEN
                     DEKVYQFICQTGLEQIFCNRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENYLSGLFF
                     QAQLNFKEQVDIREFENLYQAFGDDIKKFDFVVCGKDTTYFIEANFYTINGSKLNEVA
                     RSYQELALKFEAFLNYEFIWITDGIGWWDAKSKLQEAYKSVEIYNLSNVNDFISKVQK
                     W"
     misc_feature    87999..88811
                     /locus_tag="HPSH112_00440"
                     /note="DpnII restriction endonuclease; Region: DpnII;
                     pfam04556"
                     /db_xref="CDD:252670"
     gene            88814..89647
                     /locus_tag="HPSH112_00445"
                     /db_xref="GeneID:12772873"
     CDS             88814..89647
                     /locus_tag="HPSH112_00445"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="type I restriction enzyme M protein HsdM"
                     /protein_id="YP_006226820.1"
                     /db_xref="GI:386753602"
                     /db_xref="GeneID:12772873"
                     /translation="MVIAHSNEIARPIFKSQDQLFTLYQGDCNEVLPQFENQFDLIFA
                     DPPYFLSNDGLSIQSGKIVSVNKGDWDKEESVNDIDGFNYQWINNAKKALKNTGSLLI
                     SGTYHNIFSLGRILQKLDFKILNLITWQKTNPPPNFSCRYLTHSAEQIIWARKSYKHK
                     HVFNYEVLKKINNDKQMRDVWSFPAIAPWEKVNGKHPTQKPLALLVRLLLMASDENSL
                     IGDPFSGSSTTGIAANLLKRQFIGIEKESEFVKISMDRKSELDARFKEIRSKIKDLNL
                     K"
     misc_feature    <88865..>88957
                     /locus_tag="HPSH112_00445"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     misc_feature    88928..89578
                     /locus_tag="HPSH112_00445"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(89665..90555)
                     /locus_tag="HPSH112_00450"
                     /db_xref="GeneID:12772874"
     CDS             complement(89665..90555)
                     /locus_tag="HPSH112_00450"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-1,2-fucosyltransferase"
                     /protein_id="YP_006226821.1"
                     /db_xref="GI:386753603"
                     /db_xref="GeneID:12772874"
                     /translation="MAFKVVQICGGLGNQMFQYAFAKSLQKHLNTPVLLDITSFDGSN
                     RKMQLELFPIDLPYASAKEIAIAKMQHLPKLVRDALKCMGFDRVSQEIVFEYEPKLLK
                     PSRLTYFFGYFQDPRYFDAISPLIKQTFTLPPPENSKKKEEEYYRKLSLILAAKNSVF
                     VHIRRGDYVGIGCQLGINYQKKALEYMAKRVPNMELFVFCEDLKFTQNLDLGYPFIDM
                     TTRDKEEEAYWDMLLMQSCQHGIIANSTYSWWAAYLIKNPEKIIIGPKHWLFGHENIL
                     CEEWVKIESHFEVKSEKYNA"
     misc_feature    complement(89752..90549)
                     /locus_tag="HPSH112_00450"
                     /note="Alpha-1,2-fucosyltransferase; Region:
                     Fut1_Fut2_like; cd11301"
                     /db_xref="CDD:211387"
     misc_feature    complement(order(89815..89823,89875..89877,89956..89964,
                     90064..90066,90070..90072,90514..90525))
                     /locus_tag="HPSH112_00450"
                     /note="GDP-Fucose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:211387"
     gene            complement(90653..91183)
                     /locus_tag="HPSH112_00455"
                     /db_xref="GeneID:12772875"
     CDS             complement(90653..91183)
                     /locus_tag="HPSH112_00455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226822.1"
                     /db_xref="GI:386753604"
                     /db_xref="GeneID:12772875"
                     /translation="MPKPKKNTLPCSLSIKMSYFMRLLIKWRTRSLSHKMMTLIQILS
                     ILALASKTSEDLEEQLKKIKAYIYRTLNAKIASDVYNRVLILVNEYCTNEELFDKESV
                     KISDLLIQDIQLYALVDEMLKEDKYQVQHTILKGIIKRKYDEAYSLNSEDRILLEYQE
                     RLLEPSYASFSNKKFK"
     gene            91256..92200
                     /locus_tag="HPSH112_00460"
                     /db_xref="GeneID:12772876"
     CDS             91256..92200
                     /locus_tag="HPSH112_00460"
                     /EC_number="1.1.1.272"
                     /note="COG1052 Lactate dehydrogenase and related
                     dehydrogenases"
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="YP_006226823.1"
                     /db_xref="GI:386753605"
                     /db_xref="GeneID:12772876"
                     /translation="METFKKGVVLDAKSVGLKALEVLKEVADFDFYEITSPNQVVERC
                     KDAEIVVLNKVIITQEILSQLPKLKLICITATGTDNVDIKSAKALGIEVKNVSAYSTE
                     SVAQHTLAYTLSLLGRINDYDHYCKSGEYSQSDIFTHISGIKMGLIKGSQWGVIGLGT
                     IGKRVAKLAQAFGAKVVYYSPKDKKEEYERLSLKDLLTTSDIISIHAPLNESTRDLIA
                     LKELQSLKDGAILINVGRGGIVNEKDLAGILETKDLYYASDVFVKEPFEKDHAFLNPK
                     IQNKLLLTPHIAWAYSDSLKTLVEKTKENIQDFLASQK"
     misc_feature    91268..92197
                     /locus_tag="HPSH112_00460"
                     /note="2-hydroxyacid dehydrogenase; Provisional; Region:
                     PRK08410"
                     /db_xref="CDD:181414"
     misc_feature    91271..92185
                     /locus_tag="HPSH112_00460"
                     /note="Formate/glycerate dehydrogenases, D-specific
                     2-hydroxy acid dehydrogenases and related dehydrogenases;
                     Region: FDH_GDH_like; cl17240"
                     /db_xref="CDD:266580"
     misc_feature    order(91724..91732,91736..91738,91790..91798,91871..91876,
                     91955..91957)
                     /locus_tag="HPSH112_00460"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240631"
     gene            complement(92544..93257)
                     /locus_tag="HPSH112_00465"
                     /db_xref="GeneID:12772877"
     CDS             complement(92544..93257)
                     /locus_tag="HPSH112_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226824.1"
                     /db_xref="GI:386753606"
                     /db_xref="GeneID:12772877"
                     /translation="MKKIVLVAIALLMSACASYKITPEHVTSYNNGIQVMTSTQAKSK
                     VQLEIAQSKLKGLSESPLVLYVAAQVLEGNPVVFSRKAISVSINQTILPVLSLRQVMK
                     SSFDFEGILQSFNIAVPTTPIDNVNMITPPMFYYGQGGFLAYNGLMYGGMGMYGPGFG
                     MMMMDDVEEQEVMQESRQALKILAINYLKNNTLNVENKAKGGFVVVDTKNLKTPGVVV
                     VKVFLEDEIHTFKIDISKM"
     gene            complement(93364..94824)
                     /locus_tag="HPSH112_00470"
                     /db_xref="GeneID:12772878"
     CDS             complement(93364..94824)
                     /locus_tag="HPSH112_00470"
                     /EC_number="4.2.3.1"
                     /note="COG0498 Threonine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="YP_006226825.1"
                     /db_xref="GI:386753607"
                     /db_xref="GeneID:12772878"
                     /translation="MPFVPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLEWQDC
                     LNLSYNELVECVFERLGLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYH
                     GPSLAFKDMALQPLASLFSNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCL
                     YPKDGTSLVQKLQMVTQSASNLKVFGISGDFDDAQNALKNLLKDDDFNGALKTRQLKL
                     SVANSVNFGRIAFQIVYHIWGFLELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKM
                     GLNIDKIKVVTNSNDVLREFIETGRYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFG
                     FERTLELMQALEEEKFYALKPKELALLQEHFSCASCSDEACLKTIQEVYAEHQYLIDP
                     HTATALNASLKTHEKTLVSATASYEKFPRTTLLALNEQKKNDNDKTALETLKNSYNTP
                     DSQRLDDLFERGIKHQEVLKLNEIKSSILLWLENTH"
     misc_feature    complement(93379..94824)
                     /locus_tag="HPSH112_00470"
                     /note="threonine synthase; Validated; Region: PRK09225"
                     /db_xref="CDD:236418"
     misc_feature    complement(93397..94818)
                     /locus_tag="HPSH112_00470"
                     /note="Threonine synthase catalyzes the final step of
                     threonine biosynthesis. The conversion of
                     O-phosphohomoserine into threonine and inorganic phosphate
                     is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD
                     includes members from higher plants; Region: Thr-synth_2;
                     cd01560"
                     /db_xref="CDD:107203"
     misc_feature    complement(order(93586..93588,94036..94041,94498..94500))
                     /locus_tag="HPSH112_00470"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107203"
     misc_feature    complement(94498..94500)
                     /locus_tag="HPSH112_00470"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107203"
     gene            95027..97063
                     /locus_tag="HPSH112_00475"
                     /db_xref="GeneID:12772879"
     CDS             95027..97063
                     /locus_tag="HPSH112_00475"
                     /note="COG0840 Methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein TlpA"
                     /protein_id="YP_006226826.1"
                     /db_xref="GI:386753608"
                     /db_xref="GeneID:12772879"
                     /translation="MSKGLSIGNKIILCVALIVIVCVSILGVSLNSRVKEILKENALH
                     SMQDSLHFKVKEVQGILENTYTSVGIVKAMLPKDTKREIKIHLLKNFILANSHVAGVS
                     MFFKDREDLRFTLLRDNDTIKLVENPSLGNNPLVQKTMKNKEISKSLPYYRKMPNGAE
                     VYGVNILLPLLNENTQEAVGALMIFFSIDSFSNEITKNRSDLFLIGVKGKVLLSANKS
                     LQDKSIAEIYKSVPKATNEVMAILENGSNGSKATLEYLDPFSHKENFLAVETFKMLGK
                     TESRDNLNWMIASIIEKDKVYEQVGSVRFMVIVASAIMVLALIIAITLLMRAIVSNRL
                     EAVSSTLSHFFKLLNNQANSSGIKLVEAKSNDELGRMQTAINKNILQTQKIMQEDRQA
                     VQDTIKVVSDVKTGNFAVRITAEPASPDLKELRDALNGIMDYLQESVGTHMPSIFKIF
                     ESYSGLDFRGRIQNASGRVELVTNALGQEIQKMLETSSNFAKDLANDSANLKECVQNL
                     EKASNSQHKSLMETSKTIENITTSIQGVSSQSEAMIEQGQDIKSIVEIIRDIADQTNL
                     LALNAAIEAARAGEHGRGFAVVADEVRKLAERTQKSLSEIEANINILVQSISDTSESI
                     KNQVKEVEEINASIEALRSVTEGNLKIASDSLEISQEIDKVSNDILEDVNKKQF"
     misc_feature    95864..97060
                     /locus_tag="HPSH112_00475"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    96497..97039
                     /locus_tag="HPSH112_00475"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(96503..96508,96515..96520,96527..96529,96536..96541,
                     96545..96550,96557..96559,96566..96571,96578..96580,
                     96587..96592,96599..96604,96611..96613,96620..96625,
                     96629..96634,96644..96646,96650..96655,96662..96664,
                     96671..96676,96683..96688,96695..96697,96704..96706,
                     96713..96718,96725..96727,96737..96739,96746..96748,
                     96767..96769,96779..96781,96788..96790,96797..96802,
                     96809..96811,96818..96823,96830..96835,96839..96844,
                     96851..96856,96893..96898,96905..96907,96914..96919,
                     96926..96928,96935..96940,96941..96946,96953..96958,
                     96977..96979,96986..96991,96998..97000,97007..97012,
                     97016..97021,97028..97033,97037..97039)
                     /locus_tag="HPSH112_00475"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    96713..96814
                     /locus_tag="HPSH112_00475"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            97063..98169
                     /locus_tag="HPSH112_00480"
                     /db_xref="GeneID:12772880"
     CDS             97063..98169
                     /locus_tag="HPSH112_00480"
                     /note="COG1636 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226827.1"
                     /db_xref="GI:386753609"
                     /db_xref="GeneID:12772880"
                     /translation="MLIHICCSVDNLYFLKKAKEAFAGEKMIGFFYNPNIHPYSEYLL
                     RLEDVKRACEMLEIELLEGDYELEKFLDKAKGKELLGEKSERCFECFDLRLEASALKA
                     FELGEEKFTTTLLTSPKKDPNQLIAKGQHIAQRHNLEFVVFRNDNFEHFKSELDLNLQ
                     ALARENELYRQNYCGCQFALKIQKESQNRSPFELYSPLKRQILPASVEERTQVFRALN
                     AAKKDANKPFLAQKTIATYRLLNGGVWLSKNSNPLNCYILARSKSKAKVRINDLRWVF
                     SQRLNALVGYSQRDETLFLTLESLNALMAKNYESLKELSLNPLNYEEELSLRALVSGS
                     ESVNPIIVLEERMEKTLFVEIKSIFQEEKVFYLL"
     misc_feature    97063..97530
                     /locus_tag="HPSH112_00480"
                     /note="Adenine nucleotide alpha hydrolases superfamily
                     including N type ATP PPases and ATP sulphurylases. The
                     domain forms a apha/beta/apha fold which  binds to
                     Adenosine group; Region: Alpha_ANH_like; cd01986"
                     /db_xref="CDD:238944"
     misc_feature    order(97072..97080,97084..97095,97153..97155,97159..97161)
                     /locus_tag="HPSH112_00480"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238944"
     gene            98285..99046
                     /locus_tag="HPSH112_00485"
                     /db_xref="GeneID:12772881"
     CDS             98285..99046
                     /locus_tag="HPSH112_00485"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226828.1"
                     /db_xref="GI:386753610"
                     /db_xref="GeneID:12772881"
                     /translation="MKTLFSVYLFLSLNPLFLEAKEITWSQFLENFKNKNEDDKPKPL
                     TLDKNNEKQKILDKNQQILKRALEKSLKFFFIFGYNYSQAAYSTTNQNLTLMANSIGF
                     NTATGLEHFLRNHPKVGFRIFSVYNYSHSVSLSQPQILMVQNYGGALDFSWIFVDKKT
                     YRFRSYLGIALEQGVLLVDTIKSGAITTIIPRSKKTFFQAPFRFGFIVDFIGYLSLQF
                     GIEMPLVRNVFYTYNNHQERFKPRFNANLSLIVSF"
     misc_feature    98600..99043
                     /locus_tag="HPSH112_00485"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            complement(99029..99811)
                     /locus_tag="HPSH112_00490"
                     /db_xref="GeneID:12772882"
     CDS             complement(99029..99811)
                     /locus_tag="HPSH112_00490"
                     /note="COG0463 Glycosyltransferases involved in cell wall
                     biogenesis"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226829.1"
                     /db_xref="GI:386753611"
                     /db_xref="GeneID:12772882"
                     /translation="MLKVSVITACFNSEKTIEDTILSVLNQTYKNIEYIIIDGASTDG
                     TLEIIQKYRDKIACAISEKDEGIYDAMNKGIKRSSGDIIALLNSDDFYKDEFVVEKVV
                     HEFENKNCDSVYADLVFVKPDCLEKVVRYYESGEFDPKTLLYGVVPAHPTLFVKKAIY
                     ERYGLYKTDYKISADFEMIIRLFVVQKISFSYLKEVLVVMRTGGVSARGFKSLLLRNK
                     ENLRACQENGIQANVFSMLLKYPRKIMGLFKRESKGSLKRND"
     misc_feature    complement(99056..99811)
                     /locus_tag="HPSH112_00490"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    complement(99188..99799)
                     /locus_tag="HPSH112_00490"
                     /note="WfgS and WfeV are involved in O-antigen
                     biosynthesis; Region: GT_2_WfgS_like; cd06433"
                     /db_xref="CDD:133055"
     misc_feature    complement(order(99281..99283,99287..99289,99698..99700))
                     /locus_tag="HPSH112_00490"
                     /note="metal-binding site"
                     /db_xref="CDD:133055"
     gene            complement(99842..101539)
                     /locus_tag="HPSH112_00495"
                     /db_xref="GeneID:12772883"
     CDS             complement(99842..101539)
                     /locus_tag="HPSH112_00495"
                     /note="COG0840 Methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein TlpB"
                     /protein_id="YP_006226830.1"
                     /db_xref="GI:386753612"
                     /db_xref="GeneID:12772883"
                     /translation="MVFSSMFASLGTRIVLVVLAALISLGGLFIGFVKVMQKDALAQL
                     KEHLETEQYKKREKTLAYMTKLLEQGIHEYYKNFDNTTARKMALDYFKRINDDKGMIY
                     MVVVDKNGIVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYD
                     GGVPEKKFAYSHYDEVSSMVIATTSYYTDINTENKAITEGVDKVFNESATKLFLWILT
                     ATIALVVLTLIYAKLRIVKRIDELVLKINAFSHGDKDLRAKIDVDDRNDEISQVGRGV
                     NLFVENARLIIEEIKGTSTLNKTSMDKLVQIAQETQKSMKNSSTTLDSVKNKATGIAS
                     MMSASIEQSQGLRKRLIETQALVKESKDAIGDLFSQITESAHTEEELSSKVEQLSRNA
                     DDVKSILDIINDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRNLAGRTQKSLAE
                     INSTIMVIVQEIDAVSSQMNLNSQKMERLSDMSKSVQETYDKMSSNLSSVVSDSNQSM
                     DDYAKSGHQIEAMVSDFVEVEKVSSKTLTDSSDILNIAMHVSETTMNLDKQVNLFKT"
     misc_feature    complement(<100688..101512)
                     /locus_tag="HPSH112_00495"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4564"
                     /db_xref="CDD:226930"
     misc_feature    complement(101126..101383)
                     /locus_tag="HPSH112_00495"
                     /note="Cache is an extracellular domain that is predicted
                     to have a role in small-molecule recognition in a wide
                     range of proteins; Region: Cache_2; smart01049"
                     /db_xref="CDD:214995"
     misc_feature    complement(100688..100837)
                     /locus_tag="HPSH112_00495"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(100691..100696,100703..100708,
                     100712..100717,100724..100729,100733..100738,
                     100793..100795,100799..100804,100811..100816,
                     100820..100825,100832..100837))
                     /locus_tag="HPSH112_00495"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(99848..100633)
                     /locus_tag="HPSH112_00495"
                     /note="Methyl-accepting chemotaxis-like domains
                     (chemotaxis sensory transducer); Region: MA; smart00283"
                     /db_xref="CDD:214599"
     misc_feature    complement(99968..100534)
                     /locus_tag="HPSH112_00495"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(99968..99970,99977..99979,99986..99991,
                     99998..100000,100007..100012,100016..100021,
                     100028..100033,100037..100039,100040..100045,
                     100052..100054,100061..100066,100073..100078,
                     100082..100087,100094..100096,100103..100108,
                     100124..100126,100133..100138,100175..100180,
                     100187..100192,100196..100201,100208..100213,
                     100220..100222,100229..100234,100241..100243,
                     100250..100252,100262..100264,100283..100285,
                     100292..100294,100304..100306,100313..100318,
                     100325..100327,100334..100336,100343..100348,
                     100355..100360,100367..100369,100376..100381,
                     100385..100387,100397..100402,100406..100411,
                     100418..100420,100427..100432,100439..100444,
                     100451..100453,100460..100465,100472..100474,
                     100481..100486,100490..100495,100502..100504,
                     100511..100513,100514..100516))
                     /locus_tag="HPSH112_00495"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(100217..100318)
                     /locus_tag="HPSH112_00495"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(101746..103491)
                     /locus_tag="HPSH112_00500"
                     /db_xref="GeneID:12772884"
     CDS             complement(101746..103491)
                     /locus_tag="HPSH112_00500"
                     /note="COG0737 5'-nucleotidase/2',3'-cyclic
                     phosphodiesterase and related esterases"
                     /codon_start=1
                     /transl_table=11
                     /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
                     /protein_id="YP_006226831.1"
                     /db_xref="GI:386753613"
                     /db_xref="GeneID:12772884"
                     /translation="MKKLVLIVFLTLTLSISAKEVKIVFLETSDIHGRLFSYDYATGE
                     QKPNNGLTRIAALIKKQRAENKNVVLIDSGDLLQGNSAELFNDEPIHPLVLAENDLKF
                     DIRVLGNHEFNFSKDFLEKNIKGFNGDVVNANIIKTADNQPFVKPYAIKKIDGVRVAI
                     VGYVVPHIPTWEASTPEHFAGLEFLDAEEALKKTLKELKGKYDVLIGAFHLGREDEKG
                     GDGVPDLAKKFPQFDIIFAGHEHAVYNTKIGKVHTIEPGAYGAYLAKGVVMFDTKTKK
                     KIVTTENLPTKGVPEDEELAKKYEYVDKKSKEYANEVVGEVTKTFIDRPDFITGEEKI
                     TTMPTAALQETPVIELINNVQKYYAKADVSAAALFNFGTNLKKGPFKRKDVAYIYKFA
                     NTLIGVKITGENLLKYMEWSYQFYNQLQPGDLTISFNENIRGYNFDMFSGVKYQVDVT
                     KPAGSRIINPTINNKPIDPKAVYKLAINNYRFGTLSKTLNLVTDANRYYNSYDELQDN
                     GQIRDLIIKYITEEKGGKVTPELEHNWEIINYNFKNPLLEKLREKLKEGSIKIPTSKD
                     GRTLNVKSIKESEVK"
     misc_feature    complement(101989..103479)
                     /locus_tag="HPSH112_00500"
                     /note="5'-nucleotidase/2',3'-cyclic phosphodiesterase and
                     related esterases [Nucleotide transport and metabolism];
                     Region: UshA; COG0737"
                     /db_xref="CDD:223808"
     misc_feature    complement(102679..103425)
                     /locus_tag="HPSH112_00500"
                     /note="Escherichia coli CpdB and related proteins,
                     N-terminal metallophosphatase domain; Region: MPP_CpdB_N;
                     cd07410"
                     /db_xref="CDD:163653"
     misc_feature    complement(order(102769..102771,102775..102777,
                     102862..102864,103162..103167,103267..103269,
                     103396..103398,103402..103404))
                     /locus_tag="HPSH112_00500"
                     /note="active site"
                     /db_xref="CDD:163653"
     misc_feature    complement(order(102769..102771,102775..102777,
                     102862..102864,103165..103167,103267..103269,
                     103396..103398,103402..103404))
                     /locus_tag="HPSH112_00500"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163653"
     misc_feature    complement(102043..102492)
                     /locus_tag="HPSH112_00500"
                     /note="5'-nucleotidase, C-terminal domain; Region:
                     5_nucleotid_C; pfam02872"
                     /db_xref="CDD:251581"
     gene            complement(103626..104093)
                     /locus_tag="HPSH112_00505"
                     /db_xref="GeneID:12772885"
     CDS             complement(103626..104093)
                     /locus_tag="HPSH112_00505"
                     /EC_number="4.4.1.21"
                     /note="COG1854 LuxS protein involved in autoinducer AI2
                     synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="YP_006226832.1"
                     /db_xref="GI:386753614"
                     /db_xref="GeneID:12772885"
                     /translation="MKTPKMNVESFNLDHTKVKAPYVRIADRKKGVNGDLIVKYDVRF
                     KQPNKDHMDMPSLHSLEHLVAEIIRNHASYVIDWSPMGCQTGFYLTVLNHDNYTEILE
                     VLEKTMQDVLKATEVPASNEKQCGWAANHTLEGAQNLARAFLDKRTEWSEVGV"
     misc_feature    complement(103635..104075)
                     /locus_tag="HPSH112_00505"
                     /note="S-ribosylhomocysteinase; Provisional; Region:
                     PRK02260"
                     /db_xref="CDD:179399"
     gene            complement(104107..105249)
                     /locus_tag="HPSH112_00510"
                     /db_xref="GeneID:12772886"
     CDS             complement(104107..105249)
                     /locus_tag="HPSH112_00510"
                     /EC_number="2.5.1.48"
                     /note="COG0626 Cystathionine beta-lyases/cystathionine
                     gamma-synthases"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="YP_006226833.1"
                     /db_xref="GI:386753615"
                     /db_xref="GeneID:12772886"
                     /translation="MRMQTKLIHGGISEDATTGAVSVPIYQTSTYRQDAIGRHKGYEY
                     SRSGNPTRFALEELIADLEGGVKGFAFASGLSGIHAVFSLLQSGDHVLLGDDVYGGTF
                     RLFNKVLVKNGLSCTIIDTSDLSQIKKAIKPNTKALYLETPSNPLLKITDLVQCASVA
                     KDHGLLTIVDNTFATPYCQNPLLLGADIVVHSGTKYLGGHSDVVAGLVTTSNEALAQE
                     IAFFQNAIGGVLGPQDSWLLQRGIKTLGLRMEAHQKNALCVAEFLEKHPKVERVYYPG
                     LSAHPNHELAKKQMRGFSGMLSFTLKNDSEAVAFVESLKLFILGESLGGVESLVGIPA
                     FMTHACIPKVQREAAGIKDGLVRLSVGIEHEQDLLEDLKQAFAKIK"
     misc_feature    complement(104119..105195)
                     /locus_tag="HPSH112_00510"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(104314..104316,104548..104553,
                     104557..104559,104587..104589,104638..104640,
                     104644..104646,104668..104670,104932..104934,
                     104941..104943,104956..104958,105022..105027,
                     105031..105036,105112..105114,105118..105120,
                     105151..105156,105160..105171))
                     /locus_tag="HPSH112_00510"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(104638..104640,104665..104670,
                     104674..104676,104740..104742,104827..104829,
                     104956..104958,105025..105033))
                     /locus_tag="HPSH112_00510"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(104665..104670,104674..104676,
                     104731..104733,104740..104742,104956..104958,
                     105025..105033))
                     /locus_tag="HPSH112_00510"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(104665..104667)
                     /locus_tag="HPSH112_00510"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            complement(105270..106187)
                     /locus_tag="HPSH112_00515"
                     /db_xref="GeneID:12772887"
     CDS             complement(105270..106187)
                     /locus_tag="HPSH112_00515"
                     /note="COG0031 Cysteine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine synthase B"
                     /protein_id="YP_006226834.1"
                     /db_xref="GI:386753616"
                     /db_xref="GeneID:12772887"
                     /translation="MIITTMQDAIGRTPVFKFTSKDYPIPTNSAIYAKLEHLNPGGSI
                     KDRLGQYLIEEGFRTGKITSKTTIIEPTAGNTGIALALVALKHHLKTIFVVPEKFSAE
                     KQQIMRALGAKVINTPTSEGISGAIKKSKELAESIPDSYLPLQFENPNNPAAYYHTLA
                     PEIVQELGVGLTSFVAGIGSGGTFAGTARYLKERIPTIRLIGVEPEGSILNGGEPGPH
                     EIEGIGVEFIPPFFANLDIDGFETISDEEGFSYTRKLAKKNGLLVGSSSGAAFVAALK
                     EAQRLPEGSQVLTIFPDVADRYLSKGIYL"
     misc_feature    complement(105288..106157)
                     /locus_tag="HPSH112_00515"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    complement(order(105291..105293,105300..105302,
                     105330..105332,105402..105410,105414..105422,
                     105690..105695,105858..105863,105870..105875,
                     105882..105887,105933..105935,105942..105944,
                     106068..106070,106074..106076,106092..106094,
                     106137..106145))
                     /locus_tag="HPSH112_00515"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    complement(order(105309..105314,105390..105392,
                     105522..105524,105639..105656,105963..105965,
                     106053..106055))
                     /locus_tag="HPSH112_00515"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    complement(106053..106055)
                     /locus_tag="HPSH112_00515"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            complement(107014..108876)
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /db_xref="GeneID:12772888"
     CDS             complement(107014..108876)
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="COG0443 Molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="YP_006226835.1"
                     /db_xref="GI:386753617"
                     /db_xref="GeneID:12772888"
                     /translation="MGKVIGIDLGTTNSAMAVYEGNEAKIIANKEGKNTTPSIVAFTD
                     KGEILVGESAKRQAVTNPEKTIYSIKRIMGLMFNEDKAKEAEKRLPYKIVDRNGACAI
                     EISGKVYTPQEISAKILMKLKEDAESYLGESVTEAVITVPAYFNDSQRKATKEAGTIA
                     GLNVLRIINEPTSAALAYGLDKKESEKIMVYDLGGGTFDVTVLETGDNVVEVLATGGD
                     AFLGGDDFDNRVIDFLASEFKSETGIEIKNDVMALQRLKEAAENAKKELSSAMETEIN
                     LPFITADATGPKHLVKKLTRAKFESLTEDLVEETISKIESVIKDAGLTKNEISEVVMV
                     GGSTRIPKVQERVKAFINKDLNKSVNPDEVVAVGASIQGGVLKGDVKDVLLLDVTPLS
                     LGIETLGGVMTKVIDRGTTIPAKKSQVFSTAEDNQPAVSIMVLQGERELARDNKSLGK
                     FDLQGIPPAPRGVPQIEVTFDIDANGILTVSAQDKNTGKSQEIKISGSSGLSDSEIEK
                     MVKDAELHKEEDARKKEVIEARNHADSLAHQTQKSLDEHKTNLNENDANEIQNAINAL
                     KECVKNDNATKAELEDKTKALAQAAQKLGEAMANKNNAEQPKKKDDDVIDAEVE"
     misc_feature    complement(107017..108876)
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="molecular chaperone DnaK; Provisional; Region:
                     dnaK; PRK00290"
                     /db_xref="CDD:234715"
     misc_feature    complement(107749..108876)
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="Nucleotide-binding domain of human HSPA9 and
                     similar proteins; Region: HSPA9-Ssq1-like_NBD; cd10234"
                     /db_xref="CDD:212676"
     misc_feature    complement(order(107860..107862,107866..107874,
                     108073..108075,108085..108087,108094..108096,
                     108208..108210,108286..108288,108292..108297,
                     108367..108369,108667..108669,108838..108849))
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212676"
     misc_feature    complement(order(108040..108045,108049..108051,
                     108103..108105,108112..108117,108124..108126,
                     108484..108495,108697..108702,108706..108711,
                     108718..108720,108730..108732,108784..108786,
                     108793..108795))
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="NEF interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212676"
     misc_feature    complement(order(108238..108249,108370..108372,
                     108376..108381,108424..108429,108433..108438))
                     /gene="dnaK"
                     /locus_tag="HPSH112_00530"
                     /note="SBD interface [polypeptide binding]; other site"
                     /db_xref="CDD:212676"
     gene            complement(108907..109482)
                     /locus_tag="HPSH112_00535"
                     /db_xref="GeneID:12772889"
     CDS             complement(108907..109482)
                     /locus_tag="HPSH112_00535"
                     /note="COG0576 Molecular chaperone GrpE (heat shock
                     protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein GrpE"
                     /protein_id="YP_006226836.1"
                     /db_xref="GI:386753618"
                     /db_xref="GeneID:12772889"
                     /translation="MKDKHNQEHDHLSQEEPESCEKACACKEQQGEEMQEASEKECEI
                     KEDFELKYQEMHEKYLRVHADFENVKKRLERDKSMALEYAYEKIALDLLPVIDALLGA
                     HRSAAEEDKESALTKGLELTMEKLHEVLARHGIEGIECLEEFDPNFHNAIMQVKSEEK
                     ENGKIVQVFQQGYKYKGRVLRPAMVSIAKND"
     misc_feature    complement(108922..109326)
                     /locus_tag="HPSH112_00535"
                     /note="GrpE is the adenine nucleotide exchange factor of
                     DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the
                     ATPase domain of Hsp70 catalyzing the dissociation of ADP,
                     which enables rebinding of ATP, one step in the Hsp70
                     reaction cycle in protein folding; Region: GrpE; cd00446"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(109084..109086,109117..109119,
                     109126..109128,109177..109179,109189..109191,
                     109210..109212,109219..109221,109231..109233,
                     109273..109278,109285..109287,109297..109299,
                     109306..109311,109318..109323))
                     /locus_tag="HPSH112_00535"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(108937..108939,108949..108951,
                     108976..108978,109024..109038,109045..109047,
                     109270..109272))
                     /locus_tag="HPSH112_00535"
                     /note="hsp70 (ATPase domain) interactions [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238252"
     gene            complement(109482..110312)
                     /locus_tag="HPSH112_00540"
                     /db_xref="GeneID:12772890"
     CDS             complement(109482..110312)
                     /locus_tag="HPSH112_00540"
                     /note="COG1420 Transcriptional regulator of heat shock
                     gene"
                     /codon_start=1
                     /transl_table=11
                     /product="heat-inducible transcription repressor"
                     /protein_id="YP_006226837.1"
                     /db_xref="GI:386753619"
                     /db_xref="GeneID:12772890"
                     /translation="MVIDEIFQIMMLKRIKVGSDLNKKESLLDAFVKTYLQILEPISS
                     KRLKELANLKISCATIRNYFQTLSKEGMLYQAHSSGARLPTFKALENYWQKSLRFEIL
                     KVNEKRLKSASENFGLFTLLKKPSLERLERVIECEKRFLILDFLAFSCAMSYSVKMEK
                     FLLELVGRSVKEVRSIAASVNALSLARQLERLEYSNTQITRFNLMGLKTLLNSPLFFD
                     ILGGKVLERLKKGLHFIEPDCMLVTRPIEFQNKRMQLLCVGKLECDYEGFFQTISKEE
                     "
     misc_feature    complement(109491..110255)
                     /locus_tag="HPSH112_00540"
                     /note="heat-inducible transcription repressor;
                     Provisional; Region: PRK03911"
                     /db_xref="CDD:235174"
     gene            110532..111170
                     /locus_tag="HPSH112_00545"
                     /db_xref="GeneID:12772891"
     CDS             110532..111170
                     /locus_tag="HPSH112_00545"
                     /note="COG0235 Ribulose-5-phosphate 4-epimerase and
                     related epimerases and aldolases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226838.1"
                     /db_xref="GI:386753620"
                     /db_xref="GeneID:12772891"
                     /translation="MLNMNTHTRGIDSNLIHSLKSISLSMFRKGFFGLYQGSISARIG
                     TNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYA
                     RPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKK
                     HFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV"
     misc_feature    110559..111134
                     /locus_tag="HPSH112_00545"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05834"
                     /db_xref="CDD:180279"
     gene            111191..111487
                     /locus_tag="HPSH112_00550"
                     /db_xref="GeneID:12772892"
     CDS             111191..111487
                     /locus_tag="HPSH112_00550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226839.1"
                     /db_xref="GI:386753621"
                     /db_xref="GeneID:12772892"
                     /translation="MTINTHYTPNFTQFQTLNNINNDATIKDRNQVEQDLQQSNIQDG
                     FSQDNTQNAPDFDRLQALNAINNDGEIKDKSQVEKSLADGENIPEIYSSLDTYA"
     gene            complement(111497..113380)
                     /locus_tag="HPSH112_00555"
                     /db_xref="GeneID:12772893"
     CDS             complement(111497..113380)
                     /locus_tag="HPSH112_00555"
                     /note="COG2604 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226840.1"
                     /db_xref="GI:386753622"
                     /db_xref="GeneID:12772893"
                     /translation="MDIYQKNLQALFKKDPLLFAQLKAIKENKKYEVFLGNDSANFNL
                     LDKETNTPLFEKSPLDSSLELYKNSEIYMLYPYLYYFGLGNGVFYRLLLGNGNLKRLV
                     VIEPEIEVIFIVLNLLDFSTEILENRLILLHAAFCHYNMIASLFDMDKKSRLYARMYD
                     LKLFNAYYERYSHQMIEINQHFTRALEHGAISVGNDAKDALIGIKQHAANLPEVIKSP
                     SLVDFVSTLKNRDTAIIVSTGPSLNKQLPLLKEIAPYATLFCIDASFPILAKAGIKPD
                     IVLSLERVDLTAKFYEETPLDFQEGVIFALTSIVHKRLIQAIKKGVKQFSFRPFGYTN
                     LFGLHQYGYVGIGMSAANMAYELVVHSRFKRCVFIGQDLSFSQSGNSHASGAIYGDRE
                     IKPKKDKDKIFTEKYGGNGEVETTLVWKLFLEFFEKDIFNTPYKLEVINATEGGARIK
                     GTKEMPFKEVCEKIDKSKPKPPINLIYPTKSEQAKNLRIAKQKCEEIIKYANEKKTQV
                     EEVFLKVAPFLEEVEKLHEEKKLEELDFKALENLSAEIDNIKELFDDKQFNSYFMDAI
                     QSYIFHQELHIAEIVCKKTNNEDELRAKQLEYIYAHKYWLFSLAGGIDCVIEAIKMAL
                     KEW"
     misc_feature    complement(111518..113380)
                     /locus_tag="HPSH112_00555"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2604"
                     /db_xref="CDD:225324"
     gene            complement(113443..114987)
                     /locus_tag="HPSH112_00560"
                     /db_xref="GeneID:12772894"
     CDS             complement(113443..114987)
                     /locus_tag="HPSH112_00560"
                     /note="COG1344 Flagellin and related hook-associated
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin B"
                     /protein_id="YP_006226841.1"
                     /db_xref="GI:386753623"
                     /db_xref="GeneID:12772894"
                     /translation="MSFRINTNIAALTSHAVGVQNNRDLSSSLEKLSSGLRINKAADD
                     SSGMAIADSLRSQSANLGQAIRNANDAIGMVQTADKAMDEQIKILDTIKTKAVQAAQD
                     GQTLESRRALQSDIQRLLEELDNIANTTSFNGQQMLSGSFSNKEFQIGAYSNTTIKAS
                     IGSTSSDKIGHVRMETSSFSGEGMLASAAAQNLTEVGLNFKQVNGVNDYKIESVRIST
                     SAGTGIGALSEIINRFSNTLGVRASYNVMATGGTPVQSGTVRDLTINGVEIGTVNDVH
                     KNDADGRLTNAINSVKDRTGVEASLDIQGRINLHSIDGRAISVHATSASGQVFGGGNF
                     AGISGTQHAVIGRLTLTRTDARDIIVSGVNFSHVGFHSAQGVAEYTVNLRAVRGIFDA
                     NVASAAGANANGAQAETNSQGIGAGVTSLKGAMIVMDMADSARTQLDKIRSDMGSVQM
                     ELVTTINNISVTQVNVKAAESQIRDVDFAEESANFSKYNILAQSGSFAMAQANAVQQN
                     VLRLLQ"
     misc_feature    complement(113446..114987)
                     /locus_tag="HPSH112_00560"
                     /note="flagellin B; Provisional; Region: PRK13588"
                     /db_xref="CDD:237440"
     misc_feature    complement(114559..114975)
                     /locus_tag="HPSH112_00560"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    complement(114241..114396)
                     /locus_tag="HPSH112_00560"
                     /note="Flagellin hook IN motif; Region: Flagellin_IN;
                     pfam07196"
                     /db_xref="CDD:254098"
     misc_feature    complement(114049..114207)
                     /locus_tag="HPSH112_00560"
                     /note="Flagellin hook IN motif; Region: Flagellin_IN;
                     pfam07196"
                     /db_xref="CDD:254098"
     misc_feature    complement(113449..113706)
                     /locus_tag="HPSH112_00560"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            115153..117363
                     /locus_tag="HPSH112_00565"
                     /db_xref="GeneID:12772895"
     CDS             115153..117363
                     /locus_tag="HPSH112_00565"
                     /EC_number="5.99.1.2"
                     /note="COG0550 Topoisomerase IA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase I"
                     /protein_id="YP_006226842.1"
                     /db_xref="GI:386753624"
                     /db_xref="GeneID:12772895"
                     /translation="MKHLIIVESPAKAKTIKNFLDKNYEVIASKGHVRDLSKFALGIK
                     IDETGFTPNYVVDKDHKELVKQIIELSKKASTTYIATDEDREGEAIGYHVACLIGGKL
                     ESYPRIVFHEITQNAILNALKTPRKIDMSKVNAQQARRFLDRIVGFKLSSLIASKITK
                     GLSAGRVQSAALKLVIDREREIKAFKPLTYFTLDAYFEPHLEAQLISYKGNKLKAQEL
                     IDKKEAQEIKNELEKESYTISSIIKKSKKSPTPPPFMTSTLQQSASSLLGFSPTKTMS
                     IAQKLYEGVATPQGVMGVITYMRTDSLNIAKEALEEARNKILKDYGKDYLPPKAKVYS
                     SKNKNAQEAHEAIRPTSIVLEPNALKDYLKPEELKLYTLIYKRFLASQMQDALFESQS
                     VVVACEKGEFKASGRKLLFDGYYKILGNDDKDKLLPNLKENDPIKLEKLESNAHVTEP
                     PARYSEASLIKVLESLGIGRPSTYAPTISLLQNRDYIKVEKKQISALGSAFKVIEILE
                     KHFEEIVDSKFSASLEEELDNIAQNKADYQQVLKDFYYPFMDKIEAGKKNIISQKVHE
                     KTGQSCPKCGGELVKKNSRYGEFVACNNYPKCKYVKQTENTNDGAKQESCEKCGGEMV
                     QKFGRNGAFLACNNYPECKNTKSLKNTPNANEIIEGVKCPECGGDIALKRSKKGSFYG
                     CNNYPKCNFLSNHKPINKRCEKCHYLMSERTYRKKKAHECIQCKERVFLEENDG"
     misc_feature    115153..117246
                     /locus_tag="HPSH112_00565"
                     /note="DNA topoisomerase I; Validated; Region: PRK05582"
                     /db_xref="CDD:235516"
     misc_feature    115156..115527
                     /locus_tag="HPSH112_00565"
                     /note="TOPRIM_TopoIA_TopoI: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to Escherichia coli
                     DNA topoisomerase I.   Type IA DNA topoisomerases remove
                     (relax) negative supercoils in the...; Region:
                     TOPRIM_TopoIA_TopoI; cd03363"
                     /db_xref="CDD:173783"
     misc_feature    order(115174..115179,115186..115188,115396..115398,
                     115402..115404,115408..115410)
                     /locus_tag="HPSH112_00565"
                     /note="active site"
                     /db_xref="CDD:173783"
     misc_feature    order(115195..115197,115399..115401,115405..115407,
                     115426..115431,115435..115440)
                     /locus_tag="HPSH112_00565"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173783"
     misc_feature    order(115396..115398,115402..115404)
                     /locus_tag="HPSH112_00565"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    115405..115407
                     /locus_tag="HPSH112_00565"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173783"
     misc_feature    115540..116808
                     /locus_tag="HPSH112_00565"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    order(115540..115623,115636..115698)
                     /locus_tag="HPSH112_00565"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(115567..115572,115579..115581,115591..115593,
                     115603..115605,115987..115989,115999..116001,
                     116047..116049,116566..116571,116578..116583,
                     116587..116589,116599..116604)
                     /locus_tag="HPSH112_00565"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    order(115669..115671,115681..115683,116674..116676)
                     /locus_tag="HPSH112_00565"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(115711..115734,115756..115779,115846..115863,
                     115897..115899,116302..116346,116350..116406,
                     116467..116499)
                     /locus_tag="HPSH112_00565"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(115900..115920,115924..116004,116029..116115,
                     116179..116205,116239..116301)
                     /locus_tag="HPSH112_00565"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(115933..115935,115945..115953,116182..116184,
                     116257..116259,116266..116268,116278..116280,
                     116560..116562,116566..116568,116632..116634)
                     /locus_tag="HPSH112_00565"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    order(116041..116043,116047..116049,116182..116184)
                     /locus_tag="HPSH112_00565"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    order(116500..116622,116632..116676,116692..116808)
                     /locus_tag="HPSH112_00565"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     misc_feature    116857..116970
                     /locus_tag="HPSH112_00565"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    116989..117102
                     /locus_tag="HPSH112_00565"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     misc_feature    117130..117246
                     /locus_tag="HPSH112_00565"
                     /note="Topoisomerase DNA binding C4 zinc finger; Region:
                     zf-C4_Topoisom; pfam01396"
                     /db_xref="CDD:110400"
     gene            117356..118282
                     /locus_tag="HPSH112_00570"
                     /db_xref="GeneID:12772896"
     CDS             117356..118282
                     /locus_tag="HPSH112_00570"
                     /note="COG0731 Fe-S oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226843.1"
                     /db_xref="GI:386753625"
                     /db_xref="GeneID:12772896"
                     /translation="MAKENLPIVFGPVLSRRFGKSLGVDLSPSKKQCNYNCIYCELGK
                     AKPIERMEEVIKVKTLINAIQNALNNLTTPIDVLTITANGEPTLYPHLLELIQSVKPF
                     LKGVKTLILSNGSLFYEPKVQQALKEFDIVKFSLDAIDLKAFERVDKPYSKDIDKILE
                     GILSFSQIYQGQLVAEVLLIKGVNDSANNLKLIADFLKKINTARVDLSTIDRPSSFKA
                     PKLSEDELLKCSLFFEGLCVSLPKRSIAQAKKLISCGIDELLALISRRPLSAEEAPLI
                     LDPNAFKHLETLLNHQKITIKKVGSLEFYCAF"
     misc_feature    117356..118219
                     /locus_tag="HPSH112_00570"
                     /note="Fe-S oxidoreductases [Energy production and
                     conversion]; Region: COG0731"
                     /db_xref="CDD:223803"
     misc_feature    117446..117976
                     /locus_tag="HPSH112_00570"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(117452..117454,117458..117460,117464..117466,
                     117470..117478,117596..117598,117605..117610,
                     117686..117694,117758..117760,117887..117889)
                     /locus_tag="HPSH112_00570"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(118432..119571)
                     /locus_tag="HPSH112_00575"
                     /db_xref="GeneID:12772897"
     CDS             complement(118432..119571)
                     /locus_tag="HPSH112_00575"
                     /note="COG3845 ABC-type uncharacterized transport systems,
                     ATPase components"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226844.1"
                     /db_xref="GI:386753626"
                     /db_xref="GeneID:12772897"
                     /translation="MKSVKIGKTNKVGKNTEMANTKTNKETYFKGSDQIGGIFTKIAK
                     KVREFVKKHPKKSNAALVVLTHVACKKAKELDDKVQDKSKQAEKENKINWWKYSGLTI
                     ATSFLLAACSVDTDKQIELEQEKQKANKSGIELEQEKQKTEQERQKTNKSGIELEQER
                     QKAEQEKQKTNKSGIELEQERQKTEQEKQKTIKAQKDFIKDLEQNCEEKHGQFFIKKA
                     RIKDSISIEVEAECKTPKPTKTNQTPIQPKHLPNSKQPHSQRGSKAQELIAYLQKELE
                     SLPYSQKTIAKQVNFYRPSSIAYLELDPRDFNVTEEWQNENLKIRSKAQAKMLEMRNP
                     QANLSPFQSFSIIQNIVADINKEIEVAASTEKKAEKVGYGYSKRM"
     misc_feature    complement(118435..119571)
                     /locus_tag="HPSH112_00575"
                     /note="Helicobacter pylori protein of unknown function
                     (DUF874); Region: DUF874; pfam05917"
                     /db_xref="CDD:114629"
     gene            complement(119671..122109)
                     /locus_tag="HPSH112_00580"
                     /db_xref="GeneID:12772898"
     CDS             complement(119671..122109)
                     /locus_tag="HPSH112_00580"
                     /EC_number="2.7.9.2"
                     /note="COG0574 Phosphoenolpyruvate synthase/pyruvate
                     phosphate dikinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate synthase"
                     /protein_id="YP_006226845.1"
                     /db_xref="GI:386753627"
                     /db_xref="GeneID:12772898"
                     /translation="MRYIKFFKELNNKNVNLVGGKNASIGEMFQELVPIGIKVPDGFA
                     ITSEAYWYLLEQGGAKQKIIELLENVDATEIDVLKIRSKQIRELIFGTPFPSDLRDEI
                     FQAYETLSQQYHMKEADVAVRSSATAEDLPDASFAGQQDTYLNIKGKTELIHYIKSCL
                     ASLFTDRAISYRASRGFDHLKVALSVGVQKMVRADKGSAGVMFSIDTETGFKDAVFIT
                     SAWGLGENVVGGTINPDEFYVFKPTLEQNKRPIIKRQLGNKTQKMVYAPRGSEHPTRN
                     IKTTKKEWQSFSLSDEDVLILAKYAIEIEKHYSKEAKQYRPMDIEWAKDGDSGEIFIV
                     QARPETVQSQKTKEESQVFEKFKFKNPNEKKEIILQGRAIGSKIGSGKVRIINDLEHM
                     NSFKEGEILVTDNTDPDWEPCMKKASAVITNRGGRTCHAAIVAREIGVPAIVGVSGAT
                     DSLYTGMEITVSCAEGEEGYVYAGIYEHEIERVELSNMQETQTKIYINIGNPEKAFSF
                     SQLPNHGVGLARMEMIILNQIKAHPLALVDLHHKKSVKEKNEIENLMAGYANPKDFFV
                     KKIAEGIGMISAAFYPKPVIVRTSDFKSNEYMRMLGGSSYEPNEENPMLGYRGASRYY
                     SESYNEAFSWECEALALVREEMGLTNMKVMIPFLRTIEEGKKVLEILRKNNLESGKNG
                     LEIYIMCELPVNVILADDFLSLFDGFSIGSNDLTQLTLGVDRDSELVSHVFDERNEAM
                     LKMFKKAIEACKRHNKYCGICGQAPSDYPEVTEFLVKEGITSISLNPDSVIPTWNAVA
                     KLEKELKDHGLTAH"
     misc_feature    complement(119698..122109)
                     /locus_tag="HPSH112_00580"
                     /note="phosphoenolpyruvate synthase; Validated; Region:
                     PRK06464"
                     /db_xref="CDD:235809"
     misc_feature    complement(121063..122067)
                     /locus_tag="HPSH112_00580"
                     /note="Pyruvate phosphate dikinase, PEP/pyruvate binding
                     domain; Region: PPDK_N; pfam01326"
                     /db_xref="CDD:250534"
     misc_feature    complement(120727..120927)
                     /locus_tag="HPSH112_00580"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    complement(119707..120639)
                     /locus_tag="HPSH112_00580"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            122315..122428
                     /locus_tag="HPSH112_00585"
                     /db_xref="GeneID:12772899"
     CDS             122315..122428
                     /locus_tag="HPSH112_00585"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226846.1"
                     /db_xref="GI:386753628"
                     /db_xref="GeneID:12772899"
                     /translation="MNLFCMVFLQACLKPMSDPKAEKVDSQVQCGFGSKDC"
     gene            122470..124308
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /db_xref="GeneID:12772900"
     CDS             122470..124308
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /EC_number="6.1.1.3"
                     /note="COG0441 Threonyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="YP_006226847.1"
                     /db_xref="GI:386753629"
                     /db_xref="GeneID:12772900"
                     /translation="MSAELIAVYKDEQIIDLESAKVLGLSDGVKALNGTEPIYFDDSP
                     LALEVIRHSCAHLLAQSLKALYPDAKFFVGPVVEEGFYYDFKTASKISEEDLPKIEAK
                     MKEFAKLKLTITKEVLTREQALERFKGDELKHAVMSKISGDVFGVYQQGEFEDLCKGP
                     HLPNTRFLNHFKLTKLAGAYLGGDENNEMLIRIYGIAFATKEGLKDYLFQMEEAKKRD
                     HRKLGVELGLFSFDDEIGAGLPLWLPKGARLRKRIEDLLSKALLLRGYEPVKGPEILK
                     SDVWKISGHYDNYKENMYFTTIDEQEYGIKPMNCVGHIKVYQSALHSYRDLPLRFYEY
                     GVVHRHEKSGVLHGLLRVREFTQDDAHIFCSFEQIQSEVSAILDFTHKIMQAFDFSYE
                     MELSTRPAKSIGDDKVWEKATNALKEALKEHRIDYKIDEGGGAFYGPKIDIKITDALK
                     RKWQCGTIQVDMNLPERFKLAFTNEHNHAEQPVMIHRAILGSFERFIAILSEHFGGNF
                     PFFVAPTQIALIPINEEHRAFALKLKEELKKRDIFVEVLDKNDSLNKKVRLAEKQKIP
                     MILVLGNEEVGTEILSIRDREKQAQYKMPLKEFLNMVESKMQEVSF"
     misc_feature    122593..124305
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK12305"
                     /db_xref="CDD:237050"
     misc_feature    122908..123051
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; pfam07973"
                     /db_xref="CDD:254556"
     misc_feature    123121..124011
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    order(123130..123132,123169..123171,123322..123324,
                     123334..123336,123343..123348,123388..123390,
                     123484..123486,123490..123492,123496..123504,
                     123517..123525,123532..123534,123538..123540,
                     123820..123822,123829..123834,123844..123846,
                     123940..123945,123952..123954)
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    order(123142..123144,123160..123162,123166..123174,
                     123178..123180,123184..123186,123190..123195,
                     123199..123201,123208..123210,123253..123258,
                     123268..123273,123277..123279,123283..123291,
                     123295..123297,123349..123357,123361..123372,
                     123376..123378,123412..123417,123424..123432,
                     123436..123444,123481..123483,123487..123489,
                     123496..123498,123526..123531,123610..123612,
                     123733..123741,123886..123888,123892..123894)
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    123268..123291
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    123481..123492
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    123940..123954
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    124009..124281
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    order(124033..124038,124141..124143,124159..124161,
                     124183..124185,124213..124215,124219..124221)
                     /gene="thrS"
                     /locus_tag="HPSH112_00590"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            124305..124916
                     /gene="infC"
                     /locus_tag="HPSH112_00595"
                     /db_xref="GeneID:12772901"
     CDS             124305..124916
                     /gene="infC"
                     /locus_tag="HPSH112_00595"
                     /note="COG0290 Translation initiation factor 3 (IF-3)"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="YP_006226848.1"
                     /db_xref="GI:386753630"
                     /db_xref="GeneID:12772901"
                     /translation="MSRNEVLLNGDINFKEVRCVGDNGEVYGIISSKEALNIAQNLGL
                     DLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQKQIEIKEIKLSTQIAQNDINY
                     KVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQDLANPEKEPKTEGR
                     FVSWMFVPKAKETPKNEKKTKENNPPFNRINLMKGENHAKNED"
     misc_feature    124311..124511
                     /gene="infC"
                     /locus_tag="HPSH112_00595"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    124326..124817
                     /gene="infC"
                     /locus_tag="HPSH112_00595"
                     /note="translation initiation factor IF-3; Region: infC;
                     TIGR00168"
                     /db_xref="CDD:129272"
     misc_feature    124575..124814
                     /gene="infC"
                     /locus_tag="HPSH112_00595"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            124897..125091
                     /gene="rpmI"
                     /locus_tag="HPSH112_00600"
                     /db_xref="GeneID:12772902"
     CDS             124897..125091
                     /gene="rpmI"
                     /locus_tag="HPSH112_00600"
                     /note="COG0291 Ribosomal protein L35"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="YP_006226849.1"
                     /db_xref="GI:386753631"
                     /db_xref="GeneID:12772902"
                     /translation="MPKMKTNRGASKRFKVKKNLIKRGSAFKSHILTKKSPKRKANLN
                     APKHVHHTNAHSVMSLLCRA"
     misc_feature    124897..125088
                     /gene="rpmI"
                     /locus_tag="HPSH112_00600"
                     /note="50S ribosomal protein L35; Reviewed; Region: rpmI;
                     PRK00172"
                     /db_xref="CDD:234676"
     gene            125186..125536
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /db_xref="GeneID:12772903"
     CDS             125186..125536
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /note="COG0292 Ribosomal protein L20"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="YP_006226850.1"
                     /db_xref="GI:386753632"
                     /db_xref="GeneID:12772903"
                     /translation="MRVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYY
                     AFRDRKQKKREFRSLWVVRINAACRMHNTSYSRFMHALKVAGVELDRKVLADMAMNDM
                     QAFESVLESVKEHL"
     misc_feature    125201..125515
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /note="Ribosomal protein L20; Region: Ribosomal_L20;
                     cd07026"
                     /db_xref="CDD:197305"
     misc_feature    order(125201..125215,125219..125230,125243..125266,
                     125270..125281,125288..125293,125303..125308,
                     125315..125359,125363..125371,125378..125380,
                     125390..125392,125408..125413,125420..125425,
                     125432..125434,125456..125464)
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:197305"
     misc_feature    order(125288..125290,125300..125302,125309..125314,
                     125318..125323,125330..125332,125447..125458,
                     125465..125467,125483..125488,125504..125509)
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /note="L21 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     misc_feature    order(125351..125353,125360..125365,125372..125374,
                     125381..125386,125390..125392,125462..125464,
                     125471..125473,125480..125482)
                     /gene="rplT"
                     /locus_tag="HPSH112_00605"
                     /note="L13 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     gene            125737..126597
                     /locus_tag="HPSH112_00610"
                     /db_xref="GeneID:12772904"
     CDS             125737..126597
                     /locus_tag="HPSH112_00610"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein HorB"
                     /protein_id="YP_006226851.1"
                     /db_xref="GI:386753633"
                     /db_xref="GeneID:12772904"
                     /translation="MKKSVIVGAISLAMTSLLSAETPKQEKAIKTSPTKKGERNAAFI
                     GIDYQLGMLSTTAQNCSHGNCNGNQSGAYGSNTPNMPTASNPTGGLTHGVLGTRGYKG
                     LSNQQYAINGFGFVVGYKHFFKKSPQFGMRYYGFFDFASSYYKYYTYNDYGMRDARKG
                     SQSFMFGYGAGTDVLFNPAIFNRENLHFGFFVGVAIGGTSWGPTNYYFKDLADEYRGS
                     FHPSNFQVLVNGGIRLGTKHQGFEIGLKIQTIRNNYYTASADNVPEGVTYKFTFHRPY
                     AFYWRYIVSF"
     misc_feature    126076..126594
                     /locus_tag="HPSH112_00610"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            126649..126774
                     /locus_tag="HPSH112_00615"
                     /db_xref="GeneID:12772905"
     CDS             126649..126774
                     /locus_tag="HPSH112_00615"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226852.1"
                     /db_xref="GI:386753634"
                     /db_xref="GeneID:12772905"
                     /translation="MAFYGFLASKALKNQYGYLAKIKAQSLQAIELTNNSTQTSL"
     gene            126950..127381
                     /locus_tag="HPSH112_00620"
                     /db_xref="GeneID:12772906"
     CDS             126950..127381
                     /locus_tag="HPSH112_00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226853.1"
                     /db_xref="GI:386753635"
                     /db_xref="GeneID:12772906"
                     /translation="MKKLAFSLLFTGTFLGLFLNASDFKSMDDKQLLEQAGKVAPSEV
                     PEFRAEINKRLAVMKEEERKSYKADFKKAMDKNLASLSQEDRNKRKKEILEAIANKKK
                     TMTMKEYRQEGLDLHDCACEGPFHDHEKKGRKGKQSSHHKH"
     misc_feature    127013..127291
                     /locus_tag="HPSH112_00620"
                     /note="Protein of unknown function (DUF1104); Region:
                     DUF1104; pfam06518"
                     /db_xref="CDD:203471"
     gene            127788..128657
                     /locus_tag="HPSH112_00625"
                     /db_xref="GeneID:12772907"
     CDS             127788..128657
                     /locus_tag="HPSH112_00625"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226854.1"
                     /db_xref="GI:386753636"
                     /db_xref="GeneID:12772907"
                     /translation="MKRILFFLVATAFLLRAETDSATINTTIDPNVMFSESSTGNVKK
                     DRKRVLKSMVNLEKERVKNFNQYSETKMSKGDLSAFGAFFKGSLESCVDQKICYYEHK
                     NGKVSFVVNDREKFYKHVLKDLGTELSLPLFNWLYKGSDFGALHEQFGDMYDGYIKYL
                     ISMVRVSQKEKTRKLDAVTLKKMEDQAEKDTKAAFQKRSNGELESHTDSPEFISSSKK
                     TQNASNPDLDSTTNANALKEIASKEPEISSKKEEKSKKKRRLSKKERQQQALQQEFER
                     QISDSSKSENIAK"
     gene            complement(129267..130634)
                     /locus_tag="HPSH112_00630"
                     /db_xref="GeneID:12772908"
     CDS             complement(129267..130634)
                     /locus_tag="HPSH112_00630"
                     /note="COG1760 L-serine deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-serine deaminase"
                     /protein_id="YP_006226855.1"
                     /db_xref="GI:386753637"
                     /db_xref="GeneID:12772908"
                     /translation="MASFSILSIFKIGVGPSSSHTIGPMEAGARFCGLLKGVLEQVMR
                     VQITLHGSLALTGKGHLSDEAVLIGLHGIYANELEVTTKKALLHEALENKVLKLANQH
                     CIHFDYSKDLIFDNKPLARHQNALILKAFNSKNEVLKEETYYSVGGGFVYTEKELDNL
                     SEEGENESVAYDFSSAKELLELCQKHQKNIAEIVRLREDALKNRPDAMMAKIYHAMFE
                     CYDNGANSKEKYLPGSLRVTRLAPSIKTRLEKHPTSGKDPLALIDYISLYARAIAEEN
                     ASGGKVVTAPTNGACAVVPSVLLYAKNHLFENLSQKAINDFLLTSAAIGYLYKKNASL
                     SGAEAGCQAEIGVASSMAAGGLACLCQATTQQVLIASEIAMEHHLGLTCDPVGGLVQI
                     PCIERNVLGAIKAISASKLALEDEYKPKVSLDEVIATMYATGKDMNEKYKETSLGGLA
                     KTLKC"
     misc_feature    complement(129276..130625)
                     /locus_tag="HPSH112_00630"
                     /note="L-serine dehydratase, iron-sulfur-dependent, single
                     chain form; Region: sda_mono; TIGR00720"
                     /db_xref="CDD:188076"
     misc_feature    complement(130158..130601)
                     /locus_tag="HPSH112_00630"
                     /note="Serine dehydratase beta chain; Region: SDH_beta;
                     pfam03315"
                     /db_xref="CDD:251868"
     misc_feature    complement(129279..130085)
                     /locus_tag="HPSH112_00630"
                     /note="Serine dehydratase alpha chain; Region: SDH_alpha;
                     pfam03313"
                     /db_xref="CDD:251866"
     gene            complement(130634..131875)
                     /locus_tag="HPSH112_00635"
                     /db_xref="GeneID:12772909"
     CDS             complement(130634..131875)
                     /locus_tag="HPSH112_00635"
                     /note="COG0814 Amino acid permeases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226856.1"
                     /db_xref="GI:386753638"
                     /db_xref="GeneID:12772909"
                     /translation="MAQEKALIRDPKKLNAFDLRWMASLFGTAVGAGILFLPIRAGGH
                     GIWAIVVMSAIIFPLTYLGHRALAYFIGSKDKEDITMVVRSHFGAQWGFLITLLYFFA
                     IYPICLAYGVGITNVFDHFFTNQLHLAPFHRGLLAVALVSLMMLVMVFNATIVTRICN
                     ALVYPLCLILLLFSLYLIPYWQGANLFVVPSFKEFVLAIWLTLPVLVFSFNHSPIIST
                     FTQNVEKEYGAFKEYKLNQIELGTSLMLLGFVMFFVFSCVMCLNADDFVKAREQNIPI
                     LSYFANTLNNPLINYAGPVVAFLAIFSSFFGHYYGAKEGLEGIIIQSLKLKKTSKTLS
                     VSVTIFLWLTITLVAYINPNILDFIENLGGPIIALILFVMPMIAFYSISSLKRFRNLK
                     VDIFVFVFGSLTALSVFLGLF"
     misc_feature    complement(130637..131851)
                     /locus_tag="HPSH112_00635"
                     /note="Amino acid permeases [Amino acid transport and
                     metabolism]; Region: SdaC; COG0814"
                     /db_xref="CDD:223884"
     misc_feature    complement(130667..131833)
                     /locus_tag="HPSH112_00635"
                     /note="serine transporter; Region: stp; TIGR00814"
                     /db_xref="CDD:233139"
     gene            131938..132030
                     /locus_tag="HPSH112_00640"
                     /db_xref="GeneID:12772910"
     CDS             131938..132030
                     /locus_tag="HPSH112_00640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226857.1"
                     /db_xref="GI:386753639"
                     /db_xref="GeneID:12772910"
                     /translation="MGFFEIRGVVFSAHLFPKIHDLTRTSYNNA"
     gene            132057..133406
                     /locus_tag="HPSH112_00645"
                     /db_xref="GeneID:12772911"
     CDS             132057..133406
                     /locus_tag="HPSH112_00645"
                     /note="COG3200 3-deoxy-D-arabino-heptulosonate 7-phosphate
                     (DAHP) synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
                     /protein_id="YP_006226858.1"
                     /db_xref="GI:386753640"
                     /db_xref="GeneID:12772911"
                     /translation="MSNTTWSPASWHSFKIEQHPTYKDKQELERVKKELRSYPPLVFA
                     GEARNLQERLAQVIDNKAFLLQGGDCAESFSQFSANRIKDMFKVMMQMAIVLTFAGSI
                     PIVKVGRIAGQFAKPRSNATEILDNEEVLSYRGDIINGISKKEREPNPERMLKAYHQS
                     VATLNLIRAFAQGGLANLEQVHRFNLDFVKNNDFGKKYQQIADRITQALGFMQACGVE
                     IEKTPILREVEFYTSHEALLLHYEEPLVRKDSLTDQFYDCSAHMLWIGERTRDPKGAH
                     VEFLRGVCNPIGVKIGPNASVSEVLELCDVLNPCNIKGRLNLIVRMGSKMIKERLPKL
                     LQGVLKEKRHILWSIDPMHGNTVKTSLGVKTRAFDSVLDEVKSFFEIHRAEGSLASGV
                     HLEMTGENVTECIGGSQAITEEGLSCHYYTQCDPRLNATQALELAFLIADMLKKQRA"
     misc_feature    132060..133394
                     /locus_tag="HPSH112_00645"
                     /note="3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP)
                     synthase [Amino acid transport and metabolism]; Region:
                     AroG; COG3200"
                     /db_xref="CDD:225741"
     gene            133485..133619
                     /locus_tag="HPSH112_00650"
                     /db_xref="GeneID:12772912"
     CDS             133485..133619
                     /locus_tag="HPSH112_00650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226859.1"
                     /db_xref="GI:386753641"
                     /db_xref="GeneID:12772912"
                     /translation="MRISLLAVILALLFVACRETKQQILQNEADSTPSEKTIWQPEQK
                     "
     gene            133721..133873
                     /locus_tag="HPSH112_00655"
                     /db_xref="GeneID:12772913"
     CDS             133721..133873
                     /locus_tag="HPSH112_00655"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226860.1"
                     /db_xref="GI:386753642"
                     /db_xref="GeneID:12772913"
                     /translation="MIPKHSLSLMKFVIKQNLKKQFFKSERMAKNLKLKWAKARELNY
                     KLSKTF"
     gene            complement(133849..134307)
                     /locus_tag="HPSH112_00660"
                     /db_xref="GeneID:12772914"
     CDS             complement(133849..134307)
                     /locus_tag="HPSH112_00660"
                     /note="COG1225 Peroxiredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="bacterioferritin comigratory protein"
                     /protein_id="YP_006226861.1"
                     /db_xref="GI:386753643"
                     /db_xref="GeneID:12772914"
                     /translation="MEKLEVGQLAPDFRLKNSDGVEISLKDLLHKKVVLYFYPKDNTP
                     GCTLEAKDFSDLFSEFEKKNAVVVGVSPDNAQSHQKFISQCSLNVILLCDEDKKAANL
                     YKAYGKRMLYGKEHLGIIRSTFIINTQGVLEKCFYNVKAKGHAQKVLESL"
     misc_feature    complement(<133912..134292)
                     /locus_tag="HPSH112_00660"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    complement(133858..134280)
                     /locus_tag="HPSH112_00660"
                     /note="Peroxiredoxin (PRX) family, Bacterioferritin
                     comigratory protein (BCP) subfamily; composed of
                     thioredoxin-dependent thiol peroxidases, widely expressed
                     in pathogenic bacteria, that protect cells against
                     toxicity from reactive oxygen species by reducing...;
                     Region: PRX_BCP; cd03017"
                     /db_xref="CDD:239315"
     misc_feature    complement(order(133945..133947,134170..134172,
                     134179..134181))
                     /locus_tag="HPSH112_00660"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:239315"
     gene            complement(134317..134952)
                     /locus_tag="HPSH112_00665"
                     /db_xref="GeneID:12772915"
     CDS             complement(134317..134952)
                     /locus_tag="HPSH112_00665"
                     /note="COG1556 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226862.1"
                     /db_xref="GI:386753644"
                     /db_xref="GeneID:12772915"
                     /translation="MSKELILKRIKEARAKHAIQGANPAYRNIIKVEFEDLVEEYKHF
                     QVLNKAEVIESAKENLEQAILKALENFKSKKVLHSTDLNLNFEAFKDFTLQPYDKEIE
                     AMREELFEIDTALLHGVCGISSLGMIGAVSSHASPRLLSLITLNCIILLKKESIVRNL
                     SEGMQALKNQSKNGVLPTNMLLIGGPSRTADIELKTVFGVHGPQKVAIILY"
     misc_feature    complement(134320..134952)
                     /locus_tag="HPSH112_00665"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1556"
                     /db_xref="CDD:224473"
     gene            complement(134945..136390)
                     /locus_tag="HPSH112_00670"
                     /db_xref="GeneID:12772916"
     CDS             complement(134945..136390)
                     /locus_tag="HPSH112_00670"
                     /note="COG1139 Uncharacterized conserved protein
                     containing a ferredoxin-like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster binding protein"
                     /protein_id="YP_006226863.1"
                     /db_xref="GI:386753645"
                     /db_xref="GeneID:12772916"
                     /translation="MEKYHSDQEYEEIITDQLGDMQLRENLRSAMDTLRANRKNLIKN
                     RYSEWENLRELGKEVKLKILSRLDEYLELFEKNATQNGFKIHYAKDGDEANEIIYNLA
                     KEKNIKRILKQKSMASEEIGLNHYLKEKGIQAQETDLGELIIQLINEHPVHIVVPAIH
                     KNRKQIGKIFEEKLNAAYEEEPEKLNAIARKHMRKEFESFKMGISGVNFAIANEGAIW
                     LVENEGNGRMSTTACDVHVAICGIEKLVESFDDAAILNNLLAPSAVGVPITCYQNIIT
                     GPRKEGDLDGPKEAHIILLDNNRSNILADEKYYRALSCIRCGTCLNHCPVYDKIGGHA
                     YLSTYPGPIGVVVSPQLFGLNNYGHIPNLCSLCGRCTEVCPVEIPLAELIRDLRSDKV
                     GEGRGVVKGAKSTQHGGMEKFSMKMFAKMASDGAKWRFQLKMAQFFSPLGKLLAPILP
                     LVKEWASVRTLPNMDTSLHAKVQHLEGVIYE"
     misc_feature    complement(135005..136339)
                     /locus_tag="HPSH112_00670"
                     /note="iron-sulfur cluster-binding protein; Region:
                     TIGR00273"
                     /db_xref="CDD:129374"
     misc_feature    complement(135506..136180)
                     /locus_tag="HPSH112_00670"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; pfam02589"
                     /db_xref="CDD:251397"
     misc_feature    complement(135257..135460)
                     /locus_tag="HPSH112_00670"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    complement(134951..135235)
                     /locus_tag="HPSH112_00670"
                     /note="Domain of unknown function (DUF3390); Region:
                     DUF3390; pfam11870"
                     /db_xref="CDD:256687"
     gene            complement(136419..137147)
                     /locus_tag="HPSH112_00675"
                     /db_xref="GeneID:12772917"
     CDS             complement(136419..137147)
                     /locus_tag="HPSH112_00675"
                     /note="COG0247 Fe-S oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226864.1"
                     /db_xref="GI:386753646"
                     /db_xref="GeneID:12772917"
                     /translation="MKVNFFATCLGAAIYSNASLNAIKLLRKENLEVVFKKDQTCCGQ
                     PSYNSGYYEETKKVVLYNIKLYSNNDYPIILPSGSCTGMMRHDYLELFEGHAEFNMVK
                     DFCSRVYELSEFLDKKLQVKYEDKGEPLKITWHSNCHALRVAKVIDSAKNLIRQLKNV
                     ELIELEKEEECCGFGGTFSVKEPEISAVMVKEKIKDIESRQVDVIVSADAGCLMNIST
                     AMQKMGSPTKPMHFYDFLASRLGL"
     misc_feature    complement(136422..>137147)
                     /locus_tag="HPSH112_00675"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     misc_feature    complement(136893..137141)
                     /locus_tag="HPSH112_00675"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     misc_feature    complement(136497..136754)
                     /locus_tag="HPSH112_00675"
                     /note="Cysteine-rich domain; Region: CCG; pfam02754"
                     /db_xref="CDD:202376"
     gene            137368..139017
                     /locus_tag="HPSH112_00680"
                     /db_xref="GeneID:12772918"
     CDS             137368..139017
                     /locus_tag="HPSH112_00680"
                     /note="COG1620 L-lactate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="YP_006226865.1"
                     /db_xref="GI:386753647"
                     /db_xref="GeneID:12772918"
                     /translation="MEFYQVYDPLGNIWLSALVALSPIVLFFISLIVFKLKGYSAGFL
                     SLVLSIIIALFVYKMPAQMVSASFFYGFLYGLWPIAWIVIAAIFLYNLSVKSGYFEIL
                     KESILTLTPDHRILVILIGFCFGSFLEGAIGFGGPVAITAAILVGLGLNPLYAAGLCL
                     IANTAPVAFGAVGIPITAMASVVGIPELEISQMVGRVLPIFSIGIPFFIVFLMDGFKG
                     IRETFPAVAVTGFSFAIAQFLSSNYLGPQLPDIISALVSLIATTLFLKFWQPKRIFTS
                     NGKEPAISTEKHHICKVVVAWMPFVLLTITIIIWTQPWFKALFKEGGALAFSSFAFEF
                     NSISQKIFKTVPIVTEATNFPVVFKFPLILTTGTSIFLAALLSVFLLRVKISDAIGVF
                     GATLKEMRLPILTIGVVLAFAYVANYSGMSATLALALADTGHVFTFFSPVVGWLGVFL
                     TGSDTSSNLLFGSLQMLIATQLGLPEVLFLAANTSGGVVGKMISPQSIAIACAAVGLV
                     GKESELFRFTVKYSIALAIIMGIVFTLIAYVFPFIIPVTPT"
     misc_feature    137377..138981
                     /locus_tag="HPSH112_00680"
                     /note="L-lactate transport; Region: lctP; TIGR00795"
                     /db_xref="CDD:162041"
     gene            139066..140721
                     /locus_tag="HPSH112_00685"
                     /db_xref="GeneID:12772919"
     CDS             139066..140721
                     /locus_tag="HPSH112_00685"
                     /note="COG1620 L-lactate permease"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="YP_006226866.1"
                     /db_xref="GI:386753648"
                     /db_xref="GeneID:12772919"
                     /translation="MSEFHQVYDPLGNIWLSALVALLPILLFFLSLMVFKLKGYAAAF
                     LSVVLSAIIAVLVYKMPVSMVGSSFLYGFLYGLWPIAWIIIAAIFLYKLSVKSGYFEI
                     LKESVQSITLDHRILVILIGFCFGSFLEGAIGFGGPIAITAAILVGLGLSPLYAAGLC
                     LIANTAPVAFGAVGIPISAMASAVGVPAILISAMTGKILFFVSLFVPFFIVFLMDGFK
                     GIKETFPAVFIAAFSFAIAQFLSSNYLGPELPGIISALVSLVATALFLKFWQPKVIFR
                     SDGKAASFTKSNHHICKIYVAWSPFVILVLVIVLWIQPFFKALFEKDGLLAFSNFYFE
                     FNNISNHIFKSPPFVESDQSASFPVVFKFSLINTVGTSIFLAALISILVLRVRVSDAL
                     SVFGETLKEMRYPILTIGLVLSFAYVSNYSGISSTLALALTHTGLAFTFFSPLIGWVG
                     VFLTGSDTSSNLLFGSLQQLTAQRLHLPEILTLTANTVGGTLGKMISPQSIAIACAAV
                     GLAGKESNLFKFTVKYSLIFVAIMGVVISAIAYLIPEVVPAIK"
     misc_feature    139078..140688
                     /locus_tag="HPSH112_00685"
                     /note="L-lactate transport; Region: lctP; TIGR00795"
                     /db_xref="CDD:162041"
     gene            complement(140745..141614)
                     /locus_tag="HPSH112_00690"
                     /db_xref="GeneID:12772920"
     CDS             complement(140745..141614)
                     /locus_tag="HPSH112_00690"
                     /note="COG1194 A/G-specific DNA glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA glycosylase MutY"
                     /protein_id="YP_006226867.1"
                     /db_xref="GI:386753649"
                     /db_xref="GeneID:12772920"
                     /translation="MSQQTQISTVVKRFYSPFLEAFPTLKDLASAQLEEVLLLWRGLG
                     YYSRAKNLKKSAEICVKEHNSQLPNDYQSLLKLPGIGTYTANAILCFGFREKSACVDA
                     NIKRVLLRLFGLDPNITAKDLQIKANDFLNLNESFNHNQALIDLGALICSPKPKCAIC
                     PLNPYCLGKNHPEKHTLKKKQEIIQEEHYLGVVIQNNQIALEKIEQKLYFGMHHFPNL
                     KENLEYKLPFLGAIKHSHTKFKLNLNLYLAAIKDLKNPIRFYSLKDLETLPISSMTLK
                     ILNFLKQKNLFGG"
     misc_feature    complement(140748..141614)
                     /locus_tag="HPSH112_00690"
                     /note="DNA glycosylase MutY; Provisional; Region:
                     PRK13910"
                     /db_xref="CDD:172427"
     misc_feature    complement(141174..141614)
                     /locus_tag="HPSH112_00690"
                     /note="endonuclease III; includes endonuclease III
                     (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA
                     glycosidases (Alka-family) and other DNA glycosidases;
                     Region: ENDO3c; cd00056"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(141471..141473,141588..141590,
                     141597..141605))
                     /locus_tag="HPSH112_00690"
                     /note="minor groove reading motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(141363..141386)
                     /locus_tag="HPSH112_00690"
                     /note="helix-hairpin-helix signature motif; other site"
                     /db_xref="CDD:238013"
     misc_feature    complement(order(141183..141185,141195..141197,
                     141354..141356))
                     /locus_tag="HPSH112_00690"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238013"
     misc_feature    complement(141312..141314)
                     /locus_tag="HPSH112_00690"
                     /note="active site"
                     /db_xref="CDD:238013"
     misc_feature    complement(140781..141050)
                     /locus_tag="HPSH112_00690"
                     /note="NUDIX domain; Region: NUDIX_4; pfam14815"
                     /db_xref="CDD:258952"
     gene            complement(141732..143180)
                     /locus_tag="HPSH112_00695"
                     /db_xref="GeneID:12772921"
     CDS             complement(141732..143180)
                     /locus_tag="HPSH112_00695"
                     /note="COG0471 Di- and tricarboxylate transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="C(4)-dicarboxylates and
                     tricarboxylates/succinate antiporter"
                     /protein_id="YP_006226868.1"
                     /db_xref="GI:386753650"
                     /db_xref="GeneID:12772921"
                     /translation="MIKQILSILAPFFIATLLYFLGAPDGLNPNAWLYFCIFMGMIIG
                     LVLEPVPPGLVALSALVLCVALKIGASDEVASANKAISWGLSGYANKTVWLVFVAFIL
                     GLGYEKSLLGKRIALLLIRFLGQTPLGLGYAIGLSELCLAPFIPSNSARSGGILYPIV
                     SSIPPLMGSAPNDNPDKIGAYLMWVALASTCITSSMFLTALAPNPLAMEIATKMGVNE
                     ISWFSWFLAFLPCGVVLILLAPLLAYKTCKPTLKGSKEVSLWAKKELEGMGRFSLKEI
                     LMLSLTLLALLGWIFSKPLGLAASATALIVMVLMAFCKIVSYEDIIKNKSAFNIFLLL
                     GSLLTMAGGLKNVGFLNFIGNAAKNFLEHANLDPLIAVLFIIAFFYLSHYFFASITAH
                     VSALFALFVGIGSHIQGVNLQELSLFLMLSLGIMGILTPYGTGPSTIYYGSGYISSKD
                     FWKWGFIFGMVYLIVFLSVCVPWVKFIAYRWL"
     misc_feature    complement(141741..143177)
                     /locus_tag="HPSH112_00695"
                     /note="Sodium:sulfate symporter transmembrane region;
                     Region: Na_sulph_symp; pfam00939"
                     /db_xref="CDD:250243"
     misc_feature    complement(141759..143117)
                     /locus_tag="HPSH112_00695"
                     /note="anion transporter; Region: dass; TIGR00785"
                     /db_xref="CDD:233126"
     misc_feature    complement(order(141786..141815,141903..141905,
                     141906..141959,142020..142067,142149..142199,
                     142203..142208,142251..142295,142311..142349,
                     142464..142508,142572..142607,142611..142646,
                     142677..142721,142725..142733,142737..142742,
                     142746..142790,142860..142913,142986..143027,
                     143046..143057))
                     /locus_tag="HPSH112_00695"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            143350..144816
                     /locus_tag="HPSH112_00700"
                     /db_xref="GeneID:12772922"
     CDS             143350..144816
                     /locus_tag="HPSH112_00700"
                     /note="COG3278 Cbb3-type cytochrome oxidase, subunit 1"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit I"
                     /protein_id="YP_006226869.1"
                     /db_xref="GI:386753651"
                     /db_xref="GeneID:12772922"
                     /translation="MQENVPLSYDYSISKLFLYAMVGFGIIGMLIGIVLAFELSFPNL
                     NYIAGEYGVFGRLRPLHTNAVIYGFTLGGIWASWYYIGQRVLKITYHQHPFLKIVGLL
                     HFWLWITLLILGVISLFAGLTQSKEYAELMWPLDIVVVVAWVLWGVNMFGSMSVRREN
                     TIYVSLWYYIATYVGIAVMYIFNNLSIPTYFVADMGSVWHSISMYSGSNDALIQWWWG
                     HNAVAFVFTSGVIGTIYYFLPKESGQPIFSYKLTLFSFWSLMFVYIWAGGHHLIYSTV
                     PDWVQTLSSVFSVVLILPSWGTAINMLLTMRGQWHQLKESPLIKFLVLASTFYMLSTL
                     EGSIQAIKSVNALAHFTDWIIGHVHDGVLGWVGFTLIASMYHMTTRLFKREIYSGRLV
                     DFQFWIMTLGIVLYFSSMWIAGITQGMMWRDVDQYGNLTYQFIDTVKVLIPYYNIRGV
                     GGLMYFTGFIIFAYNIFMTITAGKKLEREPNYATPMSR"
     misc_feature    143353..144789
                     /locus_tag="HPSH112_00700"
                     /note="cbb3-type cytochrome c oxidase subunit I;
                     Provisional; Region: PRK14488"
                     /db_xref="CDD:237726"
     misc_feature    order(143374..143376,143395..143397,143407..143412,
                     143422..143424,143578..143580,144403..144405,
                     144424..144426,144433..144438,144610..144615,
                     144697..144699)
                     /locus_tag="HPSH112_00700"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238461"
     misc_feature    143386..144711
                     /locus_tag="HPSH112_00700"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    order(143452..143454,143461..143463,143485..143487,
                     143494..143496,143686..143691,143707..143709,
                     143719..143721)
                     /locus_tag="HPSH112_00700"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    order(143965..143967,143980..143985,144382..144384,
                     144394..144399,144610..144612)
                     /locus_tag="HPSH112_00700"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    order(144004..144006,144154..144159,144418..144420)
                     /locus_tag="HPSH112_00700"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238461"
     misc_feature    order(144004..144006,144016..144018,144049..144051,
                     144154..144159,144232..144234,144241..144243)
                     /locus_tag="HPSH112_00700"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238461"
     misc_feature    order(144157..144159,144394..144399,144610..144615)
                     /locus_tag="HPSH112_00700"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238461"
     gene            144829..145527
                     /locus_tag="HPSH112_00705"
                     /db_xref="GeneID:12772923"
     CDS             144829..145527
                     /locus_tag="HPSH112_00705"
                     /note="COG2993 Cbb3-type cytochrome oxidase, cytochrome c
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit II"
                     /protein_id="YP_006226870.1"
                     /db_xref="GI:386753652"
                     /db_xref="GeneID:12772923"
                     /translation="MFSFLEKNPFFFTLAFIFVFAIAGLVEILPNFFKSARPIEGLRP
                     YTVLETAGRQIYIKEGCYHCHSQLIRPFQAEVDRYGAYSLSGEYAYDRPFLWGSKRIG
                     PDLHRVGDYRTTDWHEKHMFDPKSVVPHSIMPAYKHLFAKKSDFDTAYAEALTQKKVF
                     GVPYDTENGVKLGSVEEAKKAYLEEAKKITADMKDKRVLEAIERGEVLEIVALIAYLN
                     SLGNSRINANQNAK"
     misc_feature    144832..145524
                     /locus_tag="HPSH112_00705"
                     /note="cytochrome c oxidase, cbb3-type, subunit II;
                     Region: ccoO; TIGR00781"
                     /db_xref="CDD:129863"
     gene            145538..145756
                     /locus_tag="HPSH112_00710"
                     /db_xref="GeneID:12772924"
     CDS             145538..145756
                     /locus_tag="HPSH112_00710"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type, CcoQ subunit"
                     /protein_id="YP_006226871.1"
                     /db_xref="GI:386753653"
                     /db_xref="GeneID:12772924"
                     /translation="MDLESVRGFAYAFFTILFTLFLYAYIFSMYRKQKKGIMDYERYG
                     RLALNDALEDELIEPRHKNAHDNGIKES"
     misc_feature    145559..145726
                     /locus_tag="HPSH112_00710"
                     /note="cytochrome c oxidase, cbb3-type, CcoQ subunit,
                     epsilon-Proteobacterial; Region: cbb3_Q_epsi; TIGR02736"
                     /db_xref="CDD:131783"
     gene            145758..146636
                     /locus_tag="HPSH112_00715"
                     /db_xref="GeneID:12772925"
     CDS             145758..146636
                     /locus_tag="HPSH112_00715"
                     /note="COG2010 Cytochrome c, mono- and diheme variants"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase, cbb3-type subunit III"
                     /protein_id="YP_006226872.1"
                     /db_xref="GI:386753654"
                     /db_xref="GeneID:12772925"
                     /translation="MDFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELM
                     DNGHLIDGIGEFANNVPVGWIASYMCTIVWAFWYFFFGYPLNSFSQIGQYNEEVKAHN
                     QKFEAKWKNLGQKELVDMGQGIFLVHCSQCHGISAEGLHGSAQNLVHWGKEEGIMDTI
                     KHGSKGMDYLAGEMPAMELDEKDAKAIASYVMAEISSVKKTKNPQLIDKGKELFESMG
                     CTGCHGNDGKGLQENQVFAADLTTYGTENFLRNILTHGKKGNIGHMPSFKYKNFSDLQ
                     VKALAEFIQSLKPLED"
     misc_feature    145860..146618
                     /locus_tag="HPSH112_00715"
                     /note="cytochrome c oxidase, cbb3-type, subunit III;
                     Region: ccoP; TIGR00782"
                     /db_xref="CDD:129864"
     misc_feature    145872..146030
                     /locus_tag="HPSH112_00715"
                     /note="N-terminal domain of cytochrome oxidase-cbb3, FixP;
                     Region: FixP_N; pfam14715"
                     /db_xref="CDD:258852"
     misc_feature    146109..146333
                     /locus_tag="HPSH112_00715"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     misc_feature    146376..146621
                     /locus_tag="HPSH112_00715"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            146647..146853
                     /locus_tag="HPSH112_00720"
                     /db_xref="GeneID:12772926"
     CDS             146647..146853
                     /locus_tag="HPSH112_00720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226873.1"
                     /db_xref="GI:386753655"
                     /db_xref="GeneID:12772926"
                     /translation="MKFLNGLAGNLLIVVILLCVAVFFTFKAIHIQKEQATNYYRYKD
                     INALETKNTQNRANYELVNQGSKK"
     misc_feature    146656..146826
                     /locus_tag="HPSH112_00720"
                     /note="Family of unknown function (DUF4006); Region:
                     DUF4006; pfam13179"
                     /db_xref="CDD:257547"
     gene            146850..146957
                     /locus_tag="HPSH112_00725"
                     /db_xref="GeneID:12772927"
     CDS             146850..146957
                     /locus_tag="HPSH112_00725"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226874.1"
                     /db_xref="GI:386753656"
                     /db_xref="GeneID:12772927"
                     /translation="MKFTTLEKILALMVVATILMTIVISFVPNLFLFST"
     gene            146954..147538
                     /locus_tag="HPSH112_00730"
                     /db_xref="GeneID:12772928"
     CDS             146954..147538
                     /locus_tag="HPSH112_00730"
                     /note="COG0443 Molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226875.1"
                     /db_xref="GI:386753657"
                     /db_xref="GeneID:12772928"
                     /translation="MRILWLVIAFVCCLGASDYVFNNSKGRLVEKSVAFVEGVSKELY
                     LKTGVRFVIDMTDFEKNPIVLALKNERQNYQEGFLKQLKPPFVVFFFYHDAQKIELVA
                     NPKDLLDTDKIFFEKIAPLLPTNPKEYTPQRISAMLINGYSVAVDALAQKYRVNITQN
                     FNAPKGATFVKVVIYILLLTLLGAFLGLYFFKKS"
     misc_feature    <147104..147364
                     /locus_tag="HPSH112_00730"
                     /note="Rat sarcoma (Ras)-like superfamily of small
                     guanosine triphosphatases (GTPases); Region:
                     Ras_like_GTPase; cl17170"
                     /db_xref="CDD:266525"
     misc_feature    147260..147271
                     /locus_tag="HPSH112_00730"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    147356..147364
                     /locus_tag="HPSH112_00730"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     gene            147550..148131
                     /locus_tag="HPSH112_00735"
                     /db_xref="GeneID:12772929"
     CDS             147550..148131
                     /locus_tag="HPSH112_00735"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226876.1"
                     /db_xref="GI:386753658"
                     /db_xref="GeneID:12772929"
                     /translation="MKEKNFWPLGIMSVLILGLGIVVFLVVFALKNSPKNDLVYFKGH
                     NEVDLNFNAMFKTYENFKSNYRFLVGLKPLTEGSKTPILPYFSKGTHGDKKLQENLLK
                     NALILEKSNTLHAQLQPLKPALDSPNIQVYLAFYPSPSQPRLLGTLDCEIACEPLKFD
                     LLESDKRGRYKILFKFVFKNKEELILEQLAFFK"
     gene            148219..148986
                     /locus_tag="HPSH112_00740"
                     /db_xref="GeneID:12772930"
     CDS             148219..148986
                     /locus_tag="HPSH112_00740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226877.1"
                     /db_xref="GI:386753659"
                     /db_xref="GeneID:12772930"
                     /translation="MGFLKVFKHDALGQVGNVVVGNFLITLTILAVCFYSQSAEETTM
                     LTLSYTLFFVLGAFLLIAISVGAIKNLNALFSKRGVLSFSLPISLESLLLPKILLPMV
                     FFIFSLFWFVASVRLGYYLFNAQSSVLFILHTALKTFVLKPTKTLGIALFLGLVLMKF
                     LFVLSVLNATRIKKARFLLGGLLFILVGVVLELAFNSLLPLMSSSLSINEGFYYFLQQ
                     QELQENKYYLLWGVDFLKILLLYAMSRYLLTHKLELD"
     gene            complement(148983..149846)
                     /locus_tag="HPSH112_00745"
                     /db_xref="GeneID:12772931"
     CDS             complement(148983..149846)
                     /locus_tag="HPSH112_00745"
                     /note="COG2107 Predicted periplasmic solute-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226878.1"
                     /db_xref="GI:386753660"
                     /db_xref="GeneID:12772931"
                     /translation="MISVAHSPDADDIFMYYAIKFGWIDCPIKNKTFHNIALDIETLN
                     QEALKNTYDVSAISFGLYPKIANDYALLPTATSFGNGYGPKLVKKKGVKLKKDFRVAL
                     SGDHTTNALLFKIYYKHARITYMNFLDIEKAVLEGSVHAGVLIHENILDFHNGLEVEK
                     ELWDVWKELIKVDLPLPLGGMAIRRSIPLYRAILIKKALIKAVEVALKHQNLLSNMLL
                     ERSLIRVNMERLQTYLSLYANETSTRLSEIQILAIDKLFELGYQHGFYANLLKAKDCL
                     LTDEYLQYRFS"
     misc_feature    complement(149013..149846)
                     /locus_tag="HPSH112_00745"
                     /note="Predicted periplasmic solute-binding protein
                     [General function prediction only]; Region: COG2107"
                     /db_xref="CDD:225018"
     gene            149945..150988
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /db_xref="GeneID:12772932"
     CDS             149945..150988
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="COG0468 RecA/RadA recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase A"
                     /protein_id="YP_006226879.1"
                     /db_xref="GI:386753661"
                     /db_xref="GeneID:12772932"
                     /translation="MAIDEDKQKAISLAIKQIDKVFGKGALVRLGDKQVEKIDAISTG
                     SLGLDLALGIGGVPKGRIIEIYGPESSGKTTLSLHIIAECQKNGGVCAFIDAEHALDV
                     HYAKRLGVDTENLLVSQPDTGEQALEILETITRSGGIDLVVVDSVAALTPKAEIDGDM
                     GDQHVGLQARLMSHALRKITGVLHKMNTTLIFINQIRMKIGMMGYGSPETTTGGNALK
                     FYASVRIDIRRIATLKQNEQHIGNRAKAKVVKNKVAPPFREAEFDIMFGEGISKEGEI
                     IDYGVKLDIVDKSGAWLSYQDKKLGQGRENAKALLKEDKALANEITLKIKESIGSNEE
                     IMPLPDEPLEEME"
     misc_feature    149945..150985
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="recombinase A; Provisional; Region: recA; PRK09354"
                     /db_xref="CDD:236476"
     misc_feature    149960..150937
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="RecA is a  bacterial enzyme which has roles in
                     homologous recombination, DNA repair, and the induction of
                     the SOS response.  RecA couples ATP hydrolysis to DNA
                     strand exchange; Region: recA; cd00983"
                     /db_xref="CDD:238483"
     misc_feature    order(149984..149989,149993..149998,150005..150007,
                     150017..150031,150236..150241,150245..150265,
                     150278..150283,150587..150589,150599..150601,
                     150743..150745,150881..150883)
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238483"
     misc_feature    150143..150166
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238483"
     misc_feature    order(150149..150169,150233..150235,150245..150247,
                     150254..150256,150377..150379,150527..150529,
                     150629..150631,150668..150670,150734..150745)
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238483"
     misc_feature    150365..150379
                     /gene="recA"
                     /locus_tag="HPSH112_00750"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238483"
     gene            151000..152280
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /db_xref="GeneID:12772933"
     CDS             151000..152280
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /EC_number="4.2.1.11"
                     /note="COG0148 Enolase"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_006226880.1"
                     /db_xref="GI:386753662"
                     /db_xref="GeneID:12772933"
                     /translation="MLTIKDIHALEVMDSRGNPTIQASVILSDNTKASAIVPSGASTG
                     KREALELRDNDKTRFLGKGVLRACENVNSVIKHHLIGLEAINQAFVDERLRALDGTPN
                     YANLGANAVLGVSMALARASAKALNLPLYRYLGGANALTLPVPMLNIINGGTHANNSI
                     DFQEYMIMPLGFESFREALRASAEVYHTLKELLDGKNQLTSVGDEGGFAPNFNNNVEP
                     LEVISQAIEKAGYKLGEEIALALDVASSELVDENFNYHLKGENKILDSHELVAYYKKL
                     VAKYPIVSIEDGLSEDDWEGWAFLSKELGRQIQLVGDDLFVTNASLLQKGIEKNIANA
                     ILIKPNQIGTISETLETIRLAKHHAYQCVMSHRSGESEDSFIADFAVALNTGEIKTGS
                     TARSERIAKYNRLLEIEHELKGGIYIGKELFKHG"
     misc_feature    151000..152274
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    151015..152232
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(151021..151023,151027..151053,151063..151065,
                     151099..151101,151465..151473,151534..151539,
                     151546..151551,151558..151563,151600..151605,
                     151624..151626,151630..151632,152107..152115,
                     152182..152190,152194..152199,152206..152208,
                     152215..152220,152227..152229)
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(151123..151125,151723..151725,151855..151857,
                     151936..151938)
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(151462..151464,151612..151614,152011..152013,
                     152095..152103,152164..152166)
                     /gene="eno"
                     /locus_tag="HPSH112_00755"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            152273..152548
                     /locus_tag="HPSH112_00760"
                     /db_xref="GeneID:12772934"
     CDS             152273..152548
                     /locus_tag="HPSH112_00760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226881.1"
                     /db_xref="GI:386753663"
                     /db_xref="GeneID:12772934"
                     /translation="MASGLFENDEIKDNKVRDFFYSHSSLIVFFLLLLGFGYYLGKLL
                     FGGSSLEVYLDLRDKHERLQQEITELQSKNVRLQKRLFELRELRPRD"
     gene            152564..153160
                     /locus_tag="HPSH112_00765"
                     /db_xref="GeneID:12772935"
     CDS             152564..153160
                     /locus_tag="HPSH112_00765"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226882.1"
                     /db_xref="GI:386753664"
                     /db_xref="GeneID:12772935"
                     /translation="MLKKMVGLVVVLSVLLARDNPFEPEINSKNLQGGFNGIYDSYFK
                     EIHVDLPTSARILKQITLTYQDIDGSIHSKVVGIDKNIDWHYPLKLSQHPLDPAAFEK
                     RYQIQDFDFSMANNTMILRSPYKILRSFVLVNPYRIVLDTQKGPLDIYQNRDLNQKFF
                     SQIKVGTHKDYYRITLILDGKYRYLLEEKNGAYELKLK"
     misc_feature    152906..153154
                     /locus_tag="HPSH112_00765"
                     /note="AMIN domain; Region: AMIN; pfam11741"
                     /db_xref="CDD:256588"
     gene            153165..153653
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /db_xref="GeneID:12772936"
     CDS             153165..153653
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /EC_number="2.7.1.71"
                     /note="COG0703 Shikimate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate kinase"
                     /protein_id="YP_006226883.1"
                     /db_xref="GI:386753665"
                     /db_xref="GeneID:12772936"
                     /translation="MRHLVLIGFMGSGKSSLAQELGLALKLEVLDTDMIISERVGLSV
                     RGIFEELGEDNFRMFEKNLIDELKTLKTPHIISTGGGIVMHDNLKGLGTTFYLKMDFE
                     TLIKRLNQKEREKRPLLNDLTQAKELFEKRQALYEKNASFIIDARGGLNNSLKQVLQF
                     IA"
     misc_feature    153165..153650
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /note="Shikimate kinase [Amino acid transport and
                     metabolism]; Region: AroK; COG0703"
                     /db_xref="CDD:223775"
     misc_feature    153174..153608
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /note="Shikimate kinase (SK) is the fifth enzyme in the
                     shikimate pathway, a seven-step biosynthetic pathway which
                     converts erythrose-4-phosphate to chorismic acid, found in
                     bacteria, fungi and plants. Chorismic acid is a important
                     intermediate in the synthesis...; Region: SK; cd00464"
                     /db_xref="CDD:238260"
     misc_feature    order(153195..153212,153483..153485,153510..153512)
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(153207..153209,153255..153257,153261..153263)
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /note="magnesium binding site [ion binding]; other site"
                     /db_xref="CDD:238260"
     misc_feature    order(153261..153263,153333..153335,153342..153344,
                     153399..153407,153558..153560)
                     /gene="aroK"
                     /locus_tag="HPSH112_00770"
                     /note="putative shikimate binding site; other site"
                     /db_xref="CDD:238260"
     gene            153675..154631
                     /locus_tag="HPSH112_00775"
                     /db_xref="GeneID:12772937"
     CDS             153675..154631
                     /locus_tag="HPSH112_00775"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226884.1"
                     /db_xref="GI:386753666"
                     /db_xref="GeneID:12772937"
                     /translation="MLSRDIVQYSKIRTELYAYLTYLFSHNIRNHLPEITLDYLNKQI
                     KKMHAEIKMAKNFFVLDAKGMLILKPSQLKEQGHKEGILEHDLTEGIELESHASFSDK
                     YYFYQAVSEKRCILTDPYPSKKGNHLVVSASYPVYDQNNDLAFVVCLQIPLRVAIEIS
                     SPSKYFRTFSEGSMVMYFMISIMLTLVSLLLFVKCISSFWTAIVNFSSFDIKEVFHPI
                     VLLTLALATFDLVKAIFEEEVLGKNSGDNHHAIHRTMIRFLGSIIIALAIEALMLVFK
                     FSVSEPDKITYAVYLAIGVAVLLISLAIYVKFAYSVLPKRER"
     misc_feature    154020..>154133
                     /locus_tag="HPSH112_00775"
                     /note="Cache domain; Region: Cache_1; pfam02743"
                     /db_xref="CDD:217211"
     gene            complement(154628..155749)
                     /locus_tag="HPSH112_00780"
                     /db_xref="GeneID:12772938"
     CDS             complement(154628..155749)
                     /locus_tag="HPSH112_00780"
                     /note="COG1442 Lipopolysaccharide biosynthesis proteins,
                     LPS:glycosyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipopolysaccharide biosynthesis
                     protein"
                     /protein_id="YP_006226885.1"
                     /db_xref="GI:386753667"
                     /db_xref="GeneID:12772938"
                     /translation="MSIIIPIVIAFDNNYVIPAGVSLYSMLACAKVENPQSQNDSKKL
                     FYKIHCLVDNLSLENQRKLKETLAPFSAFMSLEFLDISTPNLHTTSIEELSAIDKINE
                     AFLQLNIYAKTRFSKMVMCRLFLASLFLQYDKIIMFDADTLFLNDVSESFFIPLDGYY
                     FGAAKDFSSPKSPKHFQMERERAPRQAFSLYEHYLKEKDIKILYENHYNVGFLIVNLK
                     LWRADRLEERLLNLTRQKGQCVFCPEQDLLTLACYQKVLILPYIYNTHPFMANQKRFI
                     PNRQEIVMLHFYFVGKPWISPTALYSKEWHETLLKTSFYAKYSVKFLKQMTEFLSLKD
                     KQKTFEFLAPLLNPKTLLEYVFFRLNRIFKRLKEKFFNS"
     misc_feature    complement(154640..155740)
                     /locus_tag="HPSH112_00780"
                     /note="Lipopolysaccharide biosynthesis proteins,
                     LPS:glycosyltransferases [Cell envelope biogenesis, outer
                     membrane]; Region: RfaJ; COG1442"
                     /db_xref="CDD:224359"
     misc_feature    complement(154868..155737)
                     /locus_tag="HPSH112_00780"
                     /note="A4GalT_like proteins catalyze the addition of
                     galactose or glucose residues to the lipooligosaccharide
                     (LOS) or lipopolysaccharide (LPS) of the bacterial cell
                     surface; Region: GT8_A4GalT_like; cd04194"
                     /db_xref="CDD:133037"
     misc_feature    complement(order(154874..154876,154883..154888,
                     154892..154894,154949..154951,155015..155020,
                     155117..155125,155252..155254,155327..155335,
                     155384..155386,155393..155395,155705..155710,
                     155714..155722))
                     /locus_tag="HPSH112_00780"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133037"
     misc_feature    complement(order(154892..154894,155327..155329,
                     155333..155335))
                     /locus_tag="HPSH112_00780"
                     /note="metal-binding site"
                     /db_xref="CDD:133037"
     gene            155900..156817
                     /locus_tag="HPSH112_00785"
                     /db_xref="GeneID:12772939"
     CDS             155900..156817
                     /locus_tag="HPSH112_00785"
                     /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226886.1"
                     /db_xref="GI:386753668"
                     /db_xref="GeneID:12772939"
                     /translation="MIKSWTKKWVFIWLVVAGCFSHLMATTGEAYFKMATQAFKRGDY
                     HKAVAFYKRSCNLRVGVSCTSLGSMYEDGDGVDQNIPKAVFYYRRGCNLMNHLACASL
                     GSMYEDGDGVQKNLPKAIYYYRRGCHLKGGVSCGSLGFMYFNGTGVKQNYAKALSLSK
                     YACSLNYGISCNFTGYMYRNAKGAEKDLKKALTNFKRGCHLKDGASCVSLGYMYEAGL
                     YVRQSEGQALNLYKKGCSLKEGSGCHNVAVMYYTGKGAPKDLDKATSYYKKGCTLGFS
                     GSCKVLEMVGKNSDNLQDDAQNDTQDDTQ"
     misc_feature    155972..156793
                     /locus_tag="HPSH112_00785"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    156083..156178
                     /locus_tag="HPSH112_00785"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    156185..156289
                     /locus_tag="HPSH112_00785"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    156299..156400
                     /locus_tag="HPSH112_00785"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    156509..156613
                     /locus_tag="HPSH112_00785"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    156623..156721
                     /locus_tag="HPSH112_00785"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            complement(157043..157174)
                     /locus_tag="HPSH112_00790"
                     /db_xref="GeneID:12772940"
     CDS             complement(157043..157174)
                     /locus_tag="HPSH112_00790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226887.1"
                     /db_xref="GI:386753669"
                     /db_xref="GeneID:12772940"
                     /translation="MNSFIQCPFLKNLFLSFFIVNFYFVSYFLKRIGDFEITPPLTP"
     gene            complement(157571..158293)
                     /locus_tag="HPSH112_00795"
                     /db_xref="GeneID:12772941"
     CDS             complement(157571..158293)
                     /locus_tag="HPSH112_00795"
                     /note="COG0217 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226888.1"
                     /db_xref="GI:386753670"
                     /db_xref="GeneID:12772941"
                     /translation="MGRAFEYRRAAKEKRWDKMSKVFPKLAKAITLAAKEGGSEPDTN
                     AKLRTAILNAKVQNMPKDNIDAAIKRASSKEGNLSEITYEGKANFGVLIIMECMTDNP
                     TRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALID
                     YGLEELEEVEDKIIIRGDYNSFKLLNEGFESLRLPILKASLQRIATTPIELNDEQMEL
                     TEKLLDRIEDDDDVVALYTNIE"
     misc_feature    complement(157574..158293)
                     /locus_tag="HPSH112_00795"
                     /note="hypothetical protein; Provisional; Region:
                     PRK12378"
                     /db_xref="CDD:237084"
     gene            complement(158294..159265)
                     /locus_tag="HPSH112_00800"
                     /db_xref="GeneID:12772942"
     CDS             complement(158294..159265)
                     /locus_tag="HPSH112_00800"
                     /EC_number="4.2.1.24"
                     /note="COG0113 Delta-aminolevulinic acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="delta-aminolevulinic acid dehydratase"
                     /protein_id="YP_006226889.1"
                     /db_xref="GI:386753671"
                     /db_xref="GeneID:12772942"
                     /translation="MFKRLRRLRSSENLRAMIRETRLNIDDFIAPLFVIESDSYIKNE
                     INSMPGVYQMSVEPLLKECEELVGLGIKAVLLFGIPKHKDATGSHALNKDHIVAKAAR
                     EVKKRFKDLIVIVDLCFCEYTDHGHCGILENASVSNDKTLEILNLQGLILAESGVDIL
                     APSNMMDGNVLSLRKTLDNAGYTHTPIMSYSTKFASSYYGPFRDVANSAPSFGDRKSY
                     QMDYANKKEALLESLEDEKQGADILMVKPALAYLDIVKEIRDHTLLPLALYNVSGEYA
                     MLKLAQKHNLINYESVLLETMTCFKRAGADMIISYHAKEMANLLQRN"
     misc_feature    complement(158306..159250)
                     /locus_tag="HPSH112_00800"
                     /note="Porphobilinogen synthase (PBGS), which is also
                     called delta-aminolevulinic acid dehydratase (ALAD),
                     catalyzes the condensation of two 5-aminolevulinic acid
                     (ALA) molecules to form the pyrrole porphobilinogen (PBG),
                     which is the second step in the...; Region: ALAD_PBGS;
                     cd00384"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(158360..158362,158369..158371,
                     158381..158383,158435..158437,158507..158521,
                     158573..158578,158585..158587,158603..158605,
                     158612..158614,158672..158680,158765..158770,
                     158849..158854,159119..159121,159128..159130,
                     159203..159205,159236..159241,159248..159250))
                     /locus_tag="HPSH112_00800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(158333..158335,158450..158452,
                     158459..158461,158528..158530,158609..158611,
                     158621..158623,158642..158644,158657..158662,
                     158669..158671,158687..158689,158777..158779,
                     158882..158884,158906..158908,158912..158914,
                     158918..158920))
                     /locus_tag="HPSH112_00800"
                     /note="active site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(158528..158530,158687..158689))
                     /locus_tag="HPSH112_00800"
                     /note="Schiff base residues; other site"
                     /db_xref="CDD:238226"
     gene            complement(159288..160619)
                     /locus_tag="HPSH112_00805"
                     /db_xref="GeneID:12772943"
     CDS             complement(159288..160619)
                     /locus_tag="HPSH112_00805"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative histidine kinase sensor protein"
                     /protein_id="YP_006226890.1"
                     /db_xref="GI:386753672"
                     /db_xref="GeneID:12772943"
                     /translation="MRFSIFFKVVALFMITLFSFGAFAYYFVSSQINHENYQNEMRHY
                     QFVTTINEILNNYSDYRAIEDYLYKIGFKETTMENLEKVLAKRRHQLHHRNIGYAEVF
                     KFSDMVFILLKKDEHFVLYKDLHSVSYKNYFLAITVGLLLILFLFLFVLQSLLPLREL
                     RSQVKRFAQGDKSVSCKSKQKDEIGDLANEFDNCIQKINAMNESRILFLRSIMHELRT
                     PITKGKILSSMLKEELSYKRLSSIFDHLNMLIEQFARIEQFASKNYGSNKEKFLMSDL
                     IDKIEKMLLIDEDKKSPIHVPSSNYIIEADFELFSIALKNMVDNAIKYSDDKQVFLDF
                     IGNNLVVSNKSEPLKEDFEKYLQPYFKSSNPSQAHGFGLGMYIIKNALEAMGLNLSYH
                     YSNGRICFTIHDCVFNHFYDLEEDDEEPTPPPRKFERGERNEGDRKSQLWG"
     misc_feature    complement(159411..160154)
                     /locus_tag="HPSH112_00805"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(160020..160154)
                     /locus_tag="HPSH112_00805"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(160026..160031,160038..160043,
                     160047..160052,160059..160064,160068..160073,
                     160119..160121,160125..160130,160137..160142,
                     160146..160151))
                     /locus_tag="HPSH112_00805"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(159861..160016)
                     /locus_tag="HPSH112_00805"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(159861..159863,159873..159875,
                     159882..159884,159894..159896,159903..159905,
                     159942..159944,159951..159953,159963..159965,
                     159972..159974,159984..159986,159996..159998))
                     /locus_tag="HPSH112_00805"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(159978..159980)
                     /locus_tag="HPSH112_00805"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(159411..159683)
                     /locus_tag="HPSH112_00805"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(159420..159422,159426..159428,
                     159441..159443,159447..159449,159495..159506,
                     159576..159581,159585..159587,159591..159593,
                     159597..159599,159651..159653,159660..159662,
                     159672..159674))
                     /locus_tag="HPSH112_00805"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(159660..159662)
                     /locus_tag="HPSH112_00805"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(159498..159500,159504..159506,
                     159579..159581,159585..159587))
                     /locus_tag="HPSH112_00805"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(160645..161322)
                     /locus_tag="HPSH112_00810"
                     /db_xref="GeneID:12772944"
     CDS             complement(160645..161322)
                     /locus_tag="HPSH112_00810"
                     /note="COG0745 Response regulators consisting of a
                     CheY-like receiver domain and a winged-helix DNA-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator OmpR"
                     /protein_id="YP_006226891.1"
                     /db_xref="GI:386753673"
                     /db_xref="GeneID:12772944"
                     /translation="MIEVLMIEDDIELAEFLSEFLLQHGIHVTNYDEPYTGISAANTQ
                     NYDLLLLDLTLPNLDGLEVCRRISKQKHIPIIISSARSDVEDKIKALDYGADDYLPKP
                     YDPKELLARIQSLLRRSHKKEEVSEPSDANIFRVDKDSREVYMHEKKLDLTRAEYEIL
                     SLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRG
                     IGYKLEY"
     misc_feature    complement(160651..161313)
                     /locus_tag="HPSH112_00810"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(160975..161310)
                     /locus_tag="HPSH112_00810"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(161017..161022,161029..161031,
                     161086..161088,161143..161145,161296..161301))
                     /locus_tag="HPSH112_00810"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(161014..161022)
                     /locus_tag="HPSH112_00810"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(160654..160923)
                     /locus_tag="HPSH112_00810"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(160663..160665,160678..160680,
                     160714..160719,160741..160743,160750..160752,
                     160804..160809,160864..160866))
                     /locus_tag="HPSH112_00810"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(161557..162018)
                     /locus_tag="HPSH112_00815"
                     /db_xref="GeneID:12772945"
     CDS             complement(161557..162018)
                     /locus_tag="HPSH112_00815"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226892.1"
                     /db_xref="GI:386753674"
                     /db_xref="GeneID:12772945"
                     /translation="MELKNIISETLNEIEKMAKTIGDGFDTAQKTPSFFKTPQDLQNT
                     PSSQNANAPLEPKNAAKIETQEKITEEKEETPEIITEEIAQENPMQALIPNERVFLKG
                     LLERTLVLFKGMQALEEKEALKRLDLVARFLQYQLSVLEKRLESLERENTE"
     gene            complement(162009..162272)
                     /locus_tag="HPSH112_00820"
                     /db_xref="GeneID:12772946"
     CDS             complement(162009..162272)
                     /locus_tag="HPSH112_00820"
                     /note="COG0457 FOG: TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226893.1"
                     /db_xref="GI:386753675"
                     /db_xref="GeneID:12772946"
                     /translation="MPLETITLASIYEEQGFFEEALQIYTNILKKTPDHTEALKQIKR
                     LEKIQKNLAPFKHDATLERHYLNFIKGDYLSVENLEKWLVEWN"
     misc_feature    complement(162150..162251)
                     /locus_tag="HPSH112_00820"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cl02429"
                     /db_xref="CDD:243034"
     gene            complement(162305..163585)
                     /locus_tag="HPSH112_00825"
                     /db_xref="GeneID:12772947"
     CDS             complement(162305..163585)
                     /locus_tag="HPSH112_00825"
                     /note="COG0826 Collagenase and related proteases"
                     /codon_start=1
                     /transl_table=11
                     /product="collagenase"
                     /protein_id="YP_006226894.1"
                     /db_xref="GI:386753676"
                     /db_xref="GeneID:12772947"
                     /translation="MNQVELLSPAGNLKKLKIALSYGADAVYGGVSHFSLRNRASKEF
                     TLKTFKEGIDYAHALNKKVYATINGFPFNSQLKLLEEHIYKMAELEPDAFIIAAPGVI
                     KLALKIAPHIPIHLSTQANVLNLLDAQVFYDLGVKRIVCARELSLNDAIEIKKALPDL
                     ELEIFVHGSMCFAFSGRCLISALQKGRVPNRGSCANDCRFDYEYYVKNPDNGVMMRLV
                     EEEGVGTHIFNAKDLNLSNHIAEILSSNAISALKIEGRTKSSYYAAQTTRIYRLAVDD
                     FYNNTLKPSFYASELNTLKNRGFTDGYLMRRPFERLDTQNHQTAISEGDFQVNGEITE
                     DGRFFACKFTTTTNAAYEIIAPKNAAITPIVNEIGKIYTFEKRSYLVLYKILLENNTE
                     LETIHSGNVNLVRLPAPLPAFSFLRTQVEPKNGV"
     misc_feature    complement(162542..163585)
                     /locus_tag="HPSH112_00825"
                     /note="Collagenase and related proteases
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0826"
                     /db_xref="CDD:223896"
     gene            complement(163588..164307)
                     /locus_tag="HPSH112_00830"
                     /db_xref="GeneID:12772948"
     CDS             complement(163588..164307)
                     /locus_tag="HPSH112_00830"
                     /note="COG0840 Methyl-accepting chemotaxis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226895.1"
                     /db_xref="GI:386753677"
                     /db_xref="GeneID:12772948"
                     /translation="MTQEELDALMNGGDLENLEALEAKEETKEEPKEVKENSNHSEKM
                     TVKKEDAEKYGKISPNEWPPPPPTEEHKVVHQLDDVTRDSEVKATQIFDQLDLIGASA
                     EKIAKMVKKIQEPLQKHQEIFDNLHSHFPNIESFKTALNEQQEILNALKSIEEEAANC
                     SDSSMQAMDIMQFQDIHRQKIERVVNVMRALSQYMNSLFEGKIDDSKRVSSATYITGD
                     DDKDLASADDIEALIASFGAK"
     gene            complement(164382..165473)
                     /gene="prfB"
                     /locus_tag="HPSH112_00835"
                     /db_xref="GeneID:12772949"
     CDS             complement(164382..165473)
                     /gene="prfB"
                     /locus_tag="HPSH112_00835"
                     /note="COG1186 Protein chain release factor B"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="YP_006226896.1"
                     /db_xref="GI:386753678"
                     /db_xref="GeneID:12772949"
                     /translation="MDNYTYSELLKSLQNKCDNIALIIKPEKIKQELERIEKEQEDPN
                     FWQDVLKARDTNKEKVRLNRLLETYQKTKNSLDESTELFELAQNDNDEVTLSLLYEEA
                     PVLEHSVQKVEIEIMLSGENDASNAIITIQPGAGGTESQDWASILYRMYLRWAERRGF
                     KSEILDYQDGEEAGIKGVAFIIKGENAYGYLKNENGVHRLVRISPFDANAKRHTSFAS
                     VQISPELDDDIDIEIDEKDVRYDYYRASGAGGQHVNKTESAVRITHFPTGIVVQCQND
                     RSQHKNKASALKMLKSKLYELELEKQQSTAKNEEKSEIGWGHQIRSYVLAPYQQVKDA
                     RSNTAYSNVEAILDGDIDAILEGVLIAKA"
     misc_feature    complement(164385..165470)
                     /gene="prfB"
                     /locus_tag="HPSH112_00835"
                     /note="peptide chain release factor 2; Region: prfB;
                     TIGR00020"
                     /db_xref="CDD:232785"
     misc_feature    complement(164892..165224)
                     /gene="prfB"
                     /locus_tag="HPSH112_00835"
                     /note="This domain is found in peptide chain release
                     factors; Region: PCRF; smart00937"
                     /db_xref="CDD:214923"
     misc_feature    complement(164469..164762)
                     /gene="prfB"
                     /locus_tag="HPSH112_00835"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            complement(165534..166709)
                     /locus_tag="HPSH112_00840"
                     /db_xref="GeneID:12772950"
     CDS             complement(165534..166709)
                     /locus_tag="HPSH112_00840"
                     /note="COG0303 Molybdopterin biosynthesis enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin biosynthesis protein"
                     /protein_id="YP_006226897.1"
                     /db_xref="GI:386753679"
                     /db_xref="GeneID:12772950"
                     /translation="MVSFKEALKIHSSIPLEPLEIEIISLFESIGRILAEDIICIHAL
                     PKFNQSAMDGYGFKMQDLGKKTQVIQRIFAGDDVSALEVKENECVKIMTGAMVPKGIE
                     TIVPIECMLESHTNFALAPKDFKINANIRQKGENASLNSVLVPKNTRLNYGHIALIAS
                     QGLKEIKAFRKLKIALFSSGDELVPLGQNALECQVYDVNSVGIFNMLKNYNTHFLGVL
                     KDNKDLQLKPLESQDYDVILSSAGVSVGDKDFFKDALKEKNALFYYEKVNLKPGKPVT
                     LAKLNQSIIIGLPGNPLSCLLVLRVLILPLLERLSLNKDFKLKPFKAQINAPLKLKGE
                     RTHLILGNYSNNQFIPYNNNRYESGAIQALAQVDSIALIDEGVGLVQGEIEILRFEN"
     misc_feature    complement(165540..166709)
                     /locus_tag="HPSH112_00840"
                     /note="Molybdopterin biosynthesis enzyme [Coenzyme
                     metabolism]; Region: MoeA; COG0303"
                     /db_xref="CDD:223380"
     misc_feature    complement(165543..166700)
                     /locus_tag="HPSH112_00840"
                     /note="MoeA family. Members of this family are involved in
                     biosynthesis of the molybdenum cofactor (MoCF), an
                     essential cofactor of a diverse group of redox enzymes.
                     MoCF biosynthesis is an evolutionarily conserved pathway
                     present in eubacteria, archaea and...; Region: MoeA;
                     cd00887"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(165555..165557,165633..165635,
                     165747..165749,166107..166109,166116..166118,
                     166122..166124,166224..166226,166230..166235,
                     166242..166244,166248..166259,166302..166304,
                     166629..166631))
                     /locus_tag="HPSH112_00840"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(165984..165986,166050..166052,
                     166164..166166,166170..166175))
                     /locus_tag="HPSH112_00840"
                     /note="putative functional site; other site"
                     /db_xref="CDD:238452"
     misc_feature    complement(order(165819..165821,165828..165830,
                     165840..165845,165978..165986))
                     /locus_tag="HPSH112_00840"
                     /note="putative MPT binding site; other site"
                     /db_xref="CDD:238452"
     gene            complement(166719..167486)
                     /gene="fliR"
                     /locus_tag="HPSH112_00845"
                     /db_xref="GeneID:12772951"
     CDS             complement(166719..167486)
                     /gene="fliR"
                     /locus_tag="HPSH112_00845"
                     /note="COG1684 Flagellar biosynthesis pathway, component
                     FliR"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="YP_006226898.1"
                     /db_xref="GI:386753680"
                     /db_xref="GeneID:12772951"
                     /translation="MLDFIQELSTPHVRDFFLLFLRVSGVLSFFPFFENHLVPLSVRG
                     ALSLYVSAIFYPTLEFSNAAYTPEGFIIACLCELFLGVCASIFLQIVFASLVFATDSI
                     SFSMGLTMASAYDPISGSQKPIVGQALLLLAILILLDLSFHHQIILFVDHSLKAVPLG
                     QFVFEPALAKNIIKAFSHLFVIGFSMAFPILCLVLLSDIIFGMIMKTHPQFNLLAIGF
                     PVKIAIGFVGIILIISAIMGRFKEEISLAFSTISKIF"
     misc_feature    complement(166722..167483)
                     /gene="fliR"
                     /locus_tag="HPSH112_00845"
                     /note="Flagellar biosynthesis pathway, component FliR
                     [Cell motility and secretion / Intracellular trafficking
                     and secretion]; Region: FliR; COG1684"
                     /db_xref="CDD:224598"
     gene            complement(167461..168255)
                     /locus_tag="HPSH112_00850"
                     /db_xref="GeneID:12772952"
     CDS             complement(167461..168255)
                     /locus_tag="HPSH112_00850"
                     /note="COG2101 TATA-box binding protein (TBP), component
                     of TFIID and TFIIIB"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226899.1"
                     /db_xref="GI:386753681"
                     /db_xref="GeneID:12772952"
                     /translation="MRLNYPSKVSEEGFQVMVLSLSILKKSFNDFLSARMLLINLGPI
                     LLSLAFFGAVFYYNGANIVGYCQTLLPQSLNDYSHSQGFFAGVFAWVFKALVYFLVFW
                     IVILLSLVINIFASVFYTPLVVSYLHQKYYPHVVLEEFGSILFSIKYFLKSLIFMLLW
                     MAVLTPLYFIPFIGVFGVFFSIIPHFLFFKNTMSLDIASMIFNHQSYQNLLKQHRLKH
                     YRFSFFCYLFSLIPFFNFFATLLQTLMLTHYFFILKKKNARFYSRA"
     misc_feature    complement(167542..168192)
                     /locus_tag="HPSH112_00850"
                     /note="Etoposide-induced protein 2.4 (EI24); Region: EI24;
                     pfam07264"
                     /db_xref="CDD:254130"
     gene            168688..169587
                     /locus_tag="HPSH112_00855"
                     /db_xref="GeneID:12772953"
     CDS             168688..169587
                     /locus_tag="HPSH112_00855"
                     /note="COG0760 Parvulin-like peptidyl-prolyl isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_006226900.1"
                     /db_xref="GI:386753682"
                     /db_xref="GeneID:12772953"
                     /translation="MKKNILNLALVGALSASFLMAKPAHNANNATHNTKKTADSSAGV
                     LATVDGIPITKSDFDMIKQRNPNFDFDKLKEKEKEALIEQAIRTALVENEAKTEKLDQ
                     TPEFKAMMEAVKKQALVEFWAKKQAEEVKKIQIPEKEMQDFYNANKDQLFVKQEAHAR
                     HILVKTEDEAKRIISEIDKQPKTKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQ
                     MAPDFSKAAFALTPGNYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEK
                     LFQERMNQRIEELRKRAKIVINK"
     misc_feature    168709..169584
                     /locus_tag="HPSH112_00855"
                     /note="Parvulin-like peptidyl-prolyl isomerase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SurA; COG0760"
                     /db_xref="CDD:223831"
     misc_feature    169168..169443
                     /locus_tag="HPSH112_00855"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            169604..170527
                     /locus_tag="HPSH112_00860"
                     /db_xref="GeneID:12772954"
     CDS             169604..170527
                     /locus_tag="HPSH112_00860"
                     /EC_number="4.1.2.13"
                     /note="COG0191 Fructose/tagatose bisphosphate aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="YP_006226901.1"
                     /db_xref="GI:386753683"
                     /db_xref="GeneID:12772954"
                     /translation="MLVKGNEILLKAHKEGYGVGAFNFVNFEMLNAIFEAGNEENSPL
                     FIQASEGAIKYMGIDMAVGMVKIMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVM
                     IDASHHAFEENLELTSKVVKMAHNAGVSVEAELGRLMGIEDNISVDEKDAVLVNPKEA
                     EQFVKESQVDYLAPAIGTSHGAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDG
                     VRKSYLDAGGDLKGSKGVPFEFLQESVKGGINKVNTDTDLRIAFIAEVRKVANEDKSQ
                     FDLRKFFSPAQLALKNVVKERMKLLGSANKI"
     misc_feature    169616..170518
                     /locus_tag="HPSH112_00860"
                     /note="Tagatose-1,6-bisphosphate (TBP) aldolase and
                     related Type B Class II aldolases. TBP aldolase is a
                     tetrameric class II aldolase that catalyzes the reversible
                     condensation of dihydroxyacetone phosphate with
                     glyceraldehyde 3-phsophate to produce tagatose 1; Region:
                     TBP_aldolase_IIB; cd00947"
                     /db_xref="CDD:238477"
     misc_feature    order(169679..169687,169694..169696,169754..169756,
                     169763..169771,169781..169783,169793..169795,
                     169802..169807,170027..170029,170369..170374,
                     170378..170383,170390..170392,170402..170404,
                     170411..170413)
                     /locus_tag="HPSH112_00860"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238477"
     misc_feature    order(169847..169852,170138..170146,170150..170152,
                     170231..170236,170240..170242,170360..170362,
                     170366..170371)
                     /locus_tag="HPSH112_00860"
                     /note="active site"
                     /db_xref="CDD:238477"
     misc_feature    order(169850..169852,170141..170143,170231..170233)
                     /locus_tag="HPSH112_00860"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     misc_feature    order(170138..170140,170144..170146,170150..170152,
                     170234..170236,170240..170242)
                     /locus_tag="HPSH112_00860"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238477"
     gene            170549..171112
                     /locus_tag="HPSH112_00865"
                     /db_xref="GeneID:12772955"
     CDS             170549..171112
                     /locus_tag="HPSH112_00865"
                     /note="COG0231 Translation elongation factor P
                     (EF-P)/translation initiation factor 5A (eIF-5A)"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="YP_006226902.1"
                     /db_xref="GI:386753684"
                     /db_xref="GeneID:12772955"
                     /translation="MAIGMSELKKGLKIELGGVPYRIVEYQHVKPGKGAAFVRAKIKS
                     FLDGKVIEKTFHAGDKCEEPNLVEKTMQYLYHDGDTYQFMDIESYEQIALNDSQVGEA
                     SKWMLDGMQVQVLLHNDKAISVDVPQVVALKIVETAPNFKGDTSSASKKPATLETGAV
                     VQVPFHVLEGEIIKVNTETEEYLEKVK"
     misc_feature    170555..171109
                     /locus_tag="HPSH112_00865"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     misc_feature    170561..170728
                     /locus_tag="HPSH112_00865"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:254661"
     misc_feature    170750..170929
                     /locus_tag="HPSH112_00865"
                     /note="S1_EF-P_repeat_1: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_1;
                     cd04470"
                     /db_xref="CDD:239916"
     misc_feature    order(170816..170818,170891..170893,170906..170911)
                     /locus_tag="HPSH112_00865"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239916"
     misc_feature    170936..171103
                     /locus_tag="HPSH112_00865"
                     /note="S1_EF-P_repeat_2: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_2;
                     cd05794"
                     /db_xref="CDD:240220"
     misc_feature    order(171023..171025,171074..171076,171089..171094)
                     /locus_tag="HPSH112_00865"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            complement(171651..172679)
                     /locus_tag="HPSH112_00870"
                     /db_xref="GeneID:12772956"
     CDS             complement(171651..172679)
                     /locus_tag="HPSH112_00870"
                     /note="COG2089 Sialic acid synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="sialic acid synthase"
                     /protein_id="YP_006226903.1"
                     /db_xref="GI:386753685"
                     /db_xref="GeneID:12772956"
                     /translation="MLQRPKIVAELSANHNQDLNLAKESLHAIKESGADFVKLQTYTP
                     SCMTLNSKEDPFIIQGTLWDKENLYELYQKASTPLEWHAELFELAKKLDLGIFSSPFS
                     SKALELLESLNCPMYKIASFEIVDLDLIEKVARTKKPIILSSGIATHTELQDAISLCK
                     GAGNFDITLLKCVSAYPSKIEDANLLSMVKLGETFGVKFGLSDHTIGSLCPILATTLG
                     ASMIEKHFILNKSLQTPDSAFSMDFNGFKSMVEAIKQSVLALGEEEPKINPKTLEERR
                     FFMRSLFVIKDIQKGEALTSDNIKALRPNLGLHPKFYKEILGQKASKFLKANTPLSAD
                     GIERSLQV"
     misc_feature    complement(171687..172670)
                     /locus_tag="HPSH112_00870"
                     /note="pseudaminic acid synthase; Region: PseI; TIGR03586"
                     /db_xref="CDD:163337"
     misc_feature    complement(171894..172601)
                     /locus_tag="HPSH112_00870"
                     /note="NeuB family; Region: NeuB; pfam03102"
                     /db_xref="CDD:251732"
     misc_feature    complement(171672..171842)
                     /locus_tag="HPSH112_00870"
                     /note="C-terminal SAF domain of sialic acid synthetase;
                     Region: SAF_NeuB_like; cd11615"
                     /db_xref="CDD:212160"
     misc_feature    complement(order(171747..171755,171771..171779,
                     171825..171827,171840..171842))
                     /locus_tag="HPSH112_00870"
                     /note="NeuB binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212160"
     misc_feature    complement(171771..171773)
                     /locus_tag="HPSH112_00870"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212160"
     gene            complement(172683..173324)
                     /locus_tag="HPSH112_00875"
                     /db_xref="GeneID:12772957"
     CDS             complement(172683..173324)
                     /locus_tag="HPSH112_00875"
                     /note="COG1136 ABC-type antimicrobial peptide transport
                     system, ATPase component"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_006226904.1"
                     /db_xref="GI:386753686"
                     /db_xref="GeneID:12772957"
                     /translation="MIKAINISHAFEKPLYNGVNLHIKPKESLAILGVSGSGKSTLLS
                     HLATMLKPNSGTISLLEHQDIYALNSKKLLELRRLKVGIVFQSHYLFKGFSALENLQV
                     ASILAKQEIDHSLLEQLGIAHTLKQGVGELSGGQQQRLSIARVLSKKPKIIIADEPTG
                     NLDTTSANQVISMLQNYITEKEGALVLATHDEHLAFTCSQVYRLEKEVLIKEK"
     misc_feature    complement(172710..173324)
                     /locus_tag="HPSH112_00875"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    complement(172710..173321)
                     /locus_tag="HPSH112_00875"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(173205..173228)
                     /locus_tag="HPSH112_00875"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(172755..172757,172854..172859,
                     173067..173069,173202..173210,173214..173219))
                     /locus_tag="HPSH112_00875"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(173067..173078)
                     /locus_tag="HPSH112_00875"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(172902..172931)
                     /locus_tag="HPSH112_00875"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(172854..172871)
                     /locus_tag="HPSH112_00875"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(172836..172847)
                     /locus_tag="HPSH112_00875"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(172749..172769)
                     /locus_tag="HPSH112_00875"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(173324..174598)
                     /locus_tag="HPSH112_00880"
                     /db_xref="GeneID:12772958"
     CDS             complement(173324..174598)
                     /locus_tag="HPSH112_00880"
                     /EC_number="2.3.1.-"
                     /note="COG0815 Apolipoprotein N-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="YP_006226905.1"
                     /db_xref="GI:386753687"
                     /db_xref="GeneID:12772958"
                     /translation="MRLILFNQNAFLLACAFVSSVYANAVLDAYAVENPYVSITLTSL
                     LAPLSMLAFLKTPKNSAFALGFFVGVLLFYWCALSFRYSDFTYLLPLIIVLIALVYGV
                     LFYLLLYFENPYFRLLSFLGSSFIHPFGFDWLVPDSFFSYSVFRVDKLSLGLVFLACI
                     FLSAKQFKKYRIIAVLLLLSALDFNGFKTSDLKKVGNIELISTKTPQDLKFDSNYLNN
                     IENNILKEIKLAQSKQKTLIVFPETAYPIALENSPFKAKLEDLSGNIAILIGTLRTQG
                     YSLYNSSFLFSKESVQIADKVVLAPFGETMPLPEFLQKPLEKLFFGESAYLYRNASNF
                     SDFTLDDFTFRPLICYEGTSKPAYSNSSSKIFIVMSNNAWFSPSIEPTLQKTLLKYYA
                     RRYDKIILHSANFSTSYILNPSLLGDILFRKR"
     misc_feature    complement(173339..174598)
                     /locus_tag="HPSH112_00880"
                     /note="apolipoprotein N-acyltransferase; Reviewed; Region:
                     PRK12291"
                     /db_xref="CDD:237042"
     misc_feature    complement(173360..174415)
                     /locus_tag="HPSH112_00880"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cl11424"
                     /db_xref="CDD:264361"
     misc_feature    complement(order(173486..173488,173528..173530,
                     173543..173545,173549..173554,173687..173689,
                     173699..173701,173711..173713,173873..173875))
                     /locus_tag="HPSH112_00880"
                     /note="active site"
                     /db_xref="CDD:143587"
     misc_feature    complement(order(173552..173554,173711..173713,
                     173873..173875))
                     /locus_tag="HPSH112_00880"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143587"
     gene            174738..174851
                     /locus_tag="HPSH112_00885"
                     /db_xref="GeneID:12772959"
     CDS             174738..174851
                     /locus_tag="HPSH112_00885"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226906.1"
                     /db_xref="GI:386753688"
                     /db_xref="GeneID:12772959"
                     /translation="MIALKIMSVFFWGVFGAFLNARYLYARYMRERFGFRV"
     gene            174848..175549
                     /locus_tag="HPSH112_00890"
                     /db_xref="GeneID:12772960"
     CDS             174848..175549
                     /locus_tag="HPSH112_00890"
                     /note="COG1286 Uncharacterized membrane protein, required
                     for colicin V production"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226907.1"
                     /db_xref="GI:386753689"
                     /db_xref="GeneID:12772960"
                     /translation="MNYIDLALLVVVVAFGIRGFYHGFVSEVAGTLGIVLGVYLASRY
                     SVAVGHLFSEHLYDLRNETMTNLIGFLLVLASIWVFFLAFGVLLGKVLVFSGLGIIDK
                     ALGFIFSCLKTFLVLSFILYALSKMEVMKDANAYLQEKSAFFSTMKSVASKIMRLDGV
                     KHVEQNLKNNLEEMSDGVKNKESLNKTKESFDKAIDKGMEALKEKAKDLPKNMLDPKA
                     NQTPPNHTPSNKEPL"
     misc_feature    174848..175456
                     /locus_tag="HPSH112_00890"
                     /note="Uncharacterized membrane protein, required for
                     colicin V production [General function prediction only];
                     Region: CvpA; COG1286"
                     /db_xref="CDD:224205"
     gene            175559..177064
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /db_xref="GeneID:12772961"
     CDS             175559..177064
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /EC_number="6.1.1.6"
                     /note="COG1190 Lysyl-tRNA synthetase (class II)"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_006226908.1"
                     /db_xref="GI:386753690"
                     /db_xref="GeneID:12772961"
                     /translation="MFSNQYIQQRIHKANSLREEGKNPYKNGLKRSLTNAAFLEKYAY
                     VKGLEEPKDKEKCESIVGRVKLLRLMGKACFIKIEDESAILQAYVSQNELNDEFKSLK
                     KHLEVGDIVLVKGFPFATKTGELSVHALEFHILSKTIVPLPEKFHGLSDIELRYRQRY
                     LDLIVNPSVKDVFKKRSLIVSSVRKFFETEGFLEVETPMMHPIPGGANARPFITYHNA
                     LEIERYLRIAPELYLKRLIVGGFEAVFEINRNFRNEGMDHSHNPEFTMIEFYWAYHTY
                     EDLIELSKRLFDYLLKTLNLPSKIIYNDMEVDFNQTSVISYLDALETIGGISKDILEK
                     EDRLLAYLLEQSIKVEPDLTYGKLLAEAFDHFVEHQLINPTFVTQYPIEISPLARRND
                     SNPNIADRFELFIAGKEIANGFSELNDPLDQLERFKNQVAEKEKGDEEAQYMDEDYVW
                     ALAHGMPPTAGQGIGIDRLVMLLTGAKSIKDVILFPAMRPVKNDFNVESEE"
     misc_feature    175568..177028
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="lysyl-tRNA synthetase; Reviewed; Region: lysS;
                     PRK00484"
                     /db_xref="CDD:234778"
     misc_feature    175733..176047
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="LysRS_N: N-terminal, anticodon recognition domain
                     of lysyl-tRNA synthetases (LysRS). These enzymes are
                     homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs).
                     This domain is a beta-barrel domain (OB fold) involved in
                     binding the tRNA anticodon stem-loop; Region: LysRS_N;
                     cd04322"
                     /db_xref="CDD:239817"
     misc_feature    order(175742..175747,175796..175801,175886..175888,
                     175964..175966,175973..175981)
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239817"
     misc_feature    order(175754..175756,175760..175765,175781..175783,
                     175814..175816,175820..175822,175874..175876,
                     175916..175918,175934..175936)
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="putative anticodon binding site; other site"
                     /db_xref="CDD:239817"
     misc_feature    176054..177028
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="Lys_tRNA synthetase (LysRS) class II core domain.
                     Class II LysRS is a dimer which attaches a lysine to the
                     3' OH group of ribose of the appropriate tRNA. Its
                     assignment to class II aaRS is based upon its structure
                     and the presence of three...; Region: LysRS_core; cd00775"
                     /db_xref="CDD:238398"
     misc_feature    176150..176164
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="motif 1; other site"
                     /db_xref="CDD:238398"
     misc_feature    order(176246..176248,176312..176314,176318..176320,
                     176336..176338,176348..176350,176762..176764,
                     176783..176785,176792..176794,176804..176806,
                     176960..176962)
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="active site"
                     /db_xref="CDD:238398"
     misc_feature    176309..176320
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="motif 2; other site"
                     /db_xref="CDD:238398"
     misc_feature    176951..176962
                     /gene="lysS"
                     /locus_tag="HPSH112_00895"
                     /note="motif 3; other site"
                     /db_xref="CDD:238398"
     gene            177064..178314
                     /locus_tag="HPSH112_00900"
                     /db_xref="GeneID:12772962"
     CDS             177064..178314
                     /locus_tag="HPSH112_00900"
                     /EC_number="2.1.2.1"
                     /note="COG0112 Glycine/serine hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="YP_006226909.1"
                     /db_xref="GI:386753691"
                     /db_xref="GeneID:12772962"
                     /translation="MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFASVMEAM
                     GSVLTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAV
                     YHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVNLDGYIDYEEALKIAQ
                     SVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTGEHAHPFPHCH
                     VVSSTTHKTLRGPRGGLILTNDEEIAAKIDKAIFPGTQGGPLMHAIAAKAVGFKENLK
                     PEFKAYAQLVKSNMQVLAKALQEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGN
                     AGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVS
                     LQLHVKEELKAMASQFPVYQQPIF"
     misc_feature    177079..178275
                     /locus_tag="HPSH112_00900"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    order(177088..177090,177094..177096,177115..177120,
                     177145..177147,177160..177162,177214..177216,
                     177268..177273,177295..177297,177340..177342,
                     177361..177363,177466..177471,177841..177843,
                     177895..177897)
                     /locus_tag="HPSH112_00900"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(177157..177159,177217..177219,177247..177249,
                     177346..177351,177430..177432,177577..177579,
                     177652..177654,177661..177663,177736..177741,
                     177757..177759,178135..178137)
                     /locus_tag="HPSH112_00900"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    order(177157..177159,177430..177432,177739..177741,
                     178135..178137)
                     /locus_tag="HPSH112_00900"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    order(177223..177225,177244..177246,177415..177417,
                     177427..177429,177433..177435,177817..177819,
                     178087..178089)
                     /locus_tag="HPSH112_00900"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            178325..178867
                     /locus_tag="HPSH112_00905"
                     /db_xref="GeneID:12772963"
     CDS             178325..178867
                     /locus_tag="HPSH112_00905"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226910.1"
                     /db_xref="GI:386753692"
                     /db_xref="GeneID:12772963"
                     /translation="MTEMELKLIKIDTSHYFEKKPGLGERVDYAGRCFYNKFQRVNAM
                     LTSSLIQKHLKKEIEIAHNLILRNDKVENIVFDYNGRNPERFYHKVQLLLREEGFMNF
                     TAYNTKTPGHLHLYVHKGHTELGEGERLVKTLSMKLAQGLPKEWRVFPSNEWPKEFNI
                     LALPYEVFAKERGSFWAKHL"
     misc_feature    178328..178543
                     /locus_tag="HPSH112_00905"
                     /note="Domain of unknown function (DUF1882); Region:
                     DUF1882; pfam08966"
                     /db_xref="CDD:149893"
     misc_feature    <178583..178843
                     /locus_tag="HPSH112_00905"
                     /note="Eukaryotic and archaeal DNA primase small subunit;
                     Region: DNA_primase_S; pfam01896"
                     /db_xref="CDD:250949"
     gene            178889..179686
                     /locus_tag="HPSH112_00910"
                     /db_xref="GeneID:12772964"
     CDS             178889..179686
                     /locus_tag="HPSH112_00910"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226911.1"
                     /db_xref="GI:386753693"
                     /db_xref="GeneID:12772964"
                     /translation="MSEKERLNEVILEEENNGGGTKKVFLIVAIAIIILAVLLMVFWK
                     STRVAPKETFLQTDSGMQKIGNTKDEKKDDAFENLNLDLSKQESDLDKVADNVKKQES
                     DAFNMPTQTNQTQTEIKTTEETQEAKKELKAVENTPMSTQKESQAVVKKETPHEKPKV
                     KDKEAHKDKAKHAAKEPKAKKEAHKEVPKKANSKTTKGHYLQVGVFAHTPNKAFLQAF
                     NQFPHKIEDRGATKRYLIGPYKSKQEALMHADEVSKKMTKPVVIEAR"
     misc_feature    <179189..>179503
                     /locus_tag="HPSH112_00910"
                     /note="Cellular tumor antigen p53-inducible 5; Region:
                     TP53IP5; pfam15331"
                     /db_xref="CDD:259463"
     gene            181932..182465
                     /locus_tag="HPSH112_00930"
                     /db_xref="GeneID:12772965"
     CDS             181932..182465
                     /locus_tag="HPSH112_00930"
                     /note="COG2862 Predicted membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226912.1"
                     /db_xref="GI:386753694"
                     /db_xref="GeneID:12772965"
                     /translation="MLEKLIERVLFATRWLLAPLCIAMSLVLVVLGYVFMKELWHMLS
                     HLDTISETDLVLSALGLVDLLFMAGLVLMVLLASYESFVSKLDKVDASEITWLKHTDF
                     NALKLKVSLSIVAISAIFLLKRYMSLEDVLSSIPKDTPLSHNPIFWQVVIHLVFVCSA
                     LLAAVTNNIAFSQNKGH"
     misc_feature    181935..182462
                     /locus_tag="HPSH112_00930"
                     /note="Uncharacterized protein family, UPF0114; Region:
                     UPF0114; cl01078"
                     /db_xref="CDD:260780"
     gene            complement(182471..183979)
                     /locus_tag="HPSH112_00935"
                     /db_xref="GeneID:12772966"
     CDS             complement(182471..183979)
                     /locus_tag="HPSH112_00935"
                     /note="COG1502
                     Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
                     n synthases and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226913.1"
                     /db_xref="GI:386753695"
                     /db_xref="GeneID:12772966"
                     /translation="MKIFLVLLSVFFFNGCFGLVYKTPISSPPISYDPYTTAIGSLYA
                     EKLKENPNHSAAILLEDGFDALLHRVGLIRMSQKSIDMQTYIYKNDLSSQVIAKELLN
                     AANRGVKVRILLDDNGVYSDFSDIMLLNFHKNIEVKIFNPYYIRNKGLRYFEMLADYE
                     RIKKRMHNKLFIVDNFAVIIGGRNIGDNYFDNDLDTNFLDLDALFFGGVASKAKESFE
                     RYWRFHRSIPVSLLRTHKRLKNNAKEIAKLHEKIPISAEDKNQFKKKVNDFIERFQKY
                     QYPIYYGNAIFLADSPKKIDTPLYSPIKIAFEKALKNAKDSVFIASSYFIPGKKMMKI
                     FKNQISKGIELNILTNSLSSTDAIVVYGAWERYRNQLVRMGANVYEIRNDFFNRQIKG
                     RFSTKHSLHGKTIVFDDNLTLLGSFNIDPRSAYINTESAVLFDNPSFAKRVRLSLKDH
                     AQQSWHLVVYRHRVIWEAVEEGILIHEKTSPDTSFFLRLIKEWSKVLPEREL"
     misc_feature    complement(182489..183979)
                     /locus_tag="HPSH112_00935"
                     /note="Phosphatidylserine/phosphatidylglycerophosphate/car
                     diolipin synthases and related enzymes [Lipid metabolism];
                     Region: Cls; COG1502"
                     /db_xref="CDD:224419"
     misc_feature    complement(183317..183805)
                     /locus_tag="HPSH112_00935"
                     /note="Putative catalytic domain, repeat 1, of Escherichia
                     coli uncharacterized protein ymdC and similar proteins;
                     Region: PLDc_ymdC_like_1; cd09111"
                     /db_xref="CDD:197210"
     misc_feature    complement(order(183380..183382,183428..183430,
                     183434..183436,183473..183475,183479..183481))
                     /locus_tag="HPSH112_00935"
                     /note="putative active site [active]"
                     /db_xref="CDD:197210"
     misc_feature    complement(183479..183481)
                     /locus_tag="HPSH112_00935"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197210"
     misc_feature    complement(182486..183118)
                     /locus_tag="HPSH112_00935"
                     /note="Putative catalytic domain, repeat 2, of Escherichia
                     coli uncharacterized protein ymdC and similar proteins;
                     Region: PLDc_ymdC_like_2; cd09113"
                     /db_xref="CDD:197212"
     misc_feature    complement(order(182693..182695,182726..182728,
                     182732..182734,182771..182773,182777..182779))
                     /locus_tag="HPSH112_00935"
                     /note="putative active site [active]"
                     /db_xref="CDD:197212"
     misc_feature    complement(182777..182779)
                     /locus_tag="HPSH112_00935"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197212"
     gene            complement(184001..184738)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /db_xref="GeneID:12772967"
     CDS             complement(184001..184738)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /EC_number="1.3.99.1"
                     /note="COG0479 Succinate dehydrogenase/fumarate reductase,
                     Fe-S protein subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur subunit"
                     /protein_id="YP_006226914.1"
                     /db_xref="GI:386753696"
                     /db_xref="GeneID:12772967"
                     /translation="MSDNERTIVIRVLKFDPQSAVSKPHFKEYQLKETPSMTLFIALN
                     LIREHQDPDLSFDFVCRAGICGSCAMMVNGRPRLACKTLTSSFESGMITLMPMPSFTL
                     IKDLSVNTGDWFGDMTKRVESWAHSKEEVDITKPEKRIEPDEAQEVFELDRCIECGCC
                     IASCGTKLMRPNFIGAAGMNRAMRFMIDSHDERSDDDFYELVGDDDGVFGCMSLIACH
                     DTCPKELPLQSSIATLRNRMLKVGKSR"
     misc_feature    complement(184013..184729)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="fumarate reductase iron-sulfur subunit;
                     Provisional; Region: frdB; PRK13552"
                     /db_xref="CDD:184136"
     misc_feature    complement(184397..184711)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="2Fe-2S iron-sulfur cluster binding domain; Region:
                     Fer2_3; pfam13085"
                     /db_xref="CDD:257488"
     misc_feature    complement(184490..>184612)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(184499..184504,184535..184546,
                     184550..184552,184559..184561,184568..184573))
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    complement(order(184499..184501,184535..184537,
                     184544..184546,184559..184561))
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    complement(<184046..>184324)
                     /gene="frdB"
                     /locus_tag="HPSH112_00940"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            complement(184731..186875)
                     /locus_tag="HPSH112_00945"
                     /db_xref="GeneID:12772968"
     CDS             complement(184731..186875)
                     /locus_tag="HPSH112_00945"
                     /EC_number="1.3.99.1"
                     /note="COG1053 Succinate dehydrogenase/fumarate reductase,
                     flavoprotein subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_006226915.1"
                     /db_xref="GI:386753697"
                     /db_xref="GeneID:12772968"
                     /translation="MKITYCDALIIGGGLAGLRASIACKQKGLNTIVLSLVPVRRSHS
                     AAAQGGMQASLANAKKSEGDNEDLHFLDTVKGSDWGCDQQVARMFVTTAPKAIRELAS
                     WGVPWTRIKKGDRPAVVNGEHVTITERDDRHGYILSRDFGGTKKWRTCFTADATGHTM
                     LYAVANEALHHKVDIQDRKDMLAFIHHDNKCYGAVVRDLITGEISAYVSKGTLLATGG
                     YGRVYKHTTNAVICDGAGAASALETGVAKLGNMEAVQFHPTALVPSGILMTEGCRGDG
                     GVLRDKFGRRFMPAYEPEKKELASRDVVSRRILEHIQKGYGAKSPYGDHVWLDIAILG
                     RNHVEKNLRDVRDIAMTFAGIDPADSEEQTKDNMQGMPANEPEYGQAMAKQKGWIPIK
                     PMQHYSMGGVRTNPKGETHLKGLFCAGEAACWDLHGFNRLGGNSVSEAVVAGMIIGDY
                     FASHCLEAQIEINTQKVEAFIKESQDYMHFLLHNEGKEDVYEIKERMKEVMDEKVGVF
                     REGKRLEEALKELQELYARSKNICVKNKVLHNNPELEDAYRTKKMLKLALCITQGALL
                     RTESRGAHTRIDYPKRDDEKWLNRTLASWPSAEQDMPTIEYEELDVMKMEISPDFRGY
                     GKKGNFIPHPKKEERDAEILKTILELEKLGKDRIEVQHALMPFELQEKYKARNMRLED
                     EEVRARGEHLYSFNVHDLLDKHNANLKGEHHE"
     misc_feature    complement(184824..186875)
                     /locus_tag="HPSH112_00945"
                     /note="fumarate reductase flavoprotein subunit;
                     Provisional; Region: PRK08626"
                     /db_xref="CDD:181507"
     misc_feature    complement(185361..186863)
                     /locus_tag="HPSH112_00945"
                     /note="L-aspartate oxidase; Provisional; Region: PRK06175"
                     /db_xref="CDD:180442"
     misc_feature    complement(185004..185396)
                     /locus_tag="HPSH112_00945"
                     /note="Fumarate reductase flavoprotein C-term; Region:
                     Succ_DH_flav_C; pfam02910"
                     /db_xref="CDD:251613"
     gene            complement(186885..187652)
                     /locus_tag="HPSH112_00950"
                     /db_xref="GeneID:12772969"
     CDS             complement(186885..187652)
                     /locus_tag="HPSH112_00950"
                     /EC_number="1.3.99.1"
                     /note="COG2009 Succinate dehydrogenase/fumarate reductase,
                     cytochrome b subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase cytochrome b-556 subunit"
                     /protein_id="YP_006226916.1"
                     /db_xref="GI:386753698"
                     /db_xref="GeneID:12772969"
                     /translation="MQQEEIIEGYYGASKGLKKSGIYAKLDFLQSATGLILALFMIVH
                     MFLVSSILISDEAMYKVAKFFEGSLFLKAGEPAIVSVVATGIILILVVHAFLALRKFP
                     INYRQYKVFKTHKHLMKHGDTSLWFIQALTGFAMFFLASIHLFVMLTEPESIGPHGSS
                     YRFVTQNFWLLYIFLLFAVELHGSIGLYRLAIKWGWFKNVSIQGLRKVKWAMSVFFIV
                     LGLCTYGAYIKKGLENKDNGIKTMQEAIEADGKFHKE"
     misc_feature    complement(186888..187646)
                     /locus_tag="HPSH112_00950"
                     /note="fumarate reductase cytochrome b-556 subunit;
                     Provisional; Region: PRK13553"
                     /db_xref="CDD:237423"
     misc_feature    complement(186960..187577)
                     /locus_tag="HPSH112_00950"
                     /note="Quinol:fumarate reductase (QFR) Type B subfamily,
                     transmembrane subunit;  QFR couples the reduction of
                     fumarate to succinate to the oxidation of quinol to
                     quinone, the opposite reaction to that catalyzed by the
                     related protein, succinate:quinone...; Region:
                     QFR_TypeB_TM; cd00581"
                     /db_xref="CDD:238325"
     misc_feature    complement(order(187047..187049,187071..187076,
                     187086..187088,187275..187277,187299..187304,
                     187311..187313,187353..187355,187572..187574))
                     /locus_tag="HPSH112_00950"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238325"
     misc_feature    complement(order(187074..187076,187083..187085,
                     187095..187097,187107..187109,187254..187256,
                     187275..187277,187362..187364,187371..187376,
                     187542..187544,187551..187553,187560..187565))
                     /locus_tag="HPSH112_00950"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238325"
     misc_feature    complement(order(186981..186983,186993..186995,
                     187137..187139,187167..187169,187176..187178,
                     187212..187214,187224..187226,187521..187523,
                     187533..187535))
                     /locus_tag="HPSH112_00950"
                     /note="distal heme binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238325"
     misc_feature    complement(order(187140..187142,187152..187157,
                     187206..187208,187218..187220,187227..187232,
                     187239..187244,187302..187304,187314..187316,
                     187326..187328,187356..187361))
                     /locus_tag="HPSH112_00950"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238325"
     gene            187866..188570
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /db_xref="GeneID:12772970"
     CDS             187866..188570
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /EC_number="5.3.1.1"
                     /note="COG0149 Triosephosphate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_006226917.1"
                     /db_xref="GI:386753699"
                     /db_xref="GeneID:12772970"
                     /translation="MTKIAMANFKSAMPIFKSHAYLEELEKTLKPQHFDRVFVFPDFL
                     GLLPNSFLHFTLGAQNAYPRDCGAFTGEITSQHLEELKINTLLIGHSERRLLLKESPS
                     FLKEKFDFFKSKNFKIVYCIGEELTTREKGFKAVKEFLNEQLENIDLNYPNLVVAYEP
                     IWAIGTKKSASLEEIYLTHGFLKQILNQKTPLLYGGSVNAQNAKEILGIDSVDGLLIG
                     SASLELENFKTIISFL"
     misc_feature    187872..188561
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    order(187887..187889,187893..187895,188133..188135,
                     188340..188342,188358..188360,188454..188456,
                     188511..188513,188517..188522)
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    order(187887..187889,187896..187898,187992..188000,
                     188004..188006,188013..188015,188040..188042,
                     188094..188096,188103..188108,188139..188144)
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    order(187893..187895,188133..188135,188340..188342)
                     /gene="tpiA"
                     /locus_tag="HPSH112_00955"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            188580..189407
                     /locus_tag="HPSH112_00960"
                     /db_xref="GeneID:12772971"
     CDS             188580..189407
                     /locus_tag="HPSH112_00960"
                     /EC_number="1.3.1.9"
                     /note="COG0623 Enoyl-[acyl-carrier-protein] reductase
                     (NADH)"
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-ACP reductase"
                     /protein_id="YP_006226918.1"
                     /db_xref="GI:386753700"
                     /db_xref="GeneID:12772971"
                     /translation="MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESL
                     EKRVRPIAQELNSPYVYELDVSKEEHFKPLYDSVKKDLGSLDFIVHSVAFAPKEALEG
                     SLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMVHYNVMGL
                     AKAALESAVRYLAVDLGKHNIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN
                     VSLEEVGNAGMYLLSSLSSGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ"
     misc_feature    188580..189356
                     /locus_tag="HPSH112_00960"
                     /note="Enoyl-[acyl-carrier-protein]; Region: FabI;
                     COG0623"
                     /db_xref="CDD:223696"
     misc_feature    188595..189341
                     /locus_tag="HPSH112_00960"
                     /note="Enoyl acyl carrier protein (ACP) reductase (ENR),
                     divergent SDR; Region: ENR_SDR; cd05372"
                     /db_xref="CDD:187630"
     misc_feature    order(188616..188624,188634..188639,188697..188699,
                     188766..188774,188850..188861,188931..188933,
                     189006..189014,189042..189044,189063..189065,
                     189141..189152,189156..189167)
                     /locus_tag="HPSH112_00960"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187630"
     misc_feature    order(188667..188669,188772..188783,188790..188792,
                     188886..188906,188913..188918,188925..188930,
                     188937..188942,188949..188951,188961..188963,
                     188970..188972,189018..189023,189027..189038,
                     189042..189047,189054..189059,189066..189071,
                     189078..189083,189087..189104,189108..189113,
                     189192..189194,189201..189203,189219..189230,
                     189246..189248,189255..189260,189267..189269,
                     189282..189284,189288..189326,189330..189341)
                     /locus_tag="HPSH112_00960"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(188772..188783,188886..188906,188913..188918,
                     188925..188930,188937..188942,188949..188951,
                     188958..188963,188970..188972,189018..189023,
                     189027..189035,189042..189047,189054..189059,
                     189066..189071,189078..189083,189087..189095,
                     189099..189107)
                     /locus_tag="HPSH112_00960"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(188856..188858,188862..188864,189012..189014,
                     189042..189044,189051..189053,189063..189065,
                     189162..189167,189174..189176,189183..189185)
                     /locus_tag="HPSH112_00960"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187630"
     misc_feature    order(188934..188936,189012..189014,189051..189053,
                     189063..189065)
                     /locus_tag="HPSH112_00960"
                     /note="active site"
                     /db_xref="CDD:187630"
     gene            189417..190427
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /db_xref="GeneID:12772972"
     CDS             189417..190427
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /EC_number="2.3.1.-"
                     /note="COG1044 UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase"
                     /protein_id="YP_006226919.1"
                     /db_xref="GI:386753701"
                     /db_xref="GeneID:12772972"
                     /translation="MKLSELLSAYSIETEFSNDFEVHALAELDKATPNDISYIDQARY
                     LKLLKDSKAGAVFIRKKESSKVPKHMQALIVDNPHLAFAKASHAFKIPFFKNPESVNE
                     PKHFKKVTIMPNVIIGEGVEIGENSLIYPGVVIADGVKIGKNCILYPRVILYQNTILE
                     DNVTIHAGSVIGGDGFGYAHTALGEHVKIEHVGIVRIQKNVEIGANTAIDRAVFGETL
                     IKEGVKVDNLVQIGHNCVLGEHSIVVSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEF
                     TQIGGKSAVGKDLPPNTNFAGAIPAMEIHEWHHFLAHLRTNFRKQQKTSLLQKAKGFF
                     KS"
     misc_feature    189429..190388
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase; Region: lipid_A_lpxD; TIGR01853"
                     /db_xref="CDD:233599"
     misc_feature    189468..189683
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="UDP-3-O-[3-hydroxymyristoyl] glucosamine
                     N-acyltransferase, LpxD; Region: LpxD; pfam04613"
                     /db_xref="CDD:252703"
     misc_feature    189741..190340
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD):
                     The enzyme catalyzes the transfer of 3-hydroxymyristic
                     acid or 3-hydroxy-arachidic acid, depending on the
                     organism, from the acyl carrier protein (ACP) to
                     UDP-3-O-acyl-glucosamine to produce UDP-2; Region:
                     LbH_LpxD; cd03352"
                     /db_xref="CDD:100043"
     misc_feature    order(189756..189758,189768..189773,189825..189827,
                     189864..189866,189870..189872,189876..189878,
                     189912..189914,189918..189920,189936..189938,
                     189942..189944,189978..189986,190020..190022,
                     190032..190034,190038..190040,190044..190046,
                     190053..190061,190086..190088,190092..190100,
                     190104..190106,190116..190118,190134..190136,
                     190140..190142,190152..190160,190188..190190,
                     190206..190214,190224..190226,190260..190268,
                     190320..190322,190332..190334)
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100043"
     misc_feature    order(189942..189950,190092..190094,190104..190106,
                     190113..190118,190146..190151,190164..190172,
                     190221..190226,190257..190259)
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="active site"
                     /db_xref="CDD:100043"
     misc_feature    order(189942..189950,190113..190118,190167..190172,
                     190221..190226)
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="UDP-GlcNAc binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100043"
     misc_feature    order(190092..190094,190104..190106,190146..190151,
                     190164..190166,190257..190259)
                     /gene="lpxD"
                     /locus_tag="HPSH112_00965"
                     /note="lipid binding site [chemical binding];
                     lipid-binding site"
                     /db_xref="CDD:100043"
     gene            191011..191652
                     /locus_tag="HPSH112_00970"
                     /db_xref="GeneID:12772973"
     CDS             191011..191652
                     /locus_tag="HPSH112_00970"
                     /note="COG2452 Predicted site-specific
                     integrase-resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase A-OrfA"
                     /protein_id="YP_006226920.1"
                     /db_xref="GI:386753702"
                     /db_xref="GeneID:12772973"
                     /translation="MLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRYKLES
                     LRRINRNAVFNQDELKTIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQDLGS
                     GMNYYKKGLTKLLNLILDNQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVIINKGD
                     ENVRFEEELAKDVLEIITVFSARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA"
     misc_feature    191011..191622
                     /locus_tag="HPSH112_00970"
                     /note="Predicted site-specific integrase-resolvase [DNA
                     replication, recombination, and repair]; Region: COG2452"
                     /db_xref="CDD:225296"
     misc_feature    191014..191157
                     /locus_tag="HPSH112_00970"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cd04761"
                     /db_xref="CDD:133389"
     misc_feature    order(191017..191025,191065..191067,191116..191124)
                     /locus_tag="HPSH112_00970"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     misc_feature    191191..191595
                     /locus_tag="HPSH112_00970"
                     /note="Serine Recombinase (SR) family, IS607-like
                     transposase subfamily, catalytic domain; members contain a
                     DNA binding domain with homology to MerR/SoxR located
                     N-terminal to the catalytic domain. Serine recombinases
                     catalyze site-specific recombination of...; Region:
                     SR_IS607_transposase_like; cd03769"
                     /db_xref="CDD:239738"
     misc_feature    order(191206..191208,191212..191214,191404..191409,
                     191416..191418)
                     /locus_tag="HPSH112_00970"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239738"
     misc_feature    191212..191214
                     /locus_tag="HPSH112_00970"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239738"
     gene            191627..192886
                     /locus_tag="HPSH112_00975"
                     /db_xref="GeneID:12772974"
     CDS             191627..192886
                     /locus_tag="HPSH112_00975"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006226921.1"
                     /db_xref="GI:386753703"
                     /db_xref="GeneID:12772974"
                     /translation="MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENY
                     QLGIKTNHLQLKKEFNALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVS
                     YPKFKKKREFQGSFYIGGDQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATIT
                     QKGDHFYVSISCGVDESEYKRTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDK
                     LTRKLVRISRQLSKKIHPKTKGDKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTS
                     SLIRHSNSFCLESLKVKNMFKNHRLAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTY
                     YPSSKTCSNCQKVKQDLKLKDRIYQCLECGFELDRDINAAINLLKHLVGRVTAEFTPM
                     DLTALLNDLSKNRLATSKVELGIQQKP"
     misc_feature    191645..191773
                     /locus_tag="HPSH112_00975"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    191651..192763
                     /locus_tag="HPSH112_00975"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    191840..192514
                     /locus_tag="HPSH112_00975"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    192563..192763
                     /locus_tag="HPSH112_00975"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            complement(192909..194717)
                     /locus_tag="HPSH112_00980"
                     /db_xref="GeneID:12772975"
     CDS             complement(192909..194717)
                     /locus_tag="HPSH112_00980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226922.1"
                     /db_xref="GI:386753704"
                     /db_xref="GeneID:12772975"
                     /translation="MQAENMDIDLKNLPSTPLYPLKNPTLTPEQLEQKRKELIVDLNQ
                     KSKELTELGLLDKLGGFVGYQTQNAKDREKQLTDLKTQAIDNKLDFKDLPNALKDEYY
                     NNAETSLFNPLKTKNEIAKEDYQKDLQRKEILKKTSQELTKSDKDLIDNDNGFFNNAL
                     DFITGASEADKLKEYKEKEKAKDITKEIQKAYSAFSNIDKNKDFFSLFTSEDKEAQEK
                     AKKDFETIAKNLYHFDSVIYNEKNEPFVVKGDKVYKINDGFIDNFTQSLLNNKFSIAG
                     SVTGGLAGAKYGKSAGALGLVGGAIAGAALGATTGAATDAIITNLALDRENKADEIIR
                     HALSDGALSLATDTLMLGAGKVLKPLAKAPLKLAEMSMPFQFTKNFFTGNAKRASEII
                     ETTLSKEQQQALKEFSARFGGETKINTNNANDFLREKIKSVFKGDESKLNAYDKVKEI
                     LTLDNHKEQQQAFIRAIRSDETGNTLAFLVEAANLSPKANASLKSILNQTTENLTKSL
                     KQFDLKDYEIKSVFDNLEQGTKESYDKALNEIIGKLYDNSYKVNLRESVQDATNLEKF
                     LNDLKAQGEIDPQAKSFLRQIEENVYNPLLQTYKIL"
     gene            complement(194795..196447)
                     /locus_tag="HPSH112_00985"
                     /db_xref="GeneID:12772976"
     CDS             complement(194795..196447)
                     /locus_tag="HPSH112_00985"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226923.1"
                     /db_xref="GI:386753705"
                     /db_xref="GeneID:12772976"
                     /translation="MSWIDISVSPGSSSQGSNAILSGFIQSLGNALNNAHFGGISGFP
                     RQLSNENDQIVGYYDDPNGYYAVSRKFLAQKNYYSNERLKNAFGRLINHQNRINQLTQ
                     EIMDKENAINSLNNEIHHINQEIDKQNQAISNLNQEIANLNNEINALKNAIKQEQEKL
                     NALELETSNKNQIEESLKKLEKLKEELKRLKKKSKWKKQFNFLTDNSSNKEAKQQRAL
                     QASQEHAAFLNFFLTDPYAILPKGFIYEYHNPGKETYNALNAPNNMDGINNQFKVNAL
                     NQVLDNSYQKFLPGNDSYNALGSIEQVKALKFYDLVLNYHPESENTQSALFFKQISQY
                     AKGLRLKILTAKTSKKNLKRIEELEKTIKQEQERLNDKDLNALTQDLQKEQENALKFK
                     ESIKAKQNYINALKNAINQKEHAKNPIEQERQNQQNAKREKEQERQNQQNAKREKEQE
                     RQNLNNEINAIGNERLTIKELGTKDNFLGIQPYFNHTGRTYARAAFSDKNKSIKEYYE
                     VETKIKNILGFYRIGESDERILQRFLQLSPAVQNELALLMLN"
     misc_feature    complement(<195950..>196150)
                     /locus_tag="HPSH112_00985"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     gene            complement(196451..198022)
                     /locus_tag="HPSH112_00990"
                     /db_xref="GeneID:12772977"
     CDS             complement(196451..198022)
                     /locus_tag="HPSH112_00990"
                     /note="COG0358 DNA primase (bacterial type)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase DNA G"
                     /protein_id="YP_006226924.1"
                     /db_xref="GI:386753706"
                     /db_xref="GeneID:12772977"
                     /translation="MKITNLAPLKDRIQIMEVLESYIDFHKVGANFKACCPFHDERSA
                     SFIVSPEKNIYHCFGCGVSGDALKFLQEYKKLSFLEAVEEVAKIYNYHLEYETDAKIE
                     RNNHLKEILAYANNLFKERLKNEPKVLNYLTQTRAISLEMIEAYDLGYCLHGDLEVLK
                     ERFNADDLIACGLFSNKNEDKELRSFCNYRITIPLKDSKGQIRSFSARLCIPRLLKAN
                     NAPKYLNGRETSLYNKTFFLYNYHRALESIKEKKQVIICEGFFDVLAYEHFYYKNAIC
                     TSGTAFTKEHLAFLNKLNVELCFSFDNDNAGTEATIRALDLCLKNHVTNMSVIKIKDS
                     SVKDLSDYQKLNRRPNLAKINGFKFYCSYLLRAELTTPQKDLNYRNILKILEAFEPFM
                     QADLLKILNSFLAQKSVKPVKQKNLPGKLDLLEARVYATMLESEEFRYIARRFLTPSD
                     VKYPTFFKRIVCSDFRGLDFLKKFKTIPESYQKSSLVWLKTKGLKNSLAVALDCKDYA
                     LAEAINAKIKEIQKD"
     misc_feature    complement(197729..198007)
                     /locus_tag="HPSH112_00990"
                     /note="CHC2 zinc finger; Region: zf-CHC2; cl17510"
                     /db_xref="CDD:248064"
     misc_feature    complement(197288..197686)
                     /locus_tag="HPSH112_00990"
                     /note="DNA primase catalytic core, N-terminal domain;
                     Region: Toprim_N; pfam08275"
                     /db_xref="CDD:254701"
     misc_feature    complement(197060..197269)
                     /locus_tag="HPSH112_00990"
                     /note="TOPRIM_DnaG_primases: The topoisomerase-primase
                     (TORPIM) nucleotidyl transferase/hydrolase domain found in
                     the active site regions of proteins similar to Escherichia
                     coli DnaG. Primases synthesize RNA primers for the
                     initiation of DNA replication. DnaG...; Region:
                     TOPRIM_DnaG_primases; cd03364"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(197105..197107,197111..197113,
                     197117..197119,197237..197239,197246..197251))
                     /locus_tag="HPSH112_00990"
                     /note="active site"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(197117..197119,197249..197251))
                     /locus_tag="HPSH112_00990"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173784"
     misc_feature    complement(order(197189..197191,197219..197224,
                     197240..197245))
                     /locus_tag="HPSH112_00990"
                     /note="interdomain interaction site; other site"
                     /db_xref="CDD:173784"
     gene            complement(198019..199194)
                     /locus_tag="HPSH112_00995"
                     /db_xref="GeneID:12772978"
     CDS             complement(198019..199194)
                     /locus_tag="HPSH112_00995"
                     /note="COG0468 RecA/RadA recombinase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226925.1"
                     /db_xref="GI:386753707"
                     /db_xref="GeneID:12772978"
                     /translation="MENLIMKSFLDYPQHIEDFLKDISVKSFNPFNQKLIKVLIEMNQ
                     RNQVPRLETIKLRIAEKEFQSEEFKRILEADSYPDYLNLKSDFKTYLCFQMQEHLANK
                     LKEATRKSEVFDYEFLNKYINLGIVRSGKYFWEWEEYFKNKPPIEKIETGINYLDIIT
                     EGGIELGQIVLLSGDPEAGKTLLGVQFLMNAQQQHKVTYFGFEFSVRKHIETLRNKNF
                     NIKADNYFIDDQSCELNDLISQIRSLSKEGHKVFLIDSQMKIQAPIVGRTIEEIETSK
                     FSALGETARSLQVLIILIVQNSKNDSYTPTGSRKGGHEAHLMIRIERIKRNELPHLKD
                     FNERAKHRRIVILKNKQTGLSGYRYVKNVDYRFFEVDYNGSGQQFQHDEHEEYGGLI"
     misc_feature    complement(198151..198759)
                     /locus_tag="HPSH112_00995"
                     /note="RecA-superfamily ATPases implicated in signal
                     transduction [Signal transduction mechanisms]; Region:
                     RAD55; COG0467"
                     /db_xref="CDD:223543"
     misc_feature    complement(<198625..198750)
                     /locus_tag="HPSH112_00995"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(198655..198660,198670..198675))
                     /locus_tag="HPSH112_00995"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(198427..198432,198589..198594,
                     198598..198600,198655..198660,198670..198672))
                     /locus_tag="HPSH112_00995"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(198430..198444)
                     /locus_tag="HPSH112_00995"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(199205..199471)
                     /locus_tag="HPSH112_01000"
                     /db_xref="GeneID:12772979"
     CDS             complement(199205..199471)
                     /locus_tag="HPSH112_01000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226926.1"
                     /db_xref="GI:386753708"
                     /db_xref="GeneID:12772979"
                     /translation="MRRHGNDRTALIKELLLTKRKKISLRDSNLKELKRLKRKNNYKL
                     AQIVRLAILKGLKQFKNENLLVHLTLKEFDSFLEILEEKNQKKR"
     gene            complement(199663..200613)
                     /locus_tag="HPSH112_01005"
                     /db_xref="GeneID:12772980"
     CDS             complement(199663..200613)
                     /locus_tag="HPSH112_01005"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226927.1"
                     /db_xref="GI:386753709"
                     /db_xref="GeneID:12772980"
                     /translation="MNYILKQPMKFGYTQISNEICEDERVSDIAIAIYAYIKKHATTF
                     KLCIEDIAKRFNRNTKTIYKYLNELKDLGYIEFERERKKDGTFSKFFRFIMGNFSKKQ
                     AQKSAKKDAIHKENISVWINPQKQASNADDTEAQSMSTYFPSFTLKRKNKNKHENIRS
                     SENFSTKKFDEKQQVFSNDRDLKDSVKDSSLKSSNISNFSLFDRFSAFFSSILGNLDT
                     KHLNQYERLAFEEFLNYRSEKHKLSYSTKKALLHQCEALKAQGYDLVACINQSIRRNY
                     NEIYEVMHFEKPSCQSKAKGEEVMDQFEYNDCYNGFIFGR"
     misc_feature    complement(<200365..200535)
                     /locus_tag="HPSH112_01005"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(200377..200385,200401..200406,
                     200410..200415,200422..200427,200431..200442,
                     200467..200475,200524..200532))
                     /locus_tag="HPSH112_01005"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(200464..200466,200473..200475))
                     /locus_tag="HPSH112_01005"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(200610..200918)
                     /locus_tag="HPSH112_01010"
                     /db_xref="GeneID:12772981"
     CDS             complement(200610..200918)
                     /locus_tag="HPSH112_01010"
                     /codon_start=1
                     /transl_table=11
                     /product="Hac prophage II protein"
                     /protein_id="YP_006226928.1"
                     /db_xref="GI:386753710"
                     /db_xref="GeneID:12772981"
                     /translation="MTQEKLKPIDLEVLIALNKKAYLPKTADKISKDLRIDYYYTLNI
                     FKKLEAKGLCIQWIINKKKEKEKKNNYYKVCCLSDFGKDLCTYLKALKSVKTKKKDQQ
                     "
     gene            complement(200921..201127)
                     /locus_tag="HPSH112_01015"
                     /db_xref="GeneID:12772982"
     CDS             complement(200921..201127)
                     /locus_tag="HPSH112_01015"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226929.1"
                     /db_xref="GI:386753711"
                     /db_xref="GeneID:12772982"
                     /translation="MSKKETNMEIFQYLAYQTIKESNTDLSFFDFIQKLEKLQKTHTI
                     RSSVCNVRNKRVTSYSILLQKKAV"
     misc_feature    complement(201124..202270)
                     /note="potential frameshift: common BLAST hit:
                     gi|384892219|ref|YP_005766312.1| bacteriophage-related
                     integrase"
     gene            complement(201124..201897)
                     /locus_tag="HPSH112_01020"
                     /db_xref="GeneID:12772983"
     CDS             complement(201124..201897)
                     /locus_tag="HPSH112_01020"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage-related integrase"
                     /protein_id="YP_006226930.1"
                     /db_xref="GI:386753712"
                     /db_xref="GeneID:12772983"
                     /translation="MGLKESDKLKKITKEKIAQYHQATLTLYRKNTIHNFNANLKSFL
                     AFCERERFLPQNPYYTITLKNALAAKAIEPFSLEEVKTLIENAPTLRLKAFLVVAFFT
                     GARTGEQLALQWKDIDFKEKTITINKSLNELGEITSPKNKPSIREVDLLEPVEKILKE
                     LKESEPDTKKFVFIDMPKRSSIFQRHFKKLLKALNLKDRKLYTTRHTFASLMLSQGEE
                     PMWISRTLGHKDLNTTYSTYSHYIPKQDKERAKFTKELL"
     misc_feature    complement(201127..201891)
                     /locus_tag="HPSH112_01020"
                     /note="Integrase [DNA replication, recombination, and
                     repair]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    complement(201163..201675)
                     /locus_tag="HPSH112_01020"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(201184..201186,201292..201300,
                     201478..201480,201580..201585))
                     /locus_tag="HPSH112_01020"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(201184..201186,201214..201216,
                     201283..201285,201292..201294,201478..201480,
                     201583..201585))
                     /locus_tag="HPSH112_01020"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(201184..201186,201214..201216,
                     201283..201285,201292..201294,201583..201585))
                     /locus_tag="HPSH112_01020"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            complement(201935..202270)
                     /locus_tag="HPSH112_01025"
                     /db_xref="GeneID:12772984"
     CDS             complement(201935..202270)
                     /locus_tag="HPSH112_01025"
                     /codon_start=1
                     /transl_table=11
                     /product="bacteriophage-related integrase"
                     /protein_id="YP_006226931.1"
                     /db_xref="GI:386753713"
                     /db_xref="GeneID:12772984"
                     /translation="MNTFTLYTRDYKGEATLYLNYHDNKNKRFRVSLRKATDCLKMDT
                     DTALEYFKDKKLKEILAFVNRLEAIKNANKRVKNAEKQTHRIQSKITHTSSVKSFSIV
                     KNRTKTNEP"
     misc_feature    complement(<201995..>202228)
                     /locus_tag="HPSH112_01025"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: RtcB; cl17455"
                     /db_xref="CDD:266696"
     gene            complement(202382..202681)
                     /locus_tag="HPSH112_01030"
                     /db_xref="GeneID:12772985"
     CDS             complement(202382..202681)
                     /locus_tag="HPSH112_01030"
                     /codon_start=1
                     /transl_table=11
                     /product="Hac prophage II protein"
                     /protein_id="YP_006226932.1"
                     /db_xref="GI:386753714"
                     /db_xref="GeneID:12772985"
                     /translation="MRQKRETETSFNQLKEITQSIQAHQALKTNQNANVSELTPKRAA
                     QEPKRRAQGNCVLKPTKKTFSERQKTTIREPIQESANARTKTKEANQKGDNNAKA"
     gene            202980..204137
                     /locus_tag="HPSH112_01035"
                     /db_xref="GeneID:12772986"
     CDS             202980..204137
                     /locus_tag="HPSH112_01035"
                     /EC_number="2.5.1.6"
                     /note="COG0192 S-adenosylmethionine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="YP_006226933.1"
                     /db_xref="GI:386753715"
                     /db_xref="GeneID:12772986"
                     /translation="MKDSFLFTSESVTEGHPDKMADQISDAVLDYIIERDQKAKVACE
                     TLVSNGFCMITGELKTSVYAPMQEIAREVVKKIGYTDALYGFDYRSAAVLNGIGEQSP
                     DINQGVDREDGEIGAGDQGLMFGYACKETETLMPLPIHLAHQLTFALAQKRKDNTLPF
                     LRPDGKSQVSVRYENNKPVSIDTIVVSTQHSPEVSQKHLKEAVIEEIVYKVLPKEYLH
                     DNIKFFVNPTGKFVIGGPQGDAGLTGRKIIVDTYGGSCPHGGGAFSGKDPSKVDRSAA
                     YAARYVAKNLVASGVCDKATVQLAYAIGVIEPVSVYVNTHNTSKHSSAELEKCVRSVF
                     KLTPKGIIESLDLLRPIYSLTSAYGHFGRELEEFTWEKTNKTEEIQAFFKR"
     misc_feature    202989..204131
                     /locus_tag="HPSH112_01035"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    202989..203285
                     /locus_tag="HPSH112_01035"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    203316..203672
                     /locus_tag="HPSH112_01035"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    203676..204095
                     /locus_tag="HPSH112_01035"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            204204..204617
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /db_xref="GeneID:12772987"
     CDS             204204..204617
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /EC_number="2.7.4.6"
                     /note="COG0105 Nucleoside diphosphate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="mulitfunctional nucleoside diphosphate
                     kinase/apyrimidinic endonuclease/3'-phosphodiesterase"
                     /protein_id="YP_006226934.1"
                     /db_xref="GI:386753716"
                     /db_xref="GeneID:12772987"
                     /translation="MKQRTLSIIKPDALKKKVVGKIIDRFESNGLEVIAMKRLHLSVK
                     DAENFYAIHKERPFFKDLIEFMVSGPVVVMVLEGKDAVAKNRDLMGATDPKLAQKGTI
                     RADFAESIDANAVHGSDSLENAHNEIAFFFAARDL"
     misc_feature    204210..204614
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /note="Nucleoside diphosphate kinase; Region: NDK;
                     pfam00334"
                     /db_xref="CDD:249778"
     misc_feature    204210..204599
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /note="Nucleoside diphosphate kinase Group I
                     (NDPk_I)-like: NDP kinase domains are present in a large
                     family of structurally and functionally conserved proteins
                     from bacteria to humans that generally catalyze the
                     transfer of gamma-phosphates of a nucleoside...; Region:
                     NDPk_I; cd04413"
                     /db_xref="CDD:239876"
     misc_feature    order(204231..204233,204351..204353,204375..204377,
                     204459..204461,204477..204479,204510..204512,
                     204540..204542,204549..204551,204555..204560,
                     204582..204584)
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /note="active site"
                     /db_xref="CDD:239876"
     misc_feature    order(204243..204245,204258..204266,204273..204275,
                     204282..204284,204309..204317)
                     /gene="ndk"
                     /locus_tag="HPSH112_01040"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239876"
     gene            204642..204998
                     /locus_tag="HPSH112_01045"
                     /db_xref="GeneID:12772988"
     CDS             204642..204998
                     /locus_tag="HPSH112_01045"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226935.1"
                     /db_xref="GI:386753717"
                     /db_xref="GeneID:12772988"
                     /translation="MQFEMRKIAFNVPKAFSLEHEGVVLEGEVVRVGAKLFRLEARLK
                     GELMLVCDTSGKEFKKSLDESLVLHISDGLWDTQSQSLDFDNLDVIESFNGFIDLSEI
                     LRSEVESIRLDYHYAD"
     misc_feature    204756..>204962
                     /locus_tag="HPSH112_01045"
                     /note="Uncharacterized ACR, COG1399; Region: DUF177;
                     cl00616"
                     /db_xref="CDD:260535"
     gene            205014..205160
                     /gene="rpmF"
                     /locus_tag="HPSH112_01050"
                     /db_xref="GeneID:12772989"
     CDS             205014..205160
                     /gene="rpmF"
                     /locus_tag="HPSH112_01050"
                     /note="COG0333 Ribosomal protein L32"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="YP_006226936.1"
                     /db_xref="GI:386753718"
                     /db_xref="GeneID:12772989"
                     /translation="MAVPDRRVSKTRAAKRRTHYSVKLAKPIKAKDGTWKLPHHINKF
                     TKEY"
     misc_feature    205014..205157
                     /gene="rpmF"
                     /locus_tag="HPSH112_01050"
                     /note="Ribosomal protein L32 [Translation, ribosomal
                     structure and biogenesis]; Region: RpmF; COG0333"
                     /db_xref="CDD:223410"
     gene            205228..206247
                     /locus_tag="HPSH112_01055"
                     /db_xref="GeneID:12772990"
     CDS             205228..206247
                     /locus_tag="HPSH112_01055"
                     /note="COG0416 Fatty acid/phospholipid biosynthesis
                     enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphate acyltransferase"
                     /protein_id="YP_006226937.1"
                     /db_xref="GI:386753719"
                     /db_xref="GeneID:12772990"
                     /translation="MKIVIDLMGADHGVLPIIEGVSRALENKSFSAVLVGDKDKATPF
                     ISKELASKVEMIHTQDYIKMEEAATEAIKRKESSIYLGMDILKNGADALISAGHSGAT
                     MGLATLRLGRIKGVERPAICTLMPSVGKRPSVLLDAGANTDCKPEYLIDFALMGYEYA
                     KSVLHYDSPKVGLLSNGEEDIKGNMLVKETHKMLKAYDFFYGNVEGSDIFKGVVDVVV
                     CDGFMGNVVLKTTEGVASAIGSIFKDEIKSSFKSKMGALMLKNAFDILKQKTDYAEYG
                     GAPLLGVNKSVIISHGKSNARAIECAIYQAISTVESQVCLRITKAFESLKPSVSVPQS
                     DQQDA"
     misc_feature    205252..206205
                     /locus_tag="HPSH112_01055"
                     /note="fatty acid/phospholipid synthesis protein PlsX;
                     Region: plsX; TIGR00182"
                     /db_xref="CDD:129286"
     gene            206271..207266
                     /locus_tag="HPSH112_01060"
                     /db_xref="GeneID:12772991"
     CDS             206271..207266
                     /locus_tag="HPSH112_01060"
                     /EC_number="2.3.1.180"
                     /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
                     III"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="YP_006226938.1"
                     /db_xref="GI:386753720"
                     /db_xref="GeneID:12772991"
                     /translation="MEFYASLKSIAMHVPSERVKNAEFQQFLDTSDEWIEKRTGIKER
                     RFANDEEKSSDLGVIAAKQAIERAHLTPKDIDLVVVATLSPDFLAMPSTACVLSAKLG
                     IENKPAFDISAACTGFIYLLSVAKAYVESGMYENVLIVGAEKTSSVLDFKDRGTCILF
                     GDGAGACVIGRTKRLKESVLDVQISANGNFSNYLYTPRTLKPTPFNAKEEASEPFLCM
                     KGNEVFKLAVKTLLKDVEMILEKNALKPEDVRLFIPHQANFRIIQAVREHLDFKDEQV
                     VLTVHKYGNTSAASIPMAMCEAYEEGRLKKGDLMLLDAFGGGLTWGSALVYFGGS"
     misc_feature    206277..207254
                     /locus_tag="HPSH112_01060"
                     /note="3-oxoacyl-(acyl-carrier-protein) synthase III;
                     Region: fabH; TIGR00747"
                     /db_xref="CDD:233113"
     misc_feature    206280..207248
                     /locus_tag="HPSH112_01060"
                     /note="Ketoacyl-acyl carrier protein synthase III (KASIII)
                     initiates the elongation in type II fatty acid synthase
                     systems. It is found in bacteria and plants. Elongation of
                     fatty acids in the type II systems occurs by Claisen
                     condensation of malonyl-acyl...; Region: KAS_III; cd00830"
                     /db_xref="CDD:238426"
     misc_feature    order(206517..206519,206523..206525,206553..206555,
                     206562..206564,206586..206606,206628..206630,
                     206637..206642,206649..206654,206709..206711,
                     206820..206837,206853..206858,207222..207224)
                     /locus_tag="HPSH112_01060"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238426"
     misc_feature    order(206613..206615,207033..207035,207123..207125)
                     /locus_tag="HPSH112_01060"
                     /note="active site"
                     /db_xref="CDD:238426"
     misc_feature    207042..207044
                     /locus_tag="HPSH112_01060"
                     /note="CoA binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238426"
     gene            207288..207590
                     /locus_tag="HPSH112_01065"
                     /db_xref="GeneID:12772992"
     CDS             207288..207590
                     /locus_tag="HPSH112_01065"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226939.1"
                     /db_xref="GI:386753721"
                     /db_xref="GeneID:12772992"
                     /translation="MKKMIFLFLVVLGGLEAQSTYCSDHCEGTPDSRIPPMGFYFSFA
                     HSVKYYLQDPQERDHKLEKCHKAFDSTLKVNFITKSFKKDCKHAQMALEQSQQKTP"
     gene            complement(207887..208270)
                     /locus_tag="HPSH112_01070"
                     /db_xref="GeneID:12772993"
     CDS             complement(207887..208270)
                     /locus_tag="HPSH112_01070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226940.1"
                     /db_xref="GI:386753722"
                     /db_xref="GeneID:12772993"
                     /translation="MFKKMCLSLLMISSVCVGAKDLDFKLDYRATGGKLMGKMTDSSL
                     LSITSMNDEPVVIKNLIVNRGNSCEATKKVEPKLGDKFKKEKLFDHELKYSQQIFYRL
                     NCKPNQLLEVKIITDKGEYYHKFSQ"
     STS             211006..212105
                     /standard_name="ha2440"
                     /db_xref="UniSTS:515549"
     gene            211542..212648
                     /locus_tag="HPSH112_01085"
                     /db_xref="GeneID:12772994"
     CDS             211542..212648
                     /locus_tag="HPSH112_01085"
                     /note="COG0489 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_006226941.1"
                     /db_xref="GI:386753723"
                     /db_xref="GeneID:12772994"
                     /translation="MLTQEDVLNALKTIIYPNFEKDIVSFGFVKNIALHDNQLGLLIE
                     IPSSSEETSAILREDISKAMQKIGVKALNLDIKTPPKPQAPKPTTKNLAKNIKHVVMI
                     SSGKGGVGKSTTSVNLSIALANLNQKVGLLDADVYGPNIPRMMGLQNADVIMDPSGKK
                     LIPLKAFGVSVMSMGLLYDEGQSLIWRGPMLMRAIEQMLSDIIWGDLDVLVVDMPPGT
                     GDAQLTLAQAVPLSAGITVTTPQIVSLDDAKRSLDMFKKLHIPIAGIVENMGSFVCEH
                     CKKESEIFGSNSMNELLEAYHTQILAKLPLEPKVRLGGDRGEPIVISHPNSVSAKIFE
                     KMAQDLSAFLERVEKEKLADNKDIQPTQTHACSH"
     misc_feature    211551..212573
                     /locus_tag="HPSH112_01085"
                     /note="antiporter inner membrane protein; Provisional;
                     Region: PRK11670"
                     /db_xref="CDD:183270"
     misc_feature    211554..211742
                     /locus_tag="HPSH112_01085"
                     /note="Domain of unknown function DUF59; Region: DUF59;
                     pfam01883"
                     /db_xref="CDD:250939"
     misc_feature    211785..>212066
                     /locus_tag="HPSH112_01085"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    211836..212465
                     /locus_tag="HPSH112_01085"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    211854..211877
                     /locus_tag="HPSH112_01085"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     gene            complement(212664..213683)
                     /locus_tag="HPSH112_01090"
                     /db_xref="GeneID:12772995"
     CDS             complement(212664..213683)
                     /locus_tag="HPSH112_01090"
                     /note="COG1442 Lipopolysaccharide biosynthesis proteins,
                     LPS:glycosyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide 1,2-glycosyltransferase"
                     /protein_id="YP_006226942.1"
                     /db_xref="GI:386753724"
                     /db_xref="GeneID:12772995"
                     /translation="MVEGLSLENVAKLEETIAPFSAFSSIEFLDITDEELEPRHNYYK
                     LDPLIAGGIKKLYLKLNSFSQKRFSKMIMCRFFFASLFPQYEKMIMFDVDTLFVGDIS
                     ESFFIPLDDHYFGAVREKDLIAMNRNSAKDLYELRQMHAKTIGVADAFPNLKEAQILF
                     DNYFNAGFLALNLKSWRKENLENQLIGFFLLKNEKLLFNDQDTLCFVCRGRILELPYS
                     YNAHPSFLDTPSFPSVKEARMLHFWGDKPWKLFSVIGAKKWHEALIQTPFKDAYFNAP
                     FLDHLFESLQNRDKEIHALNKILSFSDKRHSFESLLPRLSSKLLIEFLLFKAKQKVKR
                     LIKRV"
     misc_feature    complement(212670..213680)
                     /locus_tag="HPSH112_01090"
                     /note="Lipopolysaccharide biosynthesis proteins,
                     LPS:glycosyltransferases [Cell envelope biogenesis, outer
                     membrane]; Region: RfaJ; COG1442"
                     /db_xref="CDD:224359"
     misc_feature    complement(212937..213680)
                     /locus_tag="HPSH112_01090"
                     /note="Glycosyl transferase family 8; Region:
                     Glyco_transf_8; pfam01501"
                     /db_xref="CDD:250666"
     gene            complement(213707..213826)
                     /locus_tag="HPSH112_01095"
                     /db_xref="GeneID:12772996"
     CDS             complement(213707..213826)
                     /locus_tag="HPSH112_01095"
                     /codon_start=1
                     /transl_table=11
                     /product="LPS 1,2-glycosyltransferase"
                     /protein_id="YP_006226943.1"
                     /db_xref="GI:386753725"
                     /db_xref="GeneID:12772996"
                     /translation="MQEIVPIVVTFDNNYCIPAGVSLFSMLANAKRERERERE"
     misc_feature    complement(<213734..213820)
                     /locus_tag="HPSH112_01095"
                     /note="Lipopolysaccharide biosynthesis proteins,
                     LPS:glycosyltransferases [Cell envelope biogenesis, outer
                     membrane]; Region: RfaJ; COG1442"
                     /db_xref="CDD:224359"
     misc_feature    complement(<213734..213811)
                     /locus_tag="HPSH112_01095"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            213984..215336
                     /locus_tag="HPSH112_01100"
                     /db_xref="GeneID:12772997"
     CDS             213984..215336
                     /locus_tag="HPSH112_01100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226944.1"
                     /db_xref="GI:386753726"
                     /db_xref="GeneID:12772997"
                     /translation="MLNQKVWLGLLALHGVFLNAFEYQISARVGSFSRIAFNQSVINS
                     KKGIYPTGSYVTTTGALQVDSSLLPKGIENHKLGFGVGGEIGSLAYDSTKFLIDEADP
                     KAGFQPANWYYMGRWEGYLMQHSQNWTREQKAQNARPYVLYNLYLDYQYKDIFGIKLG
                     RYPSKALFLSGFNQGFELFYRWKKFRIEWFSTFGRALANEQSIRDFYAPVNYKQKTNY
                     GMHNLNLIYENKYIRVAPFIWFYPKNFNAPGFEITHDTKSYWKSDWRIQTTFYAWFPL
                     YSDYLSKDYYRASLIGKKSASLFVFQRVHFRSYRFGWSVYKNFGNGSAQLGWNGSPVD
                     PFYDTKDDTPYEDAYSNFYNANSITINAFIGKSIKNLLVQLYGKLTYSPRADSQSLGV
                     TFKYNLKKHIYLMLMFNGYQITMHKGYKVGFFTSGYNPDFAQTIQDRSYFMSSMSYRF
                     "
     misc_feature    213984..215333
                     /locus_tag="HPSH112_01100"
                     /note="Putative outer membrane protein; Region: HP_OMP_2;
                     pfam02521"
                     /db_xref="CDD:251350"
     gene            215388..217253
                     /locus_tag="HPSH112_01105"
                     /db_xref="GeneID:12772998"
     CDS             215388..217253
                     /locus_tag="HPSH112_01105"
                     /note="COG0326 Molecular chaperone, HSP90 family"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein 90"
                     /protein_id="YP_006226945.1"
                     /db_xref="GI:386753727"
                     /db_xref="GeneID:12772998"
                     /translation="MSNQEYTFQTEINQLLDLMIHSLYSNKEIFLRELISNASDALDK
                     LNYLMLTDEKLKGLNITPGIHLSFDSQKKTLTIKDNGIGMDKNDLIEHLGTIAKSGTK
                     SFLSALSGDKKKDSALIGQFGVGFYSAFMVASKIVVQTKKVNSDQAYAWVSDGKGKFE
                     ISECVKEEQGTEITLFLKDEDSHFASRWEIDSVVKKYSEHIPFPIFLTYTDTKYEGEG
                     DNQKEIKEEKCDQINQASALWKMNKSELKDKDYKEFYQSFAHDNSEPLSYIHNKVEGS
                     LEYTTLFYIPSKAPFDMFRVDYKSGVKLYVKRVFITDDDKELLPSYLRFVKGVIDSED
                     LPLNVSREILQQNKILANIRSASVKKILSEIERLSKDEKNYHKFYEPFGKVLKEGLYG
                     DFENKEKLLELLRFYSKDKEKLVSLKEYKENLKENQKSIYYLLGENLDLLKASPLLEK
                     YAQKGYDVLLLSDEIDAFVMPGVNEYDKTPFKDASHSESLKELGLEEINDEVKERFKD
                     LMKAFEENLKDEVKGVELSSHLTSAVALIGDEQNAMMANWMRQMGQSVPENKKTLELN
                     PNHAILQKLLKCEDKEQLSAFIWLLYDGAKLLEKGALKDAKSFNERLNSVLLKAL"
     misc_feature    215388..217250
                     /locus_tag="HPSH112_01105"
                     /note="heat shock protein 90; Provisional; Region:
                     PRK05218"
                     /db_xref="CDD:235366"
     misc_feature    215469..215918
                     /locus_tag="HPSH112_01105"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(215484..215486,215496..215498,215505..215507,
                     215616..215618,215622..215624,215628..215630,
                     215634..215639,215754..215765,215868..215870,
                     215880..215882,215895..215900,215904..215906)
                     /locus_tag="HPSH112_01105"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    215496..215498
                     /locus_tag="HPSH112_01105"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(215628..215630,215634..215636,215754..215756,
                     215760..215762)
                     /locus_tag="HPSH112_01105"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    215955..217250
                     /locus_tag="HPSH112_01105"
                     /note="Hsp90 protein; Region: HSP90; pfam00183"
                     /db_xref="CDD:249661"
     gene            complement(217444..218202)
                     /locus_tag="HPSH112_01110"
                     /db_xref="GeneID:12772999"
     CDS             complement(217444..218202)
                     /locus_tag="HPSH112_01110"
                     /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226946.1"
                     /db_xref="GI:386753728"
                     /db_xref="GeneID:12772999"
                     /translation="MLGSVKKTLFGVLCLGALCLRGLMAEPDAKELVNLGIESAKKQD
                     FTQAKTHFEKACELKDGFGCVFLGAFYEEGKGVGKDLKKAVQFYTKGCELNDGYGCRL
                     LGNLYYNGQGVPKDAKKASQYYSKSCELNHAEGCMVLGSLYHHGVGTPKDSRKALDLY
                     EKACDLKDSPGCINAGYIYGIAKNFKEAIVRYSKACELNDGRGCYNLGVMQYNGQGTA
                     KDEKQAVENFKKGCKSGVKEACDALKELKIELWF"
     misc_feature    complement(217459..218202)
                     /locus_tag="HPSH112_01110"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(217810..218115)
                     /locus_tag="HPSH112_01110"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(217873..217878,217885..217890,
                     217897..217902,217984..217989,217996..218001,
                     218089..218094,218101..218106,218110..218115))
                     /locus_tag="HPSH112_01110"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(217822..217824,217831..217833,
                     217843..217845,217891..217893,217930..217932,
                     217939..217941,217951..217953,217999..218001,
                     218038..218040,218047..218049,218059..218061,
                     218095..218097))
                     /locus_tag="HPSH112_01110"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(217504..217752)
                     /locus_tag="HPSH112_01110"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(217510..217512,217519..217521,
                     217531..217533,217579..217581,217618..217620,
                     217627..217629,217639..217641,217675..217677,
                     217714..217716,217723..217725,217735..217737))
                     /locus_tag="HPSH112_01110"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(217549..217551,217564..217566,
                     217573..217578,217585..217590,217660..217665,
                     217672..217677,217681..217686))
                     /locus_tag="HPSH112_01110"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(218288..219469)
                     /locus_tag="HPSH112_01115"
                     /db_xref="GeneID:12773000"
     CDS             complement(218288..219469)
                     /locus_tag="HPSH112_01115"
                     /note="COG0624 Acetylornithine
                     deacetylase/Succinyl-diaminopimelate desuccinylase and
                     related deacylases"
                     /codon_start=1
                     /transl_table=11
                     /product="succinyl-diaminopimelate desuccinylase"
                     /protein_id="YP_006226947.1"
                     /db_xref="GI:386753729"
                     /db_xref="GeneID:12773000"
                     /translation="MDALEITQKLISYPTITPKECGIFEYIKSLFPTFKALECGENGV
                     KNLFLYRIFNPPKEHTEEKHAKEKHAKKEHAKESVKPLHFCFAGHIDVVPPGNHWQSD
                     PFKPIIKEGFLYGRGAQDMKGGVGAFLSASLNFNPKTPFMLSVLLTSDEEGPGIFGTR
                     LMLEKLKEKDLLPHMAVVAEPTCEKILGDSIKIGRRGSINGKLILKGTQGHVAYPQKC
                     QNPIDALASVLPLISGVHLDDGDEYFDPSKLVITNLHAGLGANNVTPASVEIIFNARH
                     SLKTTKESLKEYLEKVLKSVPHALELESSSSPFITASHSKLASVLKENILKTCHTTPL
                     LNTKGGTSDARFFSAHGIEVVEFGVINDRIHAIDERVSLKELELLEKVFLGVLENLSE
                     K"
     misc_feature    complement(218300..219469)
                     /locus_tag="HPSH112_01115"
                     /note="succinyl-diaminopimelate desuccinylase; Reviewed;
                     Region: PRK13009"
                     /db_xref="CDD:237265"
     misc_feature    complement(218309..219460)
                     /locus_tag="HPSH112_01115"
                     /note="M20 Peptidase proteobacterial DapE encoded
                     N-succinyl-L,L-diaminopimelic acid desuccinylase; Region:
                     M20_DapE_proteobac; cd03891"
                     /db_xref="CDD:193511"
     misc_feature    complement(order(218375..218377,218930..218932,
                     219014..219019,219110..219112,219203..219205))
                     /locus_tag="HPSH112_01115"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193511"
     misc_feature    complement(order(218453..218455,218645..218647,
                     218651..218653,218675..218680,218699..218722,
                     218726..218728,218771..218773,218780..218785,
                     218789..218794,218801..218806,218810..218812,
                     218828..218839,218870..218872))
                     /locus_tag="HPSH112_01115"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193511"
     gene            complement(219480..221345)
                     /locus_tag="HPSH112_01120"
                     /db_xref="GeneID:12773001"
     CDS             complement(219480..221345)
                     /locus_tag="HPSH112_01120"
                     /note="COG0445 NAD/FAD-utilizing enzyme apparently
                     involved in cell division"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein GidA"
                     /protein_id="YP_006226948.1"
                     /db_xref="GI:386753730"
                     /db_xref="GeneID:12773001"
                     /translation="MVKESDILVIGGGHAGIEASLIAAKMGARVHLITMLIDTIGLAS
                     CNPAIGGLGKGHLTKEVDVLGGAMGIITDNSGLQYRVLNASKGPAVRGTRAQIDMDTY
                     RIFARNLVLNTPNLSVSQEMTESLIIENDEMVGVTTNINNTYKAKKVIITTGTFLKGV
                     VHIGEHQNQNGRFGENASNSLALNLRELGFKVERLKTGTCPRVAGNSIDFEGLEEHFG
                     DTNPPYFSYKTKDFNPTQLSCFITYTNPITHQIIRDNFHRAPLFSGQIEGIGPRYCPS
                     IEDKINRFSEKERHQLFLEPQTIHKSEYYINGLSTSLPLDVQEKVIHSIKGLENALIT
                     RYGYAIEYDFIQPTELTHTLETKKIKGLYLAGQINGTTGYEEAAAQGLMAGINAVLAL
                     KNQDPFILKRNEAYIGVLIDDLITKGTNEPYRMFTSRAEYRLLLREDNTLFRLGEHAY
                     RLGLMEEDFYKGLKKDQQEIQDNLKRLKECVLTPSKEVLKRLNELDENPINDKVDGVS
                     LLARDSFNLEKMRSFFSFLTPLNERVLEQIKIECKYNIYIEKQHENIAKMDSMLKVSI
                     PKGFVFKGIPGLSLEAVEKLEKFRPKSLFEASEISGITPANLDVLHLYIHLRKNS"
     misc_feature    complement(220092..221342)
                     /locus_tag="HPSH112_01120"
                     /note="NAD(FAD)-utilizing enzyme possibly involved in
                     translation [Translation, ribosomal structure and
                     biogenesis]; Region: Gid; COG1206"
                     /db_xref="CDD:224127"
     misc_feature    complement(219489..221333)
                     /locus_tag="HPSH112_01120"
                     /note="glucose-inhibited division protein A; Region: gidA;
                     TIGR00136"
                     /db_xref="CDD:129242"
     misc_feature    complement(219513..219719)
                     /locus_tag="HPSH112_01120"
                     /note="GidA associated domain 3; Region: GIDA_assoc_3;
                     pfam13932"
                     /db_xref="CDD:258194"
     gene            221441..223099
                     /locus_tag="HPSH112_01125"
                     /db_xref="GeneID:12773002"
     CDS             221441..223099
                     /locus_tag="HPSH112_01125"
                     /note="COG0471 Di- and tricarboxylate transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent transporter"
                     /protein_id="YP_006226949.1"
                     /db_xref="GI:386753731"
                     /db_xref="GeneID:12773002"
                     /translation="MENHSHANTHTDTRADDKSTKIVRLLGLIGGALIALIICYALNA
                     QLPHIVEEIPKLNSLNYKAMPVVAGVAVLMGIWWMTEAIDLPATALLPLVLFSVFSVD
                     QFASVSSSYASPIIFLFMGGFILALSMQKWNLHTRIALSIILLVGTSPRRLILGFMIA
                     TGFLSMWVSNTATAVMMLPIGMSVLQLVAKLVGKENASNSWHQKEEITKAHGGIMGNI
                     VHKGKDITQVIQEKTIIYRTNFSICLMLGIAYAASIGSLGTLIGTPPNALLAGYMKTA
                     FNIEIDFAQWMVFGTPLAFIMLILSWLLLTYVIFPLKIKEIPGGKEVIRVELKKLGRL
                     SWAEISVGVIFILASLGWIFLDTILKSWGIKIDKIDSVIAMGVSALLFILPANHHGDR
                     LIDWGVAKKLPWDVLLLFGGGLALSAQFSKTGLSLWIGHLVSGFSHLPILFIIFMVTL
                     MVIFLTEITSNTATAAAFLPVIGGVAMGMGYENHQSLLLTIPVALSATCAFMLPVATP
                     PNAIAYGSGYVKITDMIKAGLWLNLVGVVLISAFSYFLVSLVFN"
     misc_feature    221639..223093
                     /locus_tag="HPSH112_01125"
                     /note="Di- and tricarboxylate transporters [Inorganic ion
                     transport and metabolism]; Region: CitT; COG0471"
                     /db_xref="CDD:223547"
     misc_feature    221642..223072
                     /locus_tag="HPSH112_01125"
                     /note="Permease SLC13 (solute carrier 13).  The
                     sodium/dicarboxylate cotransporter NaDC-1 has been shown
                     to translocate Krebs cycle intermediates such as
                     succinate, citrate, and alpha-ketoglutarate across plasma
                     membranes rabbit, human, and rat kidney. It is...; Region:
                     SLC13_permease; cd01115"
                     /db_xref="CDD:238535"
     misc_feature    order(221663..221674,221693..221734,221777..221830,
                     221900..221950,221954..221995,222098..222109,
                     222164..222235,222299..222343,222356..222382,
                     222488..222499,222536..222580,222644..222700,
                     222770..222817,222869..222880,222890..222937,
                     223025..223063)
                     /locus_tag="HPSH112_01125"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238535"
     gene            223112..223912
                     /locus_tag="HPSH112_01130"
                     /db_xref="GeneID:12773003"
     CDS             223112..223912
                     /locus_tag="HPSH112_01130"
                     /note="COG0575 CDP-diglyceride synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="YP_006226950.1"
                     /db_xref="GI:386753732"
                     /db_xref="GeneID:12773003"
                     /translation="MKEELFKEKSRYITGFVLIIVAGLILYADNLLLFWAVLGGIYVV
                     GFSEALRLFQVKASFSLYLILVLSWVAAYFNGRSIECALISAMVMASIIAYQKAHHSE
                     AILPFLYPGVGFFALFGVYKDFGAVAIIWLLVVVVASDVGAFFGGKLLGKTPFTPTSP
                     NKTLEGALIGVVLASVLGSFVGMGKLSGGFFMALLFSFLTALMAVFGDLYESYLKRKA
                     GIKDSGKILPGHGGVLDRLDSMLFGALGLHALLYFLEVWKETAVFLGD"
     misc_feature    223136..223873
                     /locus_tag="HPSH112_01130"
                     /note="Cytidylyltransferase family; Region: CTP_transf_1;
                     pfam01148"
                     /db_xref="CDD:250399"
     gene            223913..225019
                     /locus_tag="HPSH112_01135"
                     /db_xref="GeneID:12773004"
     CDS             223913..225019
                     /locus_tag="HPSH112_01135"
                     /EC_number="1.1.1.267"
                     /note="COG0743 1-deoxy-D-xylulose 5-phosphate
                     reductoisomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
                     /protein_id="YP_006226951.1"
                     /db_xref="GI:386753733"
                     /db_xref="GeneID:12773004"
                     /translation="MVVLGSTGSIGKNALKIAKKFKVGIEALSCGKNIALINEQIKVF
                     KPKKVAILDPNDLNGLEPLGAKVFVGLEGIDAMVEECVSNLVINAIVGVAGLRASFKS
                     LQTNKKLALANKESLVSAGHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGG
                     AFRDTPLELIPIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKID
                     ALIERSSIVHALVEFEDNSIIAHLASADMQLPISYAIDPKLASLSASIKPLDLYALSA
                     IKFEPISMERYTLWRYKDLLLENPKLGVVLNASNEVAMEKFLNQEIAFGGLIKTISQA
                     LESYAKTPFKLSNLDEVLALDREVRERFGNVARV"
     misc_feature    223913..225016
                     /locus_tag="HPSH112_01135"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Region: Dxr; TIGR00243"
                     /db_xref="CDD:161787"
     misc_feature    223913..224275
                     /locus_tag="HPSH112_01135"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase;
                     Region: DXP_reductoisom; pfam02670"
                     /db_xref="CDD:251461"
     misc_feature    224297..224545
                     /locus_tag="HPSH112_01135"
                     /note="1-deoxy-D-xylulose 5-phosphate reductoisomerase
                     C-terminal; Region: DXP_redisom_C; pfam08436"
                     /db_xref="CDD:254800"
     misc_feature    224636..224992
                     /locus_tag="HPSH112_01135"
                     /note="DXP reductoisomerase C-terminal domain; Region:
                     DXPR_C; pfam13288"
                     /db_xref="CDD:257629"
     gene            225070..225369
                     /locus_tag="HPSH112_01140"
                     /db_xref="GeneID:12773005"
     CDS             225070..225369
                     /locus_tag="HPSH112_01140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226952.1"
                     /db_xref="GI:386753734"
                     /db_xref="GeneID:12773005"
                     /translation="MGLKNKIKGFIKERMPFVVRYVRSLKGDKNIYGEINHEIKEMLE
                     AKKLHSLQEKALFNHDHQESVFLAIASLNNESFIERNKSIYKNSSLNYNYGGGGI"
     gene            225417..226211
                     /locus_tag="HPSH112_01145"
                     /db_xref="GeneID:12773006"
     CDS             225417..226211
                     /locus_tag="HPSH112_01145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226953.1"
                     /db_xref="GI:386753735"
                     /db_xref="GeneID:12773006"
                     /translation="MGYFDYDKESQNPKSPLNPWAFIRVKNEIVTLEENLFSMLPAIQ
                     RGVIGFNDCDDGSKEVILEFCKKFPSFIPISYPYEVILKDCPSLWHQFYHYCNYTFSF
                     IPKNEWVIKIDCDHIYDAKKLYESFYIPKSIKEVVMYSRINFVVRDFEVFVRNDGDFG
                     FLDAWGDHWLFYNDCEPFEIWQHNGDFYEILKLKDKHHIKDKELMQWHFPLAKKRRNA
                     IVDNDLIPLKDFKKHHADLIGTRIEESMLDEKRILEMYQKFNLAKE"
     misc_feature    <225420..226193
                     /locus_tag="HPSH112_01145"
                     /note="Beta-1,4-N-acetylgalactosaminyltransferase (CgtA);
                     Region: CgtA; pfam06306"
                     /db_xref="CDD:114995"
     gene            complement(226227..226778)
                     /locus_tag="HPSH112_01150"
                     /db_xref="GeneID:12773007"
     CDS             complement(226227..226778)
                     /locus_tag="HPSH112_01150"
                     /note="COG1881 Phospholipid-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226954.1"
                     /db_xref="GI:386753736"
                     /db_xref="GeneID:12773007"
                     /translation="MKTFEVMIQTDSQGYLDAKFGGNAPRGFLNPNGLPTYSPKISWQ
                     KVEGAQSYALELIDHDAQKVCGMSFVHWVVGNISYNVLEENASMMDKRIAQGVNSLTQ
                     GFIRSSLNESEKQRSNLNNSTYIGPMPPNGDHHYLIQVYALDIPKLALKAPFFLGDLH
                     DKMRGHIIAIGRKEFLYKQFVRK"
     misc_feature    complement(226248..226718)
                     /locus_tag="HPSH112_01150"
                     /note="PhosphatidylEthanolamine-Binding Protein (PEBP)
                     domain present in bacteria and archaea; Region:
                     PEBP_bact_arch; cd00865"
                     /db_xref="CDD:176643"
     misc_feature    complement(order(226371..226373,226377..226379,
                     226383..226385,226389..226403,226566..226568,
                     226572..226574,226602..226607))
                     /locus_tag="HPSH112_01150"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176643"
     gene            226923..227384
                     /locus_tag="HPSH112_01155"
                     /db_xref="GeneID:12773008"
     CDS             226923..227384
                     /locus_tag="HPSH112_01155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226955.1"
                     /db_xref="GI:386753737"
                     /db_xref="GeneID:12773008"
                     /translation="MESKINRLSAKIDALLEQQKRVISLLETYLSVYPTQEVSNKFFK
                     GVSQGMELAPEIAQEDEEKRLYVLQYLSHVDITKNKQDSQLKKDCLEFIQRFNVPKPI
                     MVTALYNLRGIKPTKKEVAKQLQKLYVWGKRYQQGGIDALKDRRGRPLKKP"
     misc_feature    <227268..227369
                     /locus_tag="HPSH112_01155"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     gene            227557..228720
                     /locus_tag="HPSH112_01160"
                     /db_xref="GeneID:12773009"
     CDS             227557..228720
                     /locus_tag="HPSH112_01160"
                     /note="COG1104 Cysteine sulfinate desulfinase/cysteine
                     desulfurase and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="YP_006226956.1"
                     /db_xref="GI:386753738"
                     /db_xref="GeneID:12773009"
                     /translation="MLQRIYLDNNATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTET
                     HPAIAEALDKLYKGINARDIDDVIITSCATESNNWVLKGVYFDECLKKGKNHIVTTVT
                     EHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVKEAITEKTALVSVMWANNETGLI
                     FPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLKANVDFLSFSAHKFHGPKGIGGLYI
                     RSGVGLTPLFHGGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLE
                     EALLKIPDVMVVGDRIHRVPNTTLISVRGIEGEAMLWDLNRSNIAASTGSACASEDLE
                     ANPVMVAIGASKELAHTAIRLSLSRFNTEAEIDKTIEVFSQAATRLRNISSSY"
     misc_feature    227569..228714
                     /locus_tag="HPSH112_01160"
                     /note="cysteine desulfurase, NifS family, epsilon
                     proteobacteria type; Region: nifS_epsilon; TIGR03403"
                     /db_xref="CDD:132444"
     misc_feature    order(227773..227778,227785..227787,228010..228012,
                     228094..228096,228103..228105,228163..228165,
                     228172..228174)
                     /locus_tag="HPSH112_01160"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    228172..228174
                     /locus_tag="HPSH112_01160"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            228742..229722
                     /locus_tag="HPSH112_01165"
                     /db_xref="GeneID:12773010"
     CDS             228742..229722
                     /locus_tag="HPSH112_01165"
                     /note="COG0822 NifU homolog involved in Fe-S cluster
                     formation"
                     /codon_start=1
                     /transl_table=11
                     /product="nifU-like protein"
                     /protein_id="YP_006226957.1"
                     /db_xref="GI:386753739"
                     /db_xref="GeneID:12773010"
                     /translation="MAKHDLVGSALWDAYSKEVQRRMDNPTHLGVITEEQAKARNAKL
                     IVADYGAEACGDAVRLYWLVDESTDKIVDAKFKSFGCGTAIASSDMMVELCLNKRVQE
                     AVKITNLDVERGLRDEPDTPAVPGQKMHCSVMAYDVIKKAAGMYLGKNAEDFEEEIIV
                     CECARVSLGTIKEVIRLNDLKSVEEITNYTKAGAFCKSCVRPGGHEKRDYYLVDILKE
                     VREEMEAEKLKATANKSQSGELAFREMTMVQKIKAVDKVIDENIRPMLMMDGGDLEIL
                     DIKESDDYIDVYIRYMGACDGCMSAATGTLFAIENALQELLDRSIRVLPI"
     misc_feature    228772..229719
                     /locus_tag="HPSH112_01165"
                     /note="Fe-S cluster assembly protein NifU; Region:
                     NifU_proper; TIGR02000"
                     /db_xref="CDD:233679"
     misc_feature    228784..229167
                     /locus_tag="HPSH112_01165"
                     /note="Iron-sulfur cluster scaffold-like proteins; Region:
                     IscU_like; cd06664"
                     /db_xref="CDD:143480"
     misc_feature    order(228784..228792,228799..228804,228901..228906,
                     228982..228984,228988..228990,229120..229125,
                     229129..229134)
                     /locus_tag="HPSH112_01165"
                     /note="trimerization site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143480"
     misc_feature    order(228901..228903,228982..228984,229132..229134)
                     /locus_tag="HPSH112_01165"
                     /note="active site"
                     /db_xref="CDD:143480"
     misc_feature    229216..229344
                     /locus_tag="HPSH112_01165"
                     /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
                     pfam04324"
                     /db_xref="CDD:252526"
     misc_feature    229462..229719
                     /locus_tag="HPSH112_01165"
                     /note="Thioredoxin-like proteins and domains
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: COG0694"
                     /db_xref="CDD:223766"
     gene            229878..230111
                     /locus_tag="HPSH112_01170"
                     /db_xref="GeneID:12773011"
     CDS             229878..230111
                     /locus_tag="HPSH112_01170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226958.1"
                     /db_xref="GI:386753740"
                     /db_xref="GeneID:12773011"
                     /translation="METTENTDETRLRGAKNKLGRKPKADANKKTRAVSLYFSDEQYQ
                     KLEKMASEEEESVGSYIKRYILKALRKIEQNGA"
     gene            230224..231570
                     /locus_tag="HPSH112_01175"
                     /db_xref="GeneID:12773012"
     CDS             230224..231570
                     /locus_tag="HPSH112_01175"
                     /note="COG1066 Predicted ATP-dependent serine protease"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_006226959.1"
                     /db_xref="GI:386753741"
                     /db_xref="GeneID:12773012"
                     /translation="MAKKTSLFECQHCGFTSPKWLGKCVQCNAWESFIELNQAQKEVL
                     NTLKNPIPKAQKSVSIAEIEHEEVIKFSSTQSELDIVLGGGIAKGGLYLVGGSPGVGK
                     STLLLKVASGLAKNQQKVLYVSGEESLSQIKMRATRLDCIEKELYLLNEINWPVIKAN
                     IESENYFACVIDSIQTLYSPEISSAPGSISQVREITFELMRLAKTRNIAVFIIGHITK
                     EGSIAGPRVLEHMVDSVLYFEGDPSRELRILRSFKNRFGPTSEIGLFEMKEQGLVSAK
                     EASSLFFSQEEPMEGSAITITLEGSRALILEIQALVSECSFGAPKRLANGFDTNRLNM
                     LIALLEKKLEIPLNRHDVFINVSGGIKISEPACDLAVIASILSSFKNRKIDNKTAFLG
                     EVSLNGRILEAPNLNARLKEMENYGFLKAILPKKPSQKTSIKCYEANAVGKIVEWM"
     misc_feature    230224..231558
                     /locus_tag="HPSH112_01175"
                     /note="DNA repair protein RadA; Region: sms; TIGR00416"
                     /db_xref="CDD:232966"
     misc_feature    230245..231357
                     /locus_tag="HPSH112_01175"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    230509..230532
                     /locus_tag="HPSH112_01175"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(230512..230514,230524..230532,230587..230589,
                     230593..230595,230737..230742)
                     /locus_tag="HPSH112_01175"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    230728..230739
                     /locus_tag="HPSH112_01175"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <231232..231498
                     /locus_tag="HPSH112_01175"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            231693..232772
                     /locus_tag="HPSH112_01180"
                     /db_xref="GeneID:12773013"
     CDS             231693..232772
                     /locus_tag="HPSH112_01180"
                     /note="COG0225 Peptide methionine sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional methionine sulfoxide reductase A/B"
                     /protein_id="YP_006226960.1"
                     /db_xref="GI:386753742"
                     /db_xref="GeneID:12773013"
                     /translation="MKVLSYLKHFYLFLLIGAIMQANESMGSQHQKTDERVIYLAGGC
                     FWGLEAYMERIYGVIDASSGYANGKTSSTNYEKLHESDHAESVKVIYDPKKISLDKLL
                     RYYFKVIDPVSVNKQGNDVGRQYRTGIYYVNSADKEVIDHALKALQKEVKGKIAIEVE
                     PLKNYVRAEEYHQDYLKKNPGGYCHIDLKKADEVIVDDDKYTKPSDEVLKKKLTKLQY
                     EVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSSADKYDSGCGWPSFSKPINKDV
                     VKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGLRYCINSAALRFIPLKDMEK
                     EGYGEFIPYIKKGELKKYIQDKKTH"
     misc_feature    231786..232286
                     /locus_tag="HPSH112_01180"
                     /note="Peptide methionine sulfoxide reductase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: MsrA; COG0225"
                     /db_xref="CDD:223303"
     misc_feature    232293..232700
                     /locus_tag="HPSH112_01180"
                     /note="Conserved domain frequently associated with peptide
                     methionine sulfoxide reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG0229"
                     /db_xref="CDD:223307"
     gene            232925..233713
                     /locus_tag="HPSH112_01185"
                     /db_xref="GeneID:12773014"
     CDS             232925..233713
                     /locus_tag="HPSH112_01185"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226961.1"
                     /db_xref="GI:386753743"
                     /db_xref="GeneID:12773014"
                     /translation="MAKTLKPNLDKDELNTLYKSNLSYAKNTHEHFFKTKKDLDYKLF
                     NPSIMHEQGYISFMGGQGAKRLLDMLYKLAFNAKSNKIALDRHYAKTFLQIVARTLRK
                     NVNILEEQGLIEVIKNKQRYLYVYLKDYRELEGYNSVGANKKNNIPSPFFLQIMRFLE
                     KFAKAIERVTINKKECIIHIPSQELMQRANNVVLKFTPIFNPNTTYTLTYKDLTNKDI
                     PSNLCFYQTAIVKKNLLKALKDRECVGEPINNSPKVSNYFQESA"
     gene            233716..233940
                     /locus_tag="HPSH112_01190"
                     /db_xref="GeneID:12773015"
     CDS             233716..233940
                     /locus_tag="HPSH112_01190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226962.1"
                     /db_xref="GI:386753744"
                     /db_xref="GeneID:12773015"
                     /translation="MTPSDILNICFDLNEKTLQIDFSQTDTETQNKILEELFGKELLQ
                     EKLKGHVLKILELTSNILFQSQPSTKRERQ"
     gene            233937..234416
                     /locus_tag="HPSH112_01195"
                     /db_xref="GeneID:12773016"
     CDS             233937..234416
                     /locus_tag="HPSH112_01195"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226963.1"
                     /db_xref="GI:386753745"
                     /db_xref="GeneID:12773016"
                     /translation="MIELTLDKKSIQIDEELLDIKKHLEKFYSNKEQEIIAKTLESET
                     ELTCSYLWDKDFLLLEQLLENNLGHFTFESEFALLKDREPLNLDQIKQMSVLKVLTYE
                     MTQALKNQIIHLSQVVNEESLEKDEELVVYHLDFKLNQQSYKVIAQFCVIKKERNIA"
     gene            234413..234703
                     /locus_tag="HPSH112_01200"
                     /db_xref="GeneID:12773017"
     CDS             234413..234703
                     /locus_tag="HPSH112_01200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226964.1"
                     /db_xref="GI:386753746"
                     /db_xref="GeneID:12773017"
                     /translation="MKKLRHFRKLIAFLGFSPLLLQADMTTFFNSIEQQLQSPTGKGI
                     LMIIFIAIGIFVWKNLDRWKEILLTILGVVLGTLIFFKAPALAQWFMTSVGN"
     misc_feature    234416..234682
                     /locus_tag="HPSH112_01200"
                     /note="TrbC/VIRB2 family; Region: TrbC; pfam04956"
                     /db_xref="CDD:252903"
     gene            234713..234976
                     /locus_tag="HPSH112_01205"
                     /db_xref="GeneID:12773018"
     CDS             234713..234976
                     /locus_tag="HPSH112_01205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226965.1"
                     /db_xref="GI:386753747"
                     /db_xref="GeneID:12773018"
                     /translation="MQLVGISVSNLKEISSKEKFLWLNAKSFLLSSFVPFVMTPWLDI
                     LNSLMLYACFLLVFSIAEFFDEDISDILIAHSKIKTKSNSFYA"
     gene            234988..235224
                     /locus_tag="HPSH112_01210"
                     /db_xref="GeneID:12773019"
     CDS             234988..235224
                     /locus_tag="HPSH112_01210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226966.1"
                     /db_xref="GI:386753748"
                     /db_xref="GeneID:12773019"
                     /translation="MKQEIVVEKPNKMTITYNLEQTISKLKESVNLLEKNEQYNDAYT
                     LVCGIKSIVDDFHKNVILHVSNNSKPPKRKGKSS"
     misc_feature    235224..236167
                     /note="potential frameshift: common BLAST hit:
                     gi|15645087|ref|NP_207257.1| virB4 homolog (virB4)"
     gene            236366..236734
                     /locus_tag="HPSH112_01225"
                     /db_xref="GeneID:12773020"
     CDS             236366..236734
                     /locus_tag="HPSH112_01225"
                     /note="COG1943 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="ISHa1152 transposase A"
                     /protein_id="YP_006226967.1"
                     /db_xref="GI:386753749"
                     /db_xref="GeneID:12773020"
                     /translation="MELRLKEIIQEVAKELRVEIIEMQTDKDHIHILADVDPSFGVMK
                     FIKTAKGRSSKVLRQEFNHLKTKLPTLWTNSCFISTVGGVPLNVVKQYIENQQNSNRP
                     KQKEKWKNYVDNLQTKALHQ"
     misc_feature    236366..236653
                     /locus_tag="HPSH112_01225"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:250874"
     gene            236697..237815
                     /locus_tag="HPSH112_01230"
                     /db_xref="GeneID:12773021"
     CDS             236697..237815
                     /locus_tag="HPSH112_01230"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase IS891/IS1136/IS1341 family
                     protein"
                     /protein_id="YP_006226968.1"
                     /db_xref="GI:386753750"
                     /db_xref="GeneID:12773021"
                     /translation="MLITYKQKLYTNDKTKHIDTLLRRYGVLYNHCIALHKRYYRLFK
                     KYLKLYDLQKHITKLKKTHRYAFLKTLGSQTIQDLAERIDKAFKKFFNKQAKLPRFKK
                     VANYKSFTFKSQIDKKTGLNKGVGFALKDNVISFNGYRYKFIKTYAFIGKIKTLTIKR
                     DNTGDYFLCLVCELENHPNKQTACDKSVGFDFGLKTFLTGSDHTKIESPLFFSKYLPL
                     IKRISRNLSKKIKGSNNFKKAKKKLTQLHQKIKCLRTDFFHKLALKLSREYQTIFIED
                     LNMKAMQKLWGRKVSDLAFSEFVKILENKANVVKIDRFYPSSKTCSNCLFVNEEINKD
                     FRKSGKTGDEYHCKHCGLVIDRDLNAAINIRRVGASKP"
     misc_feature    236697..237800
                     /locus_tag="HPSH112_01230"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    236892..237542
                     /locus_tag="HPSH112_01230"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    237579..237794
                     /locus_tag="HPSH112_01230"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            237917..238681
                     /locus_tag="HPSH112_01235"
                     /db_xref="GeneID:12773022"
     CDS             237917..238681
                     /locus_tag="HPSH112_01235"
                     /note="COG3451 Type IV secretory pathway, VirB4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="VirB4 type IV secretion ATPase"
                     /protein_id="YP_006226969.1"
                     /db_xref="GI:386753751"
                     /db_xref="GeneID:12773022"
                     /translation="MSNTQIELDLIFHIRSLGQFESLNFLKTKKKLTLSKMVKNDIDD
                     YIELVQANRLSMQECALNLVIRAKSKAKLDKSLKEILSLLNNAGLGSVTETIGLKPSY
                     FSFFPNNANINPRMRNQTSQVIASLILFEKNNTGFRANSWGDMPLSVFKNLDHSPYLF
                     NFHNQEVKHKGVLAHNVARVVGHTMIIGATGAGKTTLISYLMMSALKYSNIDILALDR
                     LNGLYSFTKYFDGIYNQGENFHINRYYKPIKSYKEL"
     misc_feature    <237926..238261
                     /locus_tag="HPSH112_01235"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     misc_feature    <238382..>238507
                     /locus_tag="HPSH112_01235"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    238463..>238606
                     /locus_tag="HPSH112_01235"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(238478..238483,238493..238501)
                     /locus_tag="HPSH112_01235"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(238481..238483,238493..238501,238559..238561,
                     238565..238570)
                     /locus_tag="HPSH112_01235"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     gene            complement(238694..239953)
                     /locus_tag="HPSH112_01240"
                     /db_xref="GeneID:12773023"
     CDS             complement(238694..239953)
                     /locus_tag="HPSH112_01240"
                     /note="COG0675 Transposase and inactivated derivatives"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_006226970.1"
                     /db_xref="GI:386753752"
                     /db_xref="GeneID:12773023"
                     /translation="MSAISITHKIALKPNNKHITYFKKAFGCARFAYNWGLAKWKENY
                     QLGIKTNHLQLKKEFNALKKSQFNFVYEVTKYATQQPFIHLNLAFNKFFRDLKKGLVS
                     YPKFKKKREFQGSFYIGGDQIKIIQTANTGYLKIPNLPPIKLTEKLRFQGKINNATIT
                     QKGDHFYVSISCGVDESEYKRTHKLQESHNKLGVDIGIKSFVSLSNGLNIYAPKPLDK
                     LTRKLVRISRQLSKKIHPKTKGDKTKKSNNYLKHSKKLTHLHEKIANIRLDFLHKLTS
                     SLIRHSNSFCLESLKVKNMFKNHRLAKSLSDVSMSVFNTLLEYKAKYSNKEILRADTY
                     YPSSKTCSNCQKVKQDLKLKDRIYQCLECGFELDRDINAAINLLKHLVGRVTAEFTPM
                     DLTALLNDLSKNRLATSKVELGIQQKP"
     misc_feature    complement(239807..239935)
                     /locus_tag="HPSH112_01240"
                     /note="Helix-turn-helix domain; Region: HTH_OrfB_IS605;
                     pfam12323"
                     /db_xref="CDD:256981"
     misc_feature    complement(238817..239929)
                     /locus_tag="HPSH112_01240"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG0675"
                     /db_xref="CDD:223747"
     misc_feature    complement(239066..239740)
                     /locus_tag="HPSH112_01240"
                     /note="Probable transposase; Region: OrfB_IS605;
                     pfam01385"
                     /db_xref="CDD:250577"
     misc_feature    complement(238817..239017)
                     /locus_tag="HPSH112_01240"
                     /note="Putative transposase DNA-binding domain; Region:
                     OrfB_Zn_ribbon; pfam07282"
                     /db_xref="CDD:115907"
     gene            complement(239928..240569)
                     /locus_tag="HPSH112_01245"
                     /db_xref="GeneID:12773024"
     CDS             complement(239928..240569)
                     /locus_tag="HPSH112_01245"
                     /note="COG2452 Predicted site-specific
                     integrase-resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase A-OrfA"
                     /protein_id="YP_006226971.1"
                     /db_xref="GI:386753753"
                     /db_xref="GeneID:12773024"
                     /translation="MLSIGQASKLLGVTIQTLRNWDKKDLLKPDELTKGGERRYKLES
                     LRRINRNAVFNQDELKTIAYARVSSHDQQEDLIRQVQVLELYCARCGFNYEVIQDLGS
                     GMNYYKKGLTKLLNLILDNQVKRLVLTHKDRLLRFGAELVFSICEAKEVEVVIINKGD
                     ENVRFEEELAKDVLEIITVFSARLYGSRSKKNKKLLDEMQEVITNNVSYLNHA"
     misc_feature    complement(239958..240569)
                     /locus_tag="HPSH112_01245"
                     /note="Predicted site-specific integrase-resolvase [DNA
                     replication, recombination, and repair]; Region: COG2452"
                     /db_xref="CDD:225296"
     misc_feature    complement(240423..240566)
                     /locus_tag="HPSH112_01245"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cd04761"
                     /db_xref="CDD:133389"
     misc_feature    complement(order(240456..240464,240513..240515,
                     240555..240563))
                     /locus_tag="HPSH112_01245"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     misc_feature    complement(239985..240389)
                     /locus_tag="HPSH112_01245"
                     /note="Serine Recombinase (SR) family, IS607-like
                     transposase subfamily, catalytic domain; members contain a
                     DNA binding domain with homology to MerR/SoxR located
                     N-terminal to the catalytic domain. Serine recombinases
                     catalyze site-specific recombination of...; Region:
                     SR_IS607_transposase_like; cd03769"
                     /db_xref="CDD:239738"
     misc_feature    complement(order(240162..240164,240171..240176,
                     240366..240368,240372..240374))
                     /locus_tag="HPSH112_01245"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239738"
     misc_feature    complement(240366..240368)
                     /locus_tag="HPSH112_01245"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239738"
     gene            240712..241629
                     /locus_tag="HPSH112_01250"
                     /db_xref="GeneID:12773025"
     CDS             240712..241629
                     /locus_tag="HPSH112_01250"
                     /note="COG3451 Type IV secretory pathway, VirB4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="VirB4 type IV secretion ATPase"
                     /protein_id="YP_006226972.1"
                     /db_xref="GI:386753754"
                     /db_xref="GeneID:12773025"
                     /translation="MHFYAQMAKVDSYDDHKDKVEDKTALINAIDTMYRNYNDEVKQA
                     KFSNQELPLPFDLKEFVNTIVKTNTNILDSSFEDYLKSSLFSSRMDSLDFKTRISTIN
                     TDSILHNDDDAGLLAYYVFHKMIDRALKINRGFLCFIDEFKSYAQNEMMNKKINEIIT
                     QARKANGVIVLALQDINQLTEVRNAQSFIKNMGQLILYPQRNIDTKDLNDKFGIRLSD
                     TEKHFLENTAVNEYKVLLKNMNDGSSNIIDVSLSSLGNYLQIFSSNSSMVEHIENLIK
                     HYPTTWREVFINNTYQKFDDKKHLEKVLA"
     misc_feature    241117..>241350
                     /locus_tag="HPSH112_01250"
                     /note="TraM recognition site of TraD and TraG; Region:
                     TraG-D_C; cl17375"
                     /db_xref="CDD:266658"
     gene            241758..242924
                     /locus_tag="HPSH112_01255"
                     /db_xref="GeneID:12773026"
     CDS             241758..242924
                     /locus_tag="HPSH112_01255"
                     /note="COG3736 Type IV secretory pathway, component VirB8"
                     /codon_start=1
                     /transl_table=11
                     /product="VirB8 type IV secretion protein"
                     /protein_id="YP_006226973.1"
                     /db_xref="GI:386753755"
                     /db_xref="GeneID:12773026"
                     /translation="MSNLQEIREHLKELENSFEIGSFSKEYIKEYAKCFFMGLSMFLV
                     QQKEEQDKENKEEDCHKEALLNQDAKENKEELIKNIQTNIAKNQELEKISFEKWANKI
                     QERVLPELERIVTHKLKDNVMPKLNTQLESFKKDELDLSSVFEIQRKNTQMAYRLAIG
                     GLIGVISLSVALAFLMPLKQIEPYFVDFANSDKHFAVVQKADTKVDYGEAFLRNLVGS
                     YIMGRETINHIDDKIRLNETIREQSSDEVWKTLEQLVSGKGSIYSKSNMDREIKIINI
                     SIYKQGKQQNIAVADIVAKVFDKGYLISEKRYKVSLIYHFKPLIQFDYSSMPKNPTGF
                     IVDKYSLSEIASIKALDKTYKKVERPHSKIEYKKPEPTNPQNNPANEPNNKGEQ"
     misc_feature    242124..242810
                     /locus_tag="HPSH112_01255"
                     /note="VirB8 protein; Region: VirB8; cl01500"
                     /db_xref="CDD:260965"
     gene            242921..244558
                     /locus_tag="HPSH112_01260"
                     /db_xref="GeneID:12773027"
     CDS             242921..244558
                     /locus_tag="HPSH112_01260"
                     /note="COG3504 Type IV secretory pathway, VirB9
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirB9"
                     /protein_id="YP_006226974.1"
                     /db_xref="GI:386753756"
                     /db_xref="GeneID:12773027"
                     /translation="MTRVFGGISFAISLLAPLLAENNIQNYNEPMDYSKGDVSLQPFN
                     NQTNQETQPSANHNTQPNSMQTPMPNQNSYSQPTTPIQNNQPNNAQTQTMLNNAKQFT
                     NNALNNTKQTITNTTNYVNNKLSPKPNDVPISAFKDNRDLNNQIEPNTSNHETKESDE
                     NSDSTLKPMTNFNAIQNNFFAKNRSIKDNAHFIHYTIGDTFNIRLRYAMTTTFIFDEP
                     IAQVVLGDDIGFSTKMLGEDKEHLISNILLIKPLQIGVDSNLTIIGKSGKVYSFYVFS
                     TTYTSSKNPALMVYVSSKEYFKHFTSSKKETNKEIKTTHSTPNKDIKVSHAPKKIAKK
                     SPSIKEQNLKSKNPTTTKTAIENAPLSLNRFKSPSYPPSNALANSRKASENFKVISNS
                     AKTFKEHRHSQDEMKYVDYSAKIKDDGKFIRIGDNVNHIYINKKKMEYGYVIIDKKKR
                     KWYCLWMCKKVVKSKYKDDLPTQIFNDEQFTYFKFNRSNARSKFPVVYKVVDGYDNPV
                     NSRVVGDYLIAEDVSNQWNLKLGKAYLCIEKIAKRAK"
     misc_feature    243524..>243790
                     /locus_tag="HPSH112_01260"
                     /note="Domain of unknown function (DUF4138); Region:
                     DUF4138; cl19646"
                     /db_xref="CDD:267999"
     misc_feature    244319..244537
                     /locus_tag="HPSH112_01260"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    order(244328..244345,244499..244501,244514..244534)
                     /locus_tag="HPSH112_01260"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     misc_feature    244555..245753
                     /note="potential frameshift: common BLAST hit:
                     gi|210135522|ref|YP_002301961.1| VirB10 type IV secretion
                     protein"
     gene            245737..247935
                     /locus_tag="HPSH112_01275"
                     /db_xref="GeneID:12773028"
     CDS             245737..247935
                     /locus_tag="HPSH112_01275"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226975.1"
                     /db_xref="GI:386753757"
                     /db_xref="GeneID:12773028"
                     /translation="MKKKSNVFKILMSLCLALSTSQALVIQTMQDWNLRKNSEFKALV
                     VVSNKVQENTLAMGHYKVSKNRANLSIMVTHIKKGNDYKTLQSPPNAIKEIKGKLVLK
                     KGTRIVLGGENDSEMSSAIGINKNTYTSSKNGKGFSGSGASGMGYASGYGDTGNNTSS
                     NGSNGSSMSGTSGTNGSRGANGSNGTNGANGYQGVGSNPFPPIAGSGSGSSGSSNSDY
                     TPFTSSGGGMGGGFIPFPYSPGLQNGSGANGINGTNGANGTNGANGSNSANGGTASAD
                     SHYTNEFCTAPVRNGNTMSLDIVDRNGSCFKMQAFRNDNVCQYSYDFENMKAIKQTQF
                     YFINRENKSVNIGGCVDLVGKQFEFPMYEDANRCKLDTTTNKGYGSGSASFFQTEILF
                     RGLDNLIHVAKSCTDFAGVQEQLVKYDNDPATRTVQRVINQYYIDPITKQKVFISHNV
                     VSPLKFSYQTYACGKWQFDDAKLEAYRPTQIRIFDTVANQYYNVTGCDYTSDMGKVPK
                     IVQPYTKISVASSVKGEEVGDLNLPQYTTFEIQKMALNSSDLTTTSYCNDGWGSWTKT
                     HSYTGYSNGGLRTLAKWVTQYKTINQGTTIEYIRPRNEGDSDAVYDTYKYYYVSQAQK
                     TLQRIPLTIYINSINLSDEYRKNFELTTLSQKLNLNNGVKQIINTQDFTNWQATYYRP
                     NGNGNLCMSYSFSSGSPWKSSNKGKYCSWAQTPNANYSCASHNNWIVPNQ"
     gene            247948..248889
                     /locus_tag="HPSH112_01280"
                     /db_xref="GeneID:12773029"
     CDS             247948..248889
                     /locus_tag="HPSH112_01280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226976.1"
                     /db_xref="GI:386753758"
                     /db_xref="GeneID:12773029"
                     /translation="MDLYLKKALFLASLSCLNANESFVDNSDFLAIMPSEKEEDISQE
                     QKLEQKLEQKLEQKSAELLQSQVKREFKEKKKSQKHFKAMQTKNGFFLGSEIAITSTS
                     LKQSLSLISNATDDSITYSHTSSNANFNMGVLMGYQHYFGATKRHGIKFSTHLYGGTP
                     SAVSTNIDIYNSKVSTNYTPLNFGLDIKYLFDFLNVIKKNRHTLGLSVGFGWRMQYYF
                     AKIDPIKTMRSEFITNKPKDIFSHGFYPAIGLHYYLNHHQFEVNYRFGGAINYQSLTP
                     SKIVAQNGNFKGEVLFSNFITKATNSSYIAFNYTYLF"
     misc_feature    <247948..248163
                     /locus_tag="HPSH112_01280"
                     /note="Iguana/Dzip1-like DAZ-interacting protein
                     N-terminal; Region: Dzip-like_N; pfam13815"
                     /db_xref="CDD:258095"
     gene            248907..249182
                     /locus_tag="HPSH112_01285"
                     /db_xref="GeneID:12773030"
     CDS             248907..249182
                     /locus_tag="HPSH112_01285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226977.1"
                     /db_xref="GI:386753759"
                     /db_xref="GeneID:12773030"
                     /translation="MLDEITQKNELEPISNKQNQEPKEVEKMPLNNIQKAKELKNNAN
                     LIVRRTDELDKAINKRESLQREFERRIKHLDNKIETLSKKIEELKRK"
     misc_feature    248925..>249170
                     /locus_tag="HPSH112_01285"
                     /note="phosphodiesterase; Provisional; Region: PRK12704"
                     /db_xref="CDD:237177"
     gene            249187..250131
                     /locus_tag="HPSH112_01290"
                     /db_xref="GeneID:12773031"
     CDS             249187..250131
                     /locus_tag="HPSH112_01290"
                     /note="COG0630 Type IV secretory pathway, VirB11
                     components, and related ATPases involved in archaeal
                     flagella biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="VirB11 type IV secretion ATPase"
                     /protein_id="YP_006226978.1"
                     /db_xref="GI:386753760"
                     /db_xref="GeneID:12773031"
                     /translation="MDLNKLKDYRALRNAILRLLPYLDSGITELIMNKEKEIWLYKLD
                     GTREKVFDENLDKAFMLGFGEQLASFRDLFFNANYPTLNTSIPTSRYRVSMNHFAISA
                     DNELSLNIRVPSEKKFDLKAFKLSGVCQYDYEYLQKLMIEGKNLLISGGTGSGKTSFL
                     NALIEFIPKHTRIVSVEDSEELDLRAFENHKSLLVDKTESSKFTYENALNMAMRMSPD
                     RLMVGEIDTRNALLFLRFGNTGHKGMVSTLHADSVHGVIEAIALNLQMNKSGLDVSVA
                     RKFFESSVDIVVQIVLDKATNTRYIQEILPTKELESSL"
     misc_feature    249256..250098
                     /locus_tag="HPSH112_01290"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(249634..249639,249649..249657)
                     /locus_tag="HPSH112_01290"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(249637..249639,249649..249657,249709..249711,
                     249715..249720,249853..249858)
                     /locus_tag="HPSH112_01290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    249841..249855
                     /locus_tag="HPSH112_01290"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            250128..250646
                     /locus_tag="HPSH112_01295"
                     /db_xref="GeneID:12773032"
     CDS             250128..250646
                     /locus_tag="HPSH112_01295"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226979.1"
                     /db_xref="GI:386753761"
                     /db_xref="GeneID:12773032"
                     /translation="MKKYQNKRKLGKRINCFISNECKDILENYLKVKKISVTECIESL
                     LLALDPSKETLRARDFYESLFKVISLNQHVYKELMANGNNINQIAKNTNIAIKYNKPF
                     YLQNLAFLEELFKTMDTLNKNIEDCKKVSLELLLQIYKEQKSETELNTISKILNALNE
                     KQSATGPKKDNE"
     misc_feature    <250146..250262
                     /locus_tag="HPSH112_01295"
                     /note="Replication regulatory protein RepB; Region:
                     RepB-RCR_reg; cl11673"
                     /db_xref="CDD:264466"
     gene            250643..252784
                     /locus_tag="HPSH112_01300"
                     /db_xref="GeneID:12773033"
     CDS             250643..252784
                     /locus_tag="HPSH112_01300"
                     /note="COG3505 Type IV secretory pathway, VirD4
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein VirD4"
                     /protein_id="YP_006226980.1"
                     /db_xref="GI:386753762"
                     /db_xref="GeneID:12773033"
                     /translation="MKMQFVKAFCVLFSILLIPLFFILANYYVFDAIKSFRQAYFFSQ
                     SVFIGLYKGASILDLKFEVYITMIMSLMPLVATIYMSIQKTKETSHGYARWANVKDIE
                     CFKIFSKEGFCKVVHRLGVQFDKGFILGKFGFPKLRDVCYDKPLGAMIVAPPGAGKTA
                     CVALPNLLTLPNSCIITDIKGELRDKTAGYRQKFLNNRILIFNPYGDDNTCYFNPFDK
                     RIVKPMNFDQRLRLVQENANNVFISEEKGEDHWVSKAKDLFSFYALHDVCSKDETNFF
                     DVAMGPNRDYVNLIDKRSRYYKQLYQHDKKTGEIILDPQTNEPILIPNVNARKLWYLQ
                     VSEQKYADPKDPRNFDPNEPEPAPRSEGALDEIVRNDARAWANSAEEEFASIISTFNR
                     FVSVFKSNQVRIATSKMSFDYEELRTDNISLYIVIAQKDINTLAPLVRVILESIAKNL
                     LTNESSKKEERIYMILDEFVRFGKLPFLLEMPALCRSYNVVPLFITQDYAMIRKNYSD
                     DDLKILKGVVHYNIVFKMNSAEDAEIVSKEVGEFTRQSKNYSTEKGQLVFGGSSSYSH
                     EGRNLLTAQDIMNIKSDEVIVIVTGAKATPLKLKANYWFRDKELLKRANLPIDLEVER
                     KRFKESVQPTTSQKESENSNLTESEKDNENPTTSQEKNKNENTEQENHNEIDEILKKP
                     LSEISMEEKRALFKKMQQGDEQSEQEKDTQS"
     misc_feature    250922..252493
                     /locus_tag="HPSH112_01300"
                     /note="Type IV secretory system Conjugative DNA transfer;
                     Region: T4SS-DNA_transf; pfam02534"
                     /db_xref="CDD:251356"
     misc_feature    251090..252379
                     /locus_tag="HPSH112_01300"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(251096..251101,251111..251119)
                     /locus_tag="HPSH112_01300"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(251099..251101,251111..251119,251168..251170,
                     251174..251179,252041..252046)
                     /locus_tag="HPSH112_01300"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    252029..252043
                     /locus_tag="HPSH112_01300"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            252981..260810
                     /locus_tag="HPSH112_01305"
                     /db_xref="GeneID:12773034"
     CDS             252981..260810
                     /locus_tag="HPSH112_01305"
                     /note="COG0827 Adenine-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226981.1"
                     /db_xref="GI:386753763"
                     /db_xref="GeneID:12773034"
                     /translation="MISRNPIEWARYLSFERRVHKDNSREDVNFFANGEIKESSRVYE
                     ANEKGFERRITKKYDLIDRNKEFFSKEIDILTYKNSLEELKEQGLEIQLTHHHETHKK
                     TLENGNEIAKEYDYLKDIYHEVERTKTGELVRGIIPSISSAEYFKLYNKLPFESINNE
                     NTKLNTNNTIKNTIETNASNNIIQNNDNNNPNLSIADLELEQQNLGEQNGKERTNRAD
                     EPNRTRAGIPQEIHRRSEHGGQQEGVERSSDEELLHQDSSLFIEPREQGGTRGVYRSS
                     DQQAVSEKSHRERDKLHEHVSRGDGVSARADTRADSNGASSQASRMENGARSEEKGDN
                     PSDERGVSPTPQSPSHQQNSSRDLGLSLSREQPGQTGRLRLFDHGQMGSLFPTDHENQ
                     RSKNDNELDRSSNRTNENGDKSPRQNGSANQESARSERYGIAQGSSSQSVLPLAQSRL
                     HHAGLSTPNGLGNLEEDRDQERGLLSNLDHLESLLNAIRNNTIASEPDFRTRLLEAIQ
                     NNEPLKDSIVGMQLLKDPTTKIFYDKFQLKISPKKVLEILENRIKKSIETANETLNAF
                     NALDSQAIDGNAISNSVGLNPTQESGITDNSVELNNAQEQTAQEQDTQENAQTTIKQE
                     TPTAPAIPLNPKIDFKPSEEVLIKGAKTRYKANIKAIELLKELQAKQEILKGDYYATQ
                     EEQKILAQFSGWGGLESYFKKDQRPEEFKELNALLTKDEFRRAYSSTRDAYYTPKLVI
                     DSIYQGLDQLGFNNDNHQKEIFEPSLGTGKFIAHAPSDKNYRFMGTELDPISANISKF
                     LYPNQVINNTALENHQFYQEYDAFVGNPPYGSHKIYSSNDKELSNESVHNYFLGKAIK
                     ELKDDGIGAFVVSSWFMDGKNPKMREHIAQNTTFLGAIRLPNSVFKATGAEVSSDIVF
                     FKKGVDGATNQSFTKAMPYYDKIIDSLDNDTLFALQNNRFDSFTPSDQLKIVNAIASH
                     FGFKQEKLQRWYEKIDTANFGYREQDYKIIKGFIDKVGENNINLNEQTLNEYFIHHPE
                     NILGHLSLEKTRYSFEINGEQIYKYELQALEDKSLDLSQALHQAIEKLPKDVYQYHKT
                     TFKTDALIIDANNERYQEVQKLIKNLERGELVKWDNLYFQLEQNNERGIFLKPTKINS
                     KVQDSRLKAYFKIKDALNDLTSAELSPLSSDLELESKRVRLNLVYDEFVKKFGYLNEN
                     KNRKDIKQDLYGAKVLGLEKDFEKEITPRSAKMQNIEPRQAQAKKAQIFFERTLNPKK
                     ELIITNAKEALIASINQKGGLNLHFIRDHFATQSLETTIKELLEQKLIYKDHKDNGDY
                     VLANDYLSGNVKRKLKEVKEAINQGVEGLEANVKDLELIIPKDLKATEIMANINSPWI
                     PTQYLEEFLIELAANHYEKQYGDKMTDYQLGNLKEGIKVEHLSGAYEVLVRNNELNEL
                     YGIRHKDKPHSYKAPFESLLIKVLNNKDLSVKYAQVDPNDPKKEIFITDEEQSNLARQ
                     KAEELKEAFKDWIYKDYTRRTHLEQIYNDTFNNSVLKTYDGSQLELEGFNHHISLRPH
                     QKNAIFRTIQDRAVCLDHQVGAGKTLCAIASCMEQKRMGLVNKTLIAVPNHLTKQWGD
                     EFYKAYPNANVLVVDSKDITEKERELLFNQIANNNYDAVIIAHTHLELLSNPRGIIEE
                     LKEEELVNAEKNFERQELAYKNNPRETKKPNERAFKSKLDKIRAKYDAILEKQGSHID
                     ISQMGIDNLIVDEAHLFKNLAFETSMEKIAGLGNQQGSNRARDLLIKTRYLHQNNKKI
                     MFLTGTPIANSLSEMYHLQRYLTPDVLEERGLEFFDDWAKTYGEVVNDFELDTSAQSY
                     KMVNRFSKFSDVQGLSTMYRAFADIVSNDDILKHNPHFVPKVYGDKPINVVVKRSQEV
                     AQFIGVADENGKYNEGSIIDRMQKCEGKKSKKGQDNILSCTTDARKVALDYRLIDPNA
                     KVEKEFSKSYAMAKNIYENYLETNATKGTQLGFIGLSTPKTHSQKVSLEALDNAHEIE
                     NKNPLDEAQELLESLSSYDENGNLIAPSKKELENELKEKEAKSVNLDEELAKGCKFDV
                     YSDVLRHLVQMGIPQNEIAFIHDAKTEEQKQDLFKKINRGGVRVLLGSPAKMGVGTNV
                     QERLVAMHELDCPWRPDELLQMEGRGIRQGNILHQNDPENFRMKIYRYATEKTYDSRM
                     WQIIETKSKGIEQFRNAHKLGLNELEDFNMGSSNASEMKAEATGNPLIIEEVKLRAEI
                     KNEEAKYKAFNKENYFNEENLKNNSSKLDYLKQELKDLETLQSSVMIPTHTEIKLYDL
                     KNEESKDYELIKVKEVEPLKENASMSEELTHKKLKEQNKQIAEQNKEKLDAIKKQFAS
                     NLNDLFFNEERDCKLLEYKGFVVNAYKTKYQVEFSLNPKDNPNIAYSPSNMVYKNDTA
                     NMFSSYNFCGEIKFDGFLKRLDNAITKLPEKIKELENSIKITQENIAKYTRLVEQKPP
                     YPRLEYLQALKWDHKTLIDDLAKMSKDRDYKPVFNPKSQEVLEKMNAEKRASLENEGK
                     EMTEIKNSNKEQEIKRDIKSDDEVRQHIEQVIEKEIEKGTENISSSELITTNNIDYYE
                     NEEVEIIKSRGRR"
     misc_feature    255177..256031
                     /locus_tag="HPSH112_01305"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; pfam02384"
                     /db_xref="CDD:251262"
     misc_feature    255261..255590
                     /locus_tag="HPSH112_01305"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     misc_feature    256041..258848
                     /locus_tag="HPSH112_01305"
                     /note="DNA methylase [Transcription / DNA replication,
                     recombination, and repair]; Region: COG4646"
                     /db_xref="CDD:226993"
     misc_feature    257619..>257819
                     /locus_tag="HPSH112_01305"
                     /note="Type III restriction enzyme, res subunit; Region:
                     ResIII; pfam04851"
                     /db_xref="CDD:252834"
     misc_feature    257625..258437
                     /locus_tag="HPSH112_01305"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    259218..259466
                     /locus_tag="HPSH112_01305"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            260933..261181
                     /locus_tag="HPSH112_01310"
                     /db_xref="GeneID:12773035"
     CDS             260933..261181
                     /locus_tag="HPSH112_01310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226982.1"
                     /db_xref="GI:386753764"
                     /db_xref="GeneID:12773035"
                     /translation="MNYDVLMGFLALIGLILWYGYGLRQYLKLKDENKRLKEKLQRCN
                     CNIKIPSILEVVNRPIIMDIKGELPHLAKNYRNNQIKE"
     gene            261185..263245
                     /locus_tag="HPSH112_01315"
                     /db_xref="GeneID:12773036"
     CDS             261185..263245
                     /locus_tag="HPSH112_01315"
                     /note="COG0550 Topoisomerase IA"
                     /codon_start=1
                     /transl_table=11
                     /product="topoisomerase I"
                     /protein_id="YP_006226983.1"
                     /db_xref="GI:386753765"
                     /db_xref="GeneID:12773036"
                     /translation="MKDSVIIIESPNKVAKIKEITGASVFATIGHFMQLKSYDEDNNF
                     KPTFEYDPQKKKRIFEIIEACKNKKVYIATDPDREGYAIGYHFYEKIKRIASSIYRAE
                     FFEITPSGINKGLQNASLFENTNKQMYQSALARRVADMLLGFTLSPYLGKALGQMKGS
                     SAGRVQTPCLKLIVDRDREIEKFKALPENEKVSYQIQAKINDNANKEVIIKHCDENGE
                     EIKFNDKEEALKLFESLKDNKACLLKDLKNSVAETKPKKPFITSTLLEKASSELGLGI
                     SEVQSLAQSLFEAGLITYIRTDAESLSVEFLNEAENFYTPIYKEVYLKREYKAGKQSQ
                     AEAHEAIRITHPHTYENLESVVYNAGITNQDALKLYQLIFERTIESQGKNAIYDKQDL
                     LFKIKNEYFKCSVKSLKSAGFLAMFSKKELESDESNDDKDDKEKDQNAQFNLKIDDVL
                     SLNDLVLATIKRNTPSPYKEAGFVKLLENKGIGRPSTYATYLPALLKREYFSISQDKK
                     HTITPTHKGKRVVEVFENAYQFIIDLTYTKQMEEVLDEIVENKSSYVDFISNLSSKCP
                     KIEKLERNDDEIKPSSEGQITYMENILRDLQLELSEEFKNYKEDNRVAKAFLDRYIKE
                     HEFFKKNNKKASSSNNDETRPATPKQIRFAESLAKKHHVKLPKDYKSNMKVCGDFINE
                     YSKK"
     misc_feature    261191..262942
                     /locus_tag="HPSH112_01315"
                     /note="Topoisomerase IA [DNA replication, recombination,
                     and repair]; Region: TopA; COG0550"
                     /db_xref="CDD:223624"
     misc_feature    261194..261535
                     /locus_tag="HPSH112_01315"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     misc_feature    order(261209..261214,261221..261223,261407..261409,
                     261413..261415,261419..261421)
                     /locus_tag="HPSH112_01315"
                     /note="active site"
                     /db_xref="CDD:173773"
     misc_feature    order(261209..261211,261407..261409)
                     /locus_tag="HPSH112_01315"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173773"
     misc_feature    261566..262867
                     /locus_tag="HPSH112_01315"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    order(261566..261643,261662..261724)
                     /locus_tag="HPSH112_01315"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(261587..261592,261599..261601,261611..261613,
                     261623..261625,262034..262036,262046..262048,
                     262070..262072,262640..262645,262652..262657,
                     262661..262663,262673..262678)
                     /locus_tag="HPSH112_01315"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    order(261695..261697,261707..261709,262757..262759)
                     /locus_tag="HPSH112_01315"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(261857..261877,261899..261946,262331..262375,
                     262379..262435,262541..262573)
                     /locus_tag="HPSH112_01315"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(261947..261967,261971..262138,262193..262219,
                     262250..262252,262271..262330)
                     /locus_tag="HPSH112_01315"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(261980..261982,261992..262000,262196..262198,
                     262286..262288,262295..262297,262307..262309,
                     262634..262636,262640..262642,262715..262717)
                     /locus_tag="HPSH112_01315"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    order(262064..262066,262070..262072,262196..262198)
                     /locus_tag="HPSH112_01315"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    order(262574..262693,262703..262705,262715..262759,
                     262775..262867)
                     /locus_tag="HPSH112_01315"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     gene            263300..263767
                     /locus_tag="HPSH112_01320"
                     /db_xref="GeneID:12773037"
     CDS             263300..263767
                     /locus_tag="HPSH112_01320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226984.1"
                     /db_xref="GI:386753766"
                     /db_xref="GeneID:12773037"
                     /translation="MLYIPPTSKEVYVSSIVALNIHSPQGTGDWHSSRALMPNAIDLC
                     YYIYGKDQERNTNHLLGDLGIIDGTERLNKMGYYPENSPTYIAEHPRACVDYLYMAVL
                     KTGSLGRVMLDEWFPSIEDKKSVYALIEVMKPKLNKQERENLDKWIARNPITE"
     gene            263737..264528
                     /locus_tag="HPSH112_01325"
                     /db_xref="GeneID:12773038"
     CDS             263737..264528
                     /locus_tag="HPSH112_01325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226985.1"
                     /db_xref="GI:386753767"
                     /db_xref="GeneID:12773038"
                     /translation="MDSKKPYYRVILSEQEIYHERLMRAIVKNLVDTPMVLKGGTALY
                     LGYGLNRFSEDLDFDCHKKINLLSKVKSAIPSGIILNDIHIKKDTNSVGRYMVRYATK
                     GNKEEQTLKLEVSYRDAPKESEFNVIEGMKIAKVERIIDNKLCACFDGEHTRTKARDL
                     FDLHFLAKHYEEHFNLDLAKRLKEFSKDPDKLASNYLEDKNDDILLNKIMDLEETALE
                     LSIMAHLIHKKLEKQSYSLNTLKEPNVYNSLDNSNENTHTSKHRR"
     misc_feature    263797..264351
                     /locus_tag="HPSH112_01325"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            complement(264821..265189)
                     /locus_tag="HPSH112_01330"
                     /db_xref="GeneID:12773039"
     CDS             complement(264821..265189)
                     /locus_tag="HPSH112_01330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226986.1"
                     /db_xref="GI:386753768"
                     /db_xref="GeneID:12773039"
                     /translation="MDLQQIDDLEKKLEESLNKEEQVSELENHLEQEPNTKEVKTPKK
                     RGRKKSILDEDKKKSFNVSFSPSIIKELDEFLLEFGSFKETRSTFIEEALIRHLKHRK
                     NTQEQKLLKQIEKLQNKERD"
     gene            complement(265230..265898)
                     /locus_tag="HPSH112_01335"
                     /db_xref="GeneID:12773040"
     CDS             complement(265230..265898)
                     /locus_tag="HPSH112_01335"
                     /note="COG1192 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226987.1"
                     /db_xref="GI:386753769"
                     /db_xref="GeneID:12773040"
                     /translation="MTICIANEKGGSGKSTLCLNLAVQLLKDNKEVIVFDTDSQKSME
                     VFTEIRTQKEHKTFSLFNRSSGFSDTLKQMVSKYENILIDTKGEYSKETQKAMLLSDI
                     VLVPTTPSQLDTEVLANMLERIEQLQELNENLRALIIINRMPTIPTLKERQALIEFIK
                     ENNPSDKITLLENSLSERIVYKRSVSEGLGVIEYSDKKAINEWANFYNELKGYLEKEK
                     KHAL"
     misc_feature    complement(265245..265898)
                     /locus_tag="HPSH112_01335"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(265476..265895)
                     /locus_tag="HPSH112_01335"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(<265671..265874)
                     /locus_tag="HPSH112_01335"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(265854..265874)
                     /locus_tag="HPSH112_01335"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(265647..265649,265854..265856))
                     /locus_tag="HPSH112_01335"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            266707..266877
                     /locus_tag="HPSH112_01340"
                     /db_xref="GeneID:12773041"
     CDS             266707..266877
                     /locus_tag="HPSH112_01340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226988.1"
                     /db_xref="GI:386753770"
                     /db_xref="GeneID:12773041"
                     /translation="MAQDFLELTEGNYPMSEEQMLEFMQMGVEPKSEQEVKMELENSL
                     ENTNNSREEDSK"
     gene            266874..267917
                     /locus_tag="HPSH112_01345"
                     /db_xref="GeneID:12773042"
     CDS             266874..267917
                     /locus_tag="HPSH112_01345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226989.1"
                     /db_xref="GI:386753771"
                     /db_xref="GeneID:12773042"
                     /translation="MKAWNEMDIKEQKEIFAQFLANEIAQSLNAGLEFKANNRAYNGN
                     VGNAYNGLNALILDAKQHENGYESNVWVGLDDALKLGANPKEVEFIKNNTKSKNNKEG
                     IYDKASIAYIRDYEMRYVKARDKEGNLIPLKDKEGNARRNAKGEIIYEYEKVPQRDKL
                     GNIKYMQDGVTPFYEFKKEKIDIEPTLEIKNLYNVNIFQTLDKTKLKELDPKTLRTQY
                     ISHTFSMDNQNLVIYDLSKHLNEKEYKKVLDYVEQYGATHSEKSKQYNISQSYQQEPK
                     VEIAPSTENNVKENNEMNMEQFNKMLEMAQNNPQMLAMLQQTLNKGAEQQKHDNYFAN
                     DEAAPTQSKGRGR"
     misc_feature    <267009..>267122
                     /locus_tag="HPSH112_01345"
                     /note="Domain of unknown function (DUF1738); Region:
                     DUF1738; pfam08401"
                     /db_xref="CDD:254778"
     misc_feature    267750..>267824
                     /locus_tag="HPSH112_01345"
                     /note="XPC-binding domain; Region: XPC-binding; pfam09280"
                     /db_xref="CDD:192241"
     gene            269752..271185
                     /locus_tag="HPSH112_01360"
                     /db_xref="GeneID:12773043"
     CDS             269752..271185
                     /locus_tag="HPSH112_01360"
                     /note="COG0358 DNA primase (bacterial type)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226990.1"
                     /db_xref="GI:386753772"
                     /db_xref="GeneID:12773043"
                     /translation="MAYIPNLTALPLHEILLDNGYTYNKNKTSKNNPCLKHENEEGSL
                     VIFKNQNKDGSISYTYKETHTDKVGNIITFCKDRNISVEDLIAGKLEDYLNKQDNLKA
                     RNNTQENNEEVQKIREEFNNLKPYDLENATLIKKREIDVKLLEPYKEHLKTDSLNNLI
                     LATYLAFEDKRLNVIPIHQYGINKRLNTPLTTDKEGNIRDKPLKSIAQGNKGIEVLYP
                     NDLNLVKNVIVTENIFDSLAYLELQDLDPKESVLISTAGQFNAQKLELFFQSFFKQLK
                     NRQQGAYNNYLRQEEQWQELVRQGKANDDFKSVVVETYTDIIKNYQRGKNTPIYNKRV
                     EKTREFRKPQPVNQPQESFNVVLAFDNDVKGKGYREKCEGILYALLQQFPTIYTPFSK
                     DCNDDLKLAHIIENKAINIDIMAEFLESSLEKLNNNDTPIQEKENIMDKLEQIDSLKP
                     FSKEFKDILENIKENLQTQSYVKGRGR"
     misc_feature    270676..270945
                     /locus_tag="HPSH112_01360"
                     /note="Topoisomerase-primase domain. This is a nucleotidyl
                     transferase/hydrolase domain found in type IA, type IIA
                     and type IIB topoisomerases, bacterial DnaG-type primases,
                     small primase-like proteins from bacteria and archaea, OLD
                     family nucleases from...; Region: TOPRIM; cl00718"
                     /db_xref="CDD:260587"
     gene            271185..272441
                     /locus_tag="HPSH112_01365"
                     /db_xref="GeneID:12773044"
     CDS             271185..272441
                     /locus_tag="HPSH112_01365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226991.1"
                     /db_xref="GI:386753773"
                     /db_xref="GeneID:12773044"
                     /translation="MQGNSLSIYETILSLFSDPTKKIFYNIATQTAEVLKAQMIINAV
                     LVILFMIWAYKRVKEGDIFQFKTAMGVVVFIVFMGVLNWAMDNPTTYMNMLKDTIFYP
                     SNKLTEIITNSMTSLQTLTGKNDLTLGSLIDKSYYSITQLYREVFSDLSWKTFFTMFP
                     MLIIFLLLVLAQILLIGLILIIVLITLVETLTWLSLGFAVLPLVLFPQTNGMLFSYLK
                     KLISLTFYQPCIMVVSFLNFSMIESITLKIPTQAEIINGFYNKGHIVDQMIENGSNQA
                     INNFQNAMGAYTSVLGFFIILILGSVICFFLIKRVPDFINNIFGTSGGVGAVTEMMQK
                     IGMTIGGAVVGGSMVMVANQAKQAYQSAGGGLAGLQAGARAMFGAGLSGGITTMANAK
                     GAKAGVRHFVASVKSGFGLDNDRNNK"
     misc_feature    271194..272438
                     /locus_tag="HPSH112_01365"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; cl01503"
                     /db_xref="CDD:260967"
     gene            complement(273708..274358)
                     /locus_tag="HPSH112_01380"
                     /db_xref="GeneID:12773045"
     CDS             complement(273708..274358)
                     /locus_tag="HPSH112_01380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226992.1"
                     /db_xref="GI:386753774"
                     /db_xref="GeneID:12773045"
                     /translation="MIVLKRLDKILRTGLLVGALVVCSPLNVMAKPLFTDANLIDYLS
                     KSKSNIKKEYAIDCNSQIDGSKYLNDGWNLSKNLPQEWKTAFLSCVNKKQLSKKEQEL
                     QKIIDERNEQIKKDEEWLVACRNYVRESRKKAESNFLKKNRCSKSEDGKISCYSNAFY
                     SAYGDTKPKWWTYSGSHFEEKFENEQNQADHECLSKAASLAIMHPKLEIKRAVRQP"
     misc_feature    complement(<273930..>274085)
                     /locus_tag="HPSH112_01380"
                     /note="V-type ATP synthase subunit I; Validated; Region:
                     PRK05771"
                     /db_xref="CDD:235600"
     gene            274579..275046
                     /locus_tag="HPSH112_01385"
                     /db_xref="GeneID:12773046"
     CDS             274579..275046
                     /locus_tag="HPSH112_01385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226993.1"
                     /db_xref="GI:386753775"
                     /db_xref="GeneID:12773046"
                     /translation="MQDLQDFKNDITLILSKDRLDTYDNLEQYKENLKLISSITPKIS
                     NLEIYLRNALDYCLTQNKGSEWVFDENSLIPLIEELKNKKKEISHSLILSKMSLGAVI
                     KLIFFYKLESSVLNLRHFNFKKYYQDNKNTLLVNDRKQSLYDYIKVHIALSLL"
     gene            275164..275262
                     /locus_tag="HPSH112_01390"
                     /db_xref="GeneID:12773047"
     CDS             275164..275262
                     /locus_tag="HPSH112_01390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226994.1"
                     /db_xref="GI:386753776"
                     /db_xref="GeneID:12773047"
                     /translation="MNISVESSKITLFLDDLIKSIGNKDLEELSNL"
     gene            275383..276171
                     /locus_tag="HPSH112_01395"
                     /db_xref="GeneID:12773048"
     CDS             275383..276171
                     /locus_tag="HPSH112_01395"
                     /note="COG3177 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226995.1"
                     /db_xref="GI:386753777"
                     /db_xref="GeneID:12773048"
                     /translation="MNYKELLEFDDYAMDLTIRMAHHSTAIENNPLSLAETISILTAE
                     YIPREMPQRAFFEVKNYQNMLPFLLENLKKEQKIDSFFVRELHGILMNFLLPNKGTFK
                     TTDNMILGASFETTPSFQVPMAMKEWCDNLHYKMNTLQGEEEKLKAILEQHILFERIH
                     PFSDGNGRVGRALILYSVLEQNLVPFVITKDRKEAYIKALDTHNIESLYQLAKIFQEF
                     ELTRIQGQMVLNKNKQENDNTDDLGNNDYLENTNEYTVTPKHRR"
     misc_feature    275383..>276108
                     /locus_tag="HPSH112_01395"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    275614..275910
                     /locus_tag="HPSH112_01395"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            complement(276459..277526)
                     /locus_tag="HPSH112_01400"
                     /db_xref="GeneID:12773049"
     CDS             complement(276459..277526)
                     /locus_tag="HPSH112_01400"
                     /note="COG0582 Integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase/recombinase (xerD)"
                     /protein_id="YP_006226996.1"
                     /db_xref="GI:386753778"
                     /db_xref="GeneID:12773049"
                     /translation="MLNNKLTKSQRELFDNLKVFLYTKVKNFTPIQDVNDMALILNTQ
                     NKVLKCNNVEQLRQLCHILYNQGIKHTIMMQGLFLFFEYFRDNLKLRSFRMLSEEQVI
                     NFLFELAQNRKPSSMAKYVMYLRQFFDYLDRKKHYNFDFALKNLAFAKTKESLPRHLN
                     YKDLKSFLKTLLEYKPTTSFEKRNKCVLLIVILGGLRKCEVLNIELKHIQVEEQNYSI
                     LIQGKGRKERKAYIKKSLLEPSLNAWLSDDYRLKYFNGAYLFKKDKQKSQNSLTLYNF
                     IPLIFKLAQIKHYKQYGTGLHLFRHSFATLIYQETQDLVLTSRALGHSSLLSTKIYIH
                     TTQEHNKKVALVFDSLIDNKK"
     misc_feature    complement(276498..277322)
                     /locus_tag="HPSH112_01400"
                     /note="tyrosine recombinase XerC; Region: recomb_XerC;
                     TIGR02224"
                     /db_xref="CDD:233788"
     misc_feature    complement(276525..277040)
                     /locus_tag="HPSH112_01400"
                     /note="DNA breaking-rejoining enzymes,
                     intergrase/recombinases, C-terminal catalytic domain. The
                     tyrosine recombinase/integrase family share the same
                     catalytic domain containing six conserved active site
                     residues. The best-studied members of this diverse
                     family...; Region: INT_REC_C; cd01182"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(276531..276533,276636..276641,
                     276858..276860,276933..276938))
                     /locus_tag="HPSH112_01400"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(276531..276533,276558..276560,
                     276627..276629,276636..276638,276858..276860,
                     276936..276938))
                     /locus_tag="HPSH112_01400"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(276531..276533,276558..276560,
                     276627..276629,276636..276638,276936..276938))
                     /locus_tag="HPSH112_01400"
                     /note="active site"
                     /db_xref="CDD:238587"
     misc_feature    complement(order(276531..276533,276627..276629,
                     276936..276938))
                     /locus_tag="HPSH112_01400"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238587"
     misc_feature    complement(278485..280524)
                     /note="potential frameshift: common BLAST hit:
                     gi|210135543|ref|YP_002301982.1| relaxase"
     gene            281387..281668
                     /locus_tag="HPSH112_01415"
                     /db_xref="GeneID:12773050"
     CDS             281387..281668
                     /locus_tag="HPSH112_01415"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226997.1"
                     /db_xref="GI:386753779"
                     /db_xref="GeneID:12773050"
                     /translation="MKLRERLKLTFLFKKQPLYKCMRVGLNDKWDNQKLENKWVISSY
                     EIYNSEGEPPSLLMAQLQGVGLGTPKLTEPNLTTNALKNQESYKMVFMP"
     misc_feature    281441..>281644
                     /locus_tag="HPSH112_01415"
                     /note="Protein of unknown function (DUF3519); Region:
                     DUF3519; pfam12033"
                     /db_xref="CDD:152468"
     gene            complement(281790..282623)
                     /locus_tag="HPSH112_01420"
                     /db_xref="GeneID:12773051"
     CDS             complement(281790..282623)
                     /locus_tag="HPSH112_01420"
                     /note="COG0730 Predicted permeases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226998.1"
                     /db_xref="GI:386753780"
                     /db_xref="GeneID:12773051"
                     /translation="MEESTAFILALVGLFTGITAGFFGIGGGEIVVPSAIFAHFSYSH
                     AVGISLMQMLFSSVVGSIINYKKGLLDLKEGSFAAFGGLMGAILGSFILKIIDDKILM
                     AVFVVVVCYTFIKYAFSNNKKPEHFEEMHFDLHANNKTPDKKRPIPFVSMDRTHGVLM
                     LAGFVTGIFSIPLGMGGGILMVPFLGYFLKYDSKKIVPLGLFFVVFASLSGVISLYNG
                     RVLDNISVQAGVITGIGAFLGVGIGIKLIALANEKVHKILLLLIYALSILATLHKLIM
                     G"
     misc_feature    complement(281793..282623)
                     /locus_tag="HPSH112_01420"
                     /note="Predicted permeases [General function prediction
                     only]; Region: COG0730"
                     /db_xref="CDD:223802"
     gene            complement(282649..282846)
                     /locus_tag="HPSH112_01425"
                     /db_xref="GeneID:12773052"
     CDS             complement(282649..282846)
                     /locus_tag="HPSH112_01425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006226999.1"
                     /db_xref="GI:386753781"
                     /db_xref="GeneID:12773052"
                     /translation="MCLLIKTLFKKRGLFKTLEGIFKIKCFIKRAYLLQSLSSYKTNQ
                     NPVFVIIKEKFFKDYHSFLIK"
     gene            complement(282830..284917)
                     /locus_tag="HPSH112_01430"
                     /db_xref="GeneID:12773053"
     CDS             complement(282830..284917)
                     /locus_tag="HPSH112_01430"
                     /codon_start=1
                     /transl_table=11
                     /product="putative Outer membrane protein"
                     /protein_id="YP_006227000.1"
                     /db_xref="GI:386753782"
                     /db_xref="GeneID:12773053"
                     /translation="MKIKKSLLLSLSLMASLSRAEDDGFYMSVGYQIGEAAQMVKNTG
                     ALQNLADKYDNLSNLLNQYNYLNSLVNLASTPSAITSAIDNLSSSAINLTSATTTSPA
                     YQAVALALNAAVGMWQVIAFGISCGPGPNLGPEHLENGGVRSFSNTPNYSYSTNSGTT
                     TTTCNGASNVGPNGILSSSEYQTLNTAYQTIQTALNQSQGGGMPALNGSKKMVVNINQ
                     TFTRNPTTENTYPDGDGNYYSGGFAIPIQLKFNSVNDAENLLQQAATIMQVLTTQNPH
                     VNGGGGAWGFHGKTGSVMDIFGESFNAINEMIKNAQAVLEKTKQLNANENTQITQPEN
                     FNPYTSKDKGFAQEMLNRANAQAEILSLAQQVANNFHSIQGPIQQDLEECLAGSAGVI
                     NDKTYGSGCAFVKETLNSLEQHATYYGNQVNQEKALAQTILDFKGALNTLNNDQKAIN
                     SAISSLPNAKSLQNMTHSTQNPNSPEGLLTYSLDSNKYNQLQATTQELGKNPFRRFGM
                     ISSQTNNGAMNGIGVQMGYKQFFGKKRNWGLRYYGFFDYNHAFIKSSFFNSASDVWTY
                     GVGMDALYNFINDKNTNFLGKNNKLSVGLFGGFALAGTSWLNSEFVNLNVVGNIYSAK
                     MNVANFQFLFNLGLRMNLARSKKKDSDHAAQHGVELGVKIPTINTDYYSFMGAELKYR
                     RLYSVYLNYVFAY"
     misc_feature    complement(282833..283354)
                     /locus_tag="HPSH112_01430"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            285171..286328
                     /locus_tag="HPSH112_01435"
                     /db_xref="GeneID:12773054"
     CDS             285171..286328
                     /locus_tag="HPSH112_01435"
                     /note="COG0659 Sulfate permease and related transporters
                     (MFS superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sulfate permease"
                     /protein_id="YP_006227001.1"
                     /db_xref="GI:386753783"
                     /db_xref="GeneID:12773054"
                     /translation="MFEKIQKEWLSNIQKDLLSGFVVGLSVIPETAGFAIMVGLDVGV
                     AFYTTFYMAFVLSFFGARKAMISAAAGSVALILVGVVKNYGLEYAGVATLMAGVLQIL
                     LGYLKIGNLLRFIPQSVMYGFVNALGILLLMEQFKFLQNQNVGVFILLVIGILIIYLF
                     PLITKKIPSNLVCILIVSAIALIFDTHAPNLGSIEQGISGFHPIIIPKNLDFKILIEL
                     LPYALSLALVGTIESLLTAKTLDMILKDGVSDKNKETKAQGLGNIISGLLGGMTGCAL
                     VGQSIINAKSGAKTRLSTFFAGFSLMVLVLVFNEYVVKIPIVAVVAVMVMISFTTFNF
                     QSIINIKKIKPYDTLNMLLVVAVVLYTHNLAIGVVVGVLVNALWIKSKGIA"
     misc_feature    285171..>286307
                     /locus_tag="HPSH112_01435"
                     /note="Sulfate permease and related transporters (MFS
                     superfamily) [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     misc_feature    285183..285413
                     /locus_tag="HPSH112_01435"
                     /note="Sulfate transporter N-terminal domain with GLY
                     motif; Region: Sulfate_tra_GLY; pfam13792"
                     /db_xref="CDD:258076"
     misc_feature    285477..286217
                     /locus_tag="HPSH112_01435"
                     /note="Sulfate transporter family; Region: Sulfate_transp;
                     cl19250"
                     /db_xref="CDD:267603"
     gene            complement(286363..286437)
                     /locus_tag="HPSH112_t08196"
                     /db_xref="GeneID:12773055"
     tRNA            complement(286363..286437)
                     /locus_tag="HPSH112_t08196"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:12773055"
     gene            complement(286568..288019)
                     /locus_tag="HPSH112_01440"
                     /db_xref="GeneID:12773056"
     CDS             complement(286568..288019)
                     /locus_tag="HPSH112_01440"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_006227002.1"
                     /db_xref="GI:386753784"
                     /db_xref="GeneID:12773056"
                     /translation="MKKTILLSLMASSLLAEDDGVFMSVGYQIGEAAQMVKNTGEIQK
                     VSNAYDNLNNLLTRYNELKQTASNTDSSTAQAIDNLKESANRLKTTPNSANQAVSSAL
                     SSAVAMWQVIASNLANNSLPTNEYEKINTISQSLQNTLENKNNNLTIDNDYEQLLTQA
                     STIISTLQSQCPGIDGGNGKPWGINASGNACNIFGNTFNAINSMINSAKKAAAQSRRT
                     DPESPNQPNAFTNADFNKNLNQVSSVINNTISYLKGDNLATIYNTIQKTPGSKGFQSL
                     VSRSSHSYSLNETQYSEFQTTTKEFGHNPFRSVGLINSQSNNGAMNGVGVQLGYKQFF
                     GKNKFFGIRYYAFFDYNHAYIKSNFFNSASNVFTYGAGSDLLLNFINGGSNQNRKISF
                     GIFGGIALAGTTWLNSQFVNLKTTTSIYSAKINNTNFQFLFNTGLRLQGIHHGVELGV
                     KIPTINTNYYSFMGAKLAYRRLYSVYFNYVLAY"
     misc_feature    complement(286571..287047)
                     /locus_tag="HPSH112_01440"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            complement(288213..288938)
                     /locus_tag="HPSH112_01445"
                     /db_xref="GeneID:12773057"
     CDS             complement(288213..288938)
                     /locus_tag="HPSH112_01445"
                     /EC_number="2.7.7.38"
                     /note="COG1212 CMP-2-keto-3-deoxyoctulosonic acid
                     synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-manno-octulosonate cytidylyltransferase"
                     /protein_id="YP_006227003.1"
                     /db_xref="GI:386753785"
                     /db_xref="GeneID:12773057"
                     /translation="MIIIPARLKSSRFENKVLEDIFGLPMVVRCAKNANLVDECVVAC
                     DDESIMQTCQKFHIKAVLTSKHHNSGTERCLEAAQILGLKNDERVLNLQGDEPFLEKE
                     VILALLEATKNAPFMATCAKVIDEEQAKSPNLVKVVLDSQSNALYFSRSLIPFLRDAG
                     MKRQTPLLGHIGIYGFHNKEILEELCALKPCVLEELEKLEQLRALYYQKKIAVKIVQS
                     QSVGIDTKEDLQNALKIFSPNLL"
     misc_feature    complement(288234..288935)
                     /locus_tag="HPSH112_01445"
                     /note="CMP-KDO synthetase catalyzes the activation of KDO
                     which is an essential component of the lipopolysaccharide;
                     Region: CMP-KDO-Synthetase; cd02517"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(288654..288656,288660..288662,
                     288729..288731,288810..288812,288918..288926))
                     /locus_tag="HPSH112_01445"
                     /note="Ligand binding site; other site"
                     /db_xref="CDD:133010"
     misc_feature    complement(order(288315..288326,288345..288353,
                     288360..288365,288441..288443,288474..288494,
                     288498..288503,288519..288527,288543..288545,
                     288591..288593))
                     /locus_tag="HPSH112_01445"
                     /note="oligomer interface; other site"
                     /db_xref="CDD:133010"
     gene            289051..289848
                     /locus_tag="HPSH112_01450"
                     /db_xref="GeneID:12773058"
     CDS             289051..289848
                     /locus_tag="HPSH112_01450"
                     /note="COG1651 Protein-disulfide isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227004.1"
                     /db_xref="GI:386753786"
                     /db_xref="GeneID:12773058"
                     /translation="MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTN
                     KKVRILEIKPLKSSQDLKMVVIEDPDTKYNIPLIVSKDGNLVIGLGGIFFSNNAGDVK
                     LLTETNQKILALNTNQQNSAKLNAIFDEVPADYAIELPSTNAENKDKILYIVSDPMCP
                     HCQKELTKLRDHLKENTVRMVVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISIL
                     EKIYSTQYDINDQKEPEDLRTKVENTTKKIFESGMIKGVPFLYHYKA"
     misc_feature    289060..289845
                     /locus_tag="HPSH112_01450"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    289306..>289662
                     /locus_tag="HPSH112_01450"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            289864..290517
                     /locus_tag="HPSH112_01455"
                     /db_xref="GeneID:12773059"
     CDS             289864..290517
                     /locus_tag="HPSH112_01455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227005.1"
                     /db_xref="GI:386753787"
                     /db_xref="GeneID:12773059"
                     /translation="MKKPYRKISDYAIVGGLSALVMVSIVGCKSNADDKPKEQSSLSQ
                     SVQKGAFVILEEQKDKSYKVVEEYPSSRTHIIVRDLQGNERVLSNEEIQKLIKEEEAK
                     IDNGTSKLIQPNNGGGGSNESSGFGLGSAILGSAAGAILGSYIGNKLFNNPNYQQNAQ
                     RTYKSPQAYQRSQNSFSKSVPSASSMGGASKGQSGFFGSSRPTSSPAVSSGTRGFNS"
     misc_feature    289867..290493
                     /locus_tag="HPSH112_01455"
                     /note="hypothetical protein; Provisional; Region:
                     PRK04081"
                     /db_xref="CDD:235218"
     gene            290542..291714
                     /locus_tag="HPSH112_01460"
                     /db_xref="GeneID:12773060"
     CDS             290542..291714
                     /locus_tag="HPSH112_01460"
                     /note="COG0754 Glutathionylspermidine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227006.1"
                     /db_xref="GI:386753788"
                     /db_xref="GeneID:12773060"
                     /translation="MQVIPLKPLDNKTLEEIGLDWHTNDDMSSYIADEMVVVSQKEAD
                     AYYDACNELYDMFVETAEEAIQNDRFFELDIPNALIPMIKQSFEEEVHWHIYGRFDLA
                     GGLDGKPIKLLEFNADTPTMLYETAVIQWALLKANGYDENKQFNNLYEALGENFKRMV
                     TLGEDTSRFEEMYEGWKILFSSVRGNIEEERTMRFLQDAAQSVGFETDFSYIDEVEFN
                     AEEGVFKNGLNYEFLFKLIPWENIAIDEPELALLMQGMMENKNTIFLNPAYTILFQSK
                     RFLKLLWDRYPNHPLLLETSYEPLSNKKQIKKVAFGREGANSEIFEASMQSLLKTDGV
                     YSNHKPVYQEFYELNSHNGLYYQPNVFFAYESCALGFRKGGLILDNFSKFVSHMLQ"
     misc_feature    290551..291711
                     /locus_tag="HPSH112_01460"
                     /note="Glutathionylspermidine synthase [Amino acid
                     transport and metabolism]; Region: Gsp; COG0754"
                     /db_xref="CDD:223825"
     gene            291714..292244
                     /locus_tag="HPSH112_01465"
                     /db_xref="GeneID:12773061"
     CDS             291714..292244
                     /locus_tag="HPSH112_01465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227007.1"
                     /db_xref="GI:386753789"
                     /db_xref="GeneID:12773061"
                     /translation="MVAMMRYFHIYATTFFFPLALLFAISGLSLLFGVRQDTGAKIKE
                     WVLEKSLKKEERLDFLKDFLKENHIAMPKKIEPREYRGALVIGTPLYEINLETKGAQI
                     KIKTIERGFLGALIMLHKAKVGVVFKTLLGIFCVFLLLFYLSAFLMVAFKDTKRMFIS
                     VLIGFVVFFGAIYWSL"
     misc_feature    291726..292220
                     /locus_tag="HPSH112_01465"
                     /note="PepSY-associated TM helix; Region: PepSY_TM_1;
                     cl19400"
                     /db_xref="CDD:267753"
     gene            292338..292415
                     /locus_tag="HPSH112_01470"
                     /db_xref="GeneID:12773062"
     CDS             292338..292415
                     /locus_tag="HPSH112_01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227008.1"
                     /db_xref="GI:386753790"
                     /db_xref="GeneID:12773062"
                     /translation="MGFWEGYFKMPPISLWVLKIPFFKN"
     gene            complement(292689..293756)
                     /locus_tag="HPSH112_01475"
                     /db_xref="GeneID:12773063"
     CDS             complement(292689..293756)
                     /locus_tag="HPSH112_01475"
                     /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227009.1"
                     /db_xref="GI:386753791"
                     /db_xref="GeneID:12773063"
                     /translation="MSVKILKMLVCGLFFWSLQAHLWGKKDNSFLGVAERAYKSGNYS
                     KATSYFKKACNDGVSEGCTQLGIIYENGQGTKIDYKKALEYYQSACQGDDREGCFGLG
                     GLYDEGLGTTQNYQEAIDAYAKACVLKHPESCYNLGIIYDRKIKGNAAQAVTYYQKSC
                     NFDMAKGCYVLGVAYEKGFLEVKQSNHKAVIYYLKACRLDDGQACRALGSLFENGDAG
                     LDEDFEVAFDYLQKACTLNNSGGCASLGSMYMLGRYVKKDPQKAFNFFKQACDMGNAV
                     SCSRMGFMYSQGDAVPKDLRKALDNYERGCDMGDEVGCFALAGMYYNMKDKENAIMIY
                     DKGCKLGMKQACENLTKLRGY"
     misc_feature    complement(292755..293678)
                     /locus_tag="HPSH112_01475"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(293382..293675)
                     /locus_tag="HPSH112_01475"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(293421..293423,293436..293438,
                     293445..293450,293457..293462,293544..293549,
                     293556..293561,293565..293570,293649..293654,
                     293661..293666,293670..293675))
                     /locus_tag="HPSH112_01475"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(293382..293384,293391..293393,
                     293403..293405,293451..293453,293490..293492,
                     293499..293501,293511..293513,293559..293561,
                     293598..293600,293607..293609,293619..293621,
                     293655..293657))
                     /locus_tag="HPSH112_01475"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(293157..293471)
                     /locus_tag="HPSH112_01475"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(293208..293210,293226..293228,
                     293235..293240,293247..293252,293328..293333,
                     293340..293345,293349..293354,293445..293450,
                     293457..293462,293466..293471))
                     /locus_tag="HPSH112_01475"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(293169..293171,293178..293180,
                     293190..293192,293241..293243,293280..293282,
                     293289..293291,293301..293303,293343..293345,
                     293382..293384,293391..293393,293403..293405,
                     293451..293453))
                     /locus_tag="HPSH112_01475"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(292935..293036)
                     /locus_tag="HPSH112_01475"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(order(292746..292748,292755..292757,
                     292767..292769,292803..292805,292842..292844,
                     292851..292853,292863..292865,292911..292913,
                     292950..292952,292959..292961,292971..292973))
                     /locus_tag="HPSH112_01475"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(292827..292934)
                     /locus_tag="HPSH112_01475"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    complement(order(292785..292790,292797..292802,
                     292809..292814,292896..292901,292908..292913,
                     292917..292922))
                     /locus_tag="HPSH112_01475"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(293850..294218)
                     /locus_tag="HPSH112_01480"
                     /db_xref="GeneID:12773064"
     CDS             complement(293850..294218)
                     /locus_tag="HPSH112_01480"
                     /note="COG2010 Cytochrome c, mono- and diheme variants"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227010.1"
                     /db_xref="GI:386753792"
                     /db_xref="GeneID:12773064"
                     /translation="MRLFIALVLFLWLSLNAKEADFISDLEYGMALYKNPRGVACAKC
                     HGIKGEKQEITFYYEKGEKKILYAPKINHLDFKTFKDALSLGKGMMPKYNLNLEEIQA
                     IYLYITSLAHKEERKEPFKP"
     misc_feature    complement(293898..294134)
                     /locus_tag="HPSH112_01480"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            complement(294218..295138)
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /db_xref="GeneID:12773065"
     CDS             complement(294218..295138)
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /EC_number="2.5.1.61"
                     /note="COG0181 Porphobilinogen deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="porphobilinogen deaminase"
                     /protein_id="YP_006227011.1"
                     /db_xref="GI:386753793"
                     /db_xref="GeneID:12773065"
                     /translation="MGNLVIGSRGSELALWQANHIKERLKKECSIESEIQIVKTKGDK
                     ILDTPLNKIGGKGLFTKELEELLLKGEIDLAVHSLKDVPVVFEKGLDLACITKRADVR
                     DTFLSVKFPDLMSLPKGAKVGTTSLRRSMQLKLKRQDLDTESLRGNVQTRLKKLECGE
                     FDAIILAEAGLCRLEIQGAKYRKAFSVEEMIPSMGQGALGVEMLKSHKHFATLQKLND
                     EESAFCCHLEREFIKGLNGGCQIPIGVHASLMGDRVKIRAVLGLPNGKEVIAKEKQGD
                     KTKALDLVQELLEAFLQSGAKEILEKAQLF"
     misc_feature    complement(294224..295138)
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /note="Porphobilinogen deaminase [Coenzyme metabolism];
                     Region: HemC; COG0181"
                     /db_xref="CDD:223259"
     misc_feature    complement(294260..295129)
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(294329..294331,294335..294337,
                     294344..294346,294353..294355,294368..294370,
                     294404..294406,294410..294412,294422..294424,
                     294443..294445,294452..294457,294467..294469,
                     294476..294478,294494..294496,294548..294571,
                     294620..294625,294632..294634,294695..294697,
                     294734..294736,294746..294751,294755..294757,
                     294830..294847,294851..294856,294881..294883,
                     294887..294904,295091..295093,295106..295108))
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(294422..294424,294548..294553,
                     294560..294562,294620..294622,294629..294631,
                     294638..294646,294683..294685,294704..294706,
                     294752..294757,294761..294769,294896..294901,
                     294905..294907,295088..295090,295100..295102))
                     /gene="hemC"
                     /locus_tag="HPSH112_01485"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            complement(295149..296882)
                     /locus_tag="HPSH112_01490"
                     /db_xref="GeneID:12773066"
     CDS             complement(295149..296882)
                     /locus_tag="HPSH112_01490"
                     /EC_number="6.1.1.15"
                     /note="COG0442 Prolyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="YP_006227012.1"
                     /db_xref="GI:386753794"
                     /db_xref="GeneID:12773066"
                     /translation="MLFSKLFAPTLKEPPKDAVLKSHKHLAQAGYIYQVGSGIYNFLP
                     LAKKVLDKIENITHKRMQEHGAQNILMSFVVLASLWEKSGRLDKYGKELLVFKDRKDN
                     DFVLSPTLEENITEIAANFIKSYKQLPVHLYQIHTKFRDEIRPRFGLVRAREFIMKDG
                     YSFHEDAESLDKEFLNTQSAYKEILSDLGLDFRIVEADSGAIGGSKSREFVVLTECGE
                     DTIVVCKNCDYAANIEIAKRSKRPEPLNVPKAQLAKFPTPNTTSAQSVAEFFKTEPYF
                     VLKALVRKVIHKDKETLACFFVRGDDNLEEVKALNALNLLGANALELREASKEDLNNA
                     GLIAGFIGPYGLKKHVSYIIFDEDLKEGDCLIVGANEKDFHAVGVDLKGFENLVYADI
                     VQVKESDHCPDCQGELKYHKSLEVGHIFKLGQGYAKSLKASFLDKNGKERFFEMGCYG
                     IGISRLLSAILEQKSDDLGCVWTKNTAPFDVVIVVSNWKDEAQKKLAFEVYERLRQKG
                     VDALLDDRDARFGAKMRDFELIGERLALIVGKQTLESKEFECIKRANLEKRTLKDTEL
                     EEKILEMLKSE"
     misc_feature    complement(295164..296882)
                     /locus_tag="HPSH112_01490"
                     /note="prolyl-tRNA synthetase, family II; Region:
                     proS_fam_II; TIGR00409"
                     /db_xref="CDD:232962"
     misc_feature    complement(295494..296834)
                     /locus_tag="HPSH112_01490"
                     /note="Prolyl-tRNA synthetase (ProRS) class II core
                     catalytic domain. ProRS is a homodimer. It is responsible
                     for the attachment of proline to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ProRS_core_prok;
                     cd00779"
                     /db_xref="CDD:238402"
     misc_feature    complement(order(296421..296423,296472..296474,
                     296532..296534,296586..296600,296604..296606,
                     296664..296669,296673..296681,296730..296732,
                     296751..296762,296781..296786))
                     /locus_tag="HPSH112_01490"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(296664..296687)
                     /locus_tag="HPSH112_01490"
                     /note="motif 1; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(order(295518..295520,295527..295529,
                     295533..295541,295629..295631,295635..295640,
                     295644..295646,296406..296408,296412..296414,
                     296418..296420,296427..296435,296457..296459,
                     296463..296465,296550..296552,296556..296558))
                     /locus_tag="HPSH112_01490"
                     /note="active site"
                     /db_xref="CDD:238402"
     misc_feature    complement(296457..296468)
                     /locus_tag="HPSH112_01490"
                     /note="motif 2; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(295707..296207)
                     /locus_tag="HPSH112_01490"
                     /note="INS is an amino acid-editing domain inserted (INS)
                     into the bacterial class II prolyl-tRNA synthetase (ProRS)
                     however, this CD is not exclusively bacterial. It is also
                     found at the N-terminus of the eukaryotic/archaea-like
                     ProRS's of yeasts and...; Region: ProRS-INS; cd04334"
                     /db_xref="CDD:239826"
     misc_feature    complement(order(295779..295781,295863..295868,
                     296046..296048))
                     /locus_tag="HPSH112_01490"
                     /note="putative deacylase active site [active]"
                     /db_xref="CDD:239826"
     misc_feature    complement(295518..295535)
                     /locus_tag="HPSH112_01490"
                     /note="motif 3; other site"
                     /db_xref="CDD:238402"
     misc_feature    complement(295170..295451)
                     /locus_tag="HPSH112_01490"
                     /note="ProRS Prolyl-anticodon binding domain, short
                     version found predominantly in bacteria. ProRS belongs to
                     class II aminoacyl-tRNA synthetases (aaRS). This alignment
                     contains the anticodon binding domain, which is
                     responsible for specificity in tRNA-binding; Region:
                     ProRS_anticodon_short; cd00861"
                     /db_xref="CDD:238438"
     misc_feature    complement(order(295230..295232,295236..295238,
                     295266..295268,295290..295292,295308..295310,
                     295422..295427))
                     /locus_tag="HPSH112_01490"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238438"
     gene            complement(296886..298235)
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /db_xref="GeneID:12773067"
     CDS             complement(296886..298235)
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /EC_number="1.2.1.70"
                     /note="COG0373 Glutamyl-tRNA reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="YP_006227013.1"
                     /db_xref="GI:386753795"
                     /db_xref="GeneID:12773067"
                     /translation="MELETHLSKYFTLAFTHKSMGLEMREKLAINSSATLKEFLQTIK
                     NHCPNIKECMVLSTCNRFEIYASLKHGAHANEQKSALLKILAQNKKMSVSDLEKCVLM
                     SVDESAVHHVFSVCSSLDSLVVGETQITGQMKNAYKFAFEEKFCSKDLTRLLHFAFKC
                     AAKVRNLTGISKQGVSISSVAVKEALNIFEKERIKDKKALVIGLGEMAQLVIKHLLNK
                     QFEALILGRNEAKFEDFIKELEEPKKVSFQNIENLNAYINEYQLLFCATSSPHFIVQN
                     DMLKETIFRRFWFDLAVPRNIEKPVLDNIFLYSVDDLEPMVRENVENRQESRTKAYEI
                     VGLATMEFYQWIQSLEVEPLIKDLRELARISAQKELQKALKKRYVPKEYESNIEKILH
                     NAFNTFLHHPTIALKKNAQKEESDVLVGAIKNLFNLDKSSANHAQNLNLYKCEYYEE"
     misc_feature    complement(296949..298208)
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="glutamyl-tRNA reductase; Region: hemA; TIGR01035"
                     /db_xref="CDD:233242"
     misc_feature    complement(297255..298208)
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="NADP-binding domain of glutamyl-tRNA reductase;
                     Region: NAD_bind_Glutamyl_tRNA_reduct; cd05213"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(297810..297812,297822..297824,
                     297831..297833,297843..297845,297852..297854,
                     298062..298064,298158..298160))
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="tRNA; other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(297840..297842,297852..297854,
                     297858..297860,297873..297875,298053..298055,
                     298059..298064))
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="putative tRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(297612..297614,297621..297623,
                     297627..297629))
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="putative NADP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(296949..297248)
                     /gene="hemA"
                     /locus_tag="HPSH112_01495"
                     /note="Glutamyl-tRNAGlu reductase, dimerization domain;
                     Region: GlutR_dimer; pfam00745"
                     /db_xref="CDD:250100"
     gene            complement(298235..299158)
                     /locus_tag="HPSH112_01500"
                     /db_xref="GeneID:12773068"
     CDS             complement(298235..299158)
                     /locus_tag="HPSH112_01500"
                     /note="COG0142 Geranylgeranyl pyrophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative octaprenyl-diphosphate synthase"
                     /protein_id="YP_006227014.1"
                     /db_xref="GI:386753796"
                     /db_xref="GeneID:12773068"
                     /translation="MQEKQLKAIQNKIASWIKEIESAFIDELFSKIGPSKMLRSKLML
                     ALLNGKTDAILLDKAFNLCAIVEMIQTASLLHDDVIDKATMRRKLPSINALFGNFNAV
                     MLGDVFYSKAFFELSKMGESIAQTLSNAVLRLSRGEIEDVFVGECFNSDKQKYWRILE
                     DKTAHFIEASLKSMAILLNKDAKIYADFGLNFGMAFQIIDDLLDITQDAKTLGKPNFS
                     DFKEGKTTLPYLLLYEKLNPHEQGLLISYFKQDSHEIIEWTKEKFKQYGIIEETLKTA
                     QVYSKKALEAIKKENNLILEKLAQDVIYRTF"
     misc_feature    complement(298244..299053)
                     /locus_tag="HPSH112_01500"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298487..298489,298502..298504,
                     298517..298519,298547..298549,298556..298561,
                     298661..298663,298670..298675,298736..298738,
                     298745..298747,298898..298903,298916..298921,
                     298925..298933,298937..298945,298952..298954))
                     /locus_tag="HPSH112_01500"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    complement(298916..298945)
                     /locus_tag="HPSH112_01500"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298487..298489,298502..298504,
                     298517..298519,298547..298549,298556..298561,
                     298673..298675,298736..298738,298898..298903,
                     298916..298918,298925..298930))
                     /locus_tag="HPSH112_01500"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298556..298561,298673..298675,
                     298898..298903,298916..298918,298925..298930))
                     /locus_tag="HPSH112_01500"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298673..298675,298736..298738,
                     298898..298903,298916..298918,298925..298930))
                     /locus_tag="HPSH112_01500"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298481..298495,298502..298519,
                     298535..298540,298868..298912))
                     /locus_tag="HPSH112_01500"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    complement(order(298487..298489,298502..298504,
                     298517..298519,298547..298549,298556..298561))
                     /locus_tag="HPSH112_01500"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            complement(299168..299563)
                     /locus_tag="HPSH112_01505"
                     /db_xref="GeneID:12773069"
     CDS             complement(299168..299563)
                     /locus_tag="HPSH112_01505"
                     /note="COG0085 DNA-directed RNA polymerase, beta
                     subunit/140 kD subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227015.1"
                     /db_xref="GI:386753797"
                     /db_xref="GeneID:12773069"
                     /translation="MNELIRYGLMFLFFLKAFGLDYGIDKTLELKKDEVFKAIIKDTS
                     NEQTKEITLYWTLYANKGLVINMRFNHFPYQFILYTDHARNTYNLKVFEEKFSSNSVL
                     SLVFKDFKEDKAALRLLALMPLVFSPKEP"
     gene            complement(299556..299840)
                     /locus_tag="HPSH112_01510"
                     /db_xref="GeneID:12773070"
     CDS             complement(299556..299840)
                     /locus_tag="HPSH112_01510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227016.1"
                     /db_xref="GI:386753798"
                     /db_xref="GeneID:12773070"
                     /translation="MRDYSELEIFEGNPLDKWNDIIFHASRKLSKKELERLLELLALL
                     ETFIEKEDLEEKFESFAKALRIDEELQQKIESKKTDIVIQSMANILSGNE"
     misc_feature    complement(299559..299813)
                     /locus_tag="HPSH112_01510"
                     /note="Domain of unknown function (DUF2018); Region:
                     DUF2018; pfam09442"
                     /db_xref="CDD:150197"
     gene            complement(299861..300295)
                     /locus_tag="HPSH112_01515"
                     /db_xref="GeneID:12773071"
     CDS             complement(299861..300295)
                     /locus_tag="HPSH112_01515"
                     /note="COG0783 DNA-binding ferritin-like protein
                     (oxidative damage protectant)"
                     /codon_start=1
                     /transl_table=11
                     /product="neutrophil activating protein (napA)
                     (bacterioferritin)"
                     /protein_id="YP_006227017.1"
                     /db_xref="GI:386753799"
                     /db_xref="GeneID:12773071"
                     /translation="MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIY
                     EEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKHL
                     EKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA"
     misc_feature    complement(299867..300283)
                     /locus_tag="HPSH112_01515"
                     /note="DPS protein, ferritin-like diiron-binding domain;
                     Region: DPS; cd01043"
                     /db_xref="CDD:153102"
     misc_feature    complement(299867..300283)
                     /locus_tag="HPSH112_01515"
                     /note="Ferritin-like domain; Region: Ferritin; pfam00210"
                     /db_xref="CDD:249681"
     misc_feature    complement(order(300128..300133,300140..300142,
                     300152..300154,300185..300187,300218..300223,
                     300227..300229,300239..300244))
                     /locus_tag="HPSH112_01515"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    complement(order(300128..300130,300140..300142,
                     300173..300175,300185..300187,300221..300223))
                     /locus_tag="HPSH112_01515"
                     /note="DPS ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    complement(order(299915..299920,299939..299941))
                     /locus_tag="HPSH112_01515"
                     /note="ion pore; other site"
                     /db_xref="CDD:153102"
     gene            complement(300500..301645)
                     /locus_tag="HPSH112_01520"
                     /db_xref="GeneID:12773072"
     CDS             complement(300500..301645)
                     /locus_tag="HPSH112_01520"
                     /note="COG0642 Signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase sensor protein"
                     /protein_id="YP_006227018.1"
                     /db_xref="GI:386753800"
                     /db_xref="GeneID:12773072"
                     /translation="MKKSKRLKRPYLKRSHLKHSYKASSFKGLLKKEDNVISLENFKP
                     KESEDLLENFSNKKDMQELLGLLNQFILQSYKVEKEFKDYKALYEWVIEILPQAIWVV
                     NENGSFFYKNSLANQSHEVFNKAKLENFNTEIEHENKSYLVQQNSIQGKQIITATDIS
                     AQKRQERLASMGKISAHLAHEIRNPVGSISLLASVLLKHANEKTKPIVVELQKALWRV
                     ERIIKATLLFSKGIQANRTKQSLKTLESDLKEALNCYTYSKDIDFLFNFSDEEGFFDF
                     DLMGIVLQNFLYNAIDAIEALEESEQGQVKIEAFIQNEFIVFTIIDNGKEVENKSALF
                     EPFETTKLKGNGLGLALSLQVVKAHEGSIALLENQEKTFEIKILNAS"
     misc_feature    complement(300515..301459)
                     /locus_tag="HPSH112_01520"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(300956..301144)
                     /locus_tag="HPSH112_01520"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(300971..300973,300983..300985,
                     300992..300994,301004..301006,301013..301015,
                     301025..301027,301070..301072,301079..301081,
                     301091..301093,301100..301102,301112..301114,
                     301124..301126))
                     /locus_tag="HPSH112_01520"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(301106..301108)
                     /locus_tag="HPSH112_01520"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(300515..300802)
                     /locus_tag="HPSH112_01520"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(300527..300529,300545..300547,
                     300551..300553,300599..300610,300674..300676,
                     300680..300682,300686..300688,300770..300772,
                     300779..300781,300791..300793))
                     /locus_tag="HPSH112_01520"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(300779..300781)
                     /locus_tag="HPSH112_01520"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(300602..300604,300608..300610,
                     300674..300676))
                     /locus_tag="HPSH112_01520"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(301642..301959)
                     /locus_tag="HPSH112_01525"
                     /db_xref="GeneID:12773073"
     CDS             complement(301642..301959)
                     /locus_tag="HPSH112_01525"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227019.1"
                     /db_xref="GI:386753801"
                     /db_xref="GeneID:12773073"
                     /translation="MINNNKAMLEQYNVSKLASEEKLKALAQNKNDKLLKEQTDSFEA
                     LLLKFMLDSAMKMDNPLYPKAPGDEIYTSMYKDTLSKELSGNFGYSEMLFNFLKEQEK
                     QKS"
     misc_feature    complement(<301681..301911)
                     /locus_tag="HPSH112_01525"
                     /note="Rod binding protein; Region: Rod-binding; cl01626"
                     /db_xref="CDD:261020"
     gene            complement(301956..302984)
                     /gene="flgI"
                     /locus_tag="HPSH112_01530"
                     /db_xref="GeneID:12773074"
     CDS             complement(301956..302984)
                     /gene="flgI"
                     /locus_tag="HPSH112_01530"
                     /note="COG1706 Flagellar basal-body P-ring protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body P-ring protein"
                     /protein_id="YP_006227020.1"
                     /db_xref="GI:386753802"
                     /db_xref="GeneID:12773074"
                     /translation="MKRVFLWLIFVLAFHKLLAEKIGDIASVVGVRDNQLIGYGLVIG
                     LNGTGDKSGSKFTMQSISNMLESVNVKISADDIKSKNVAAVMITASLPPFARQGDKID
                     IQISSIGDAKSIQGGTLVMTPLNAVDGNIYALAQGAITSGNSNNLLSANIINGATIER
                     EVSYDLFHKNAMVLSLKNPNFKNAIQVQNTLNKVFGNKVAIALDPKTIQITRPERFSM
                     VEFLALVQEIPINYSAKNKIIVDEKSGTIVSGVDIMVHPIVVTSQDITLKITKEPLDN
                     SKNAQDLDNNMSLDTAHNTLSSNGKNITIAGVVKALQKIGVSAKGMVSILQALKKSGA
                     ISAEMEIL"
     misc_feature    complement(301959..302984)
                     /gene="flgI"
                     /locus_tag="HPSH112_01530"
                     /note="flagellar basal body P-ring protein; Provisional;
                     Region: flgI; PRK05303"
                     /db_xref="CDD:235399"
     gene            303173..304651
                     /locus_tag="HPSH112_01535"
                     /db_xref="GeneID:12773075"
     CDS             303173..304651
                     /locus_tag="HPSH112_01535"
                     /note="COG0513 Superfamily II DNA and RNA helicases"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent RNA helicase"
                     /protein_id="YP_006227021.1"
                     /db_xref="GI:386753803"
                     /db_xref="GeneID:12773075"
                     /translation="MEFNQPPLPTEIDDDAYHKPSFNDLGLKESVLKSVYEAGFTSPS
                     PIQEKAIPAVLQGRDVIAQAQTGTGKTAAFALPIINNLKNNHTIEALVITPTRELAMQ
                     ISDEIFKLGKHTRTKTVCVYGGQSVKKQCEFIKKNPQVMIATPGRLLDHLKNERIHKF
                     VPKVVVLDESDEMLDMGFLDDIEEIFDYLPSEAQILLFSATMPEPIKRLADRILENPI
                     KIHIAPSNITNTDITQRFYVINEHERAEAIMHLLDTQAPKKSIVFTRTKKEADELHQF
                     LASKNYKSTALHGDMDQRDRRASIMAFKKNDADVLVATDVASRGLDISGVSHVFNYHL
                     PLNTESYIHRIGRTGRAGKKGMAITLVTPLEYKELLRMQKEIDSKIELFEIPTINENQ
                     IIKTLHDAKVSEGIISLYEQLTEIFEPSQLVLKLLSLQFETSKIGLNQQEIDAIQNPK
                     EKTPKTSNKKTHQREQARSFKKGQHQDRHPKTNHHSKKPKRR"
     misc_feature    303173..304627
                     /locus_tag="HPSH112_01535"
                     /note="Superfamily II DNA and RNA helicases [DNA
                     replication, recombination, and repair / Transcription /
                     Translation, ribosomal structure and biogenesis]; Region:
                     SrmB; COG0513"
                     /db_xref="CDD:223587"
     misc_feature    303236..303832
                     /locus_tag="HPSH112_01535"
                     /note="DEAD-box helicases. A diverse family of proteins
                     involved in ATP-dependent RNA unwinding, needed in a
                     variety of cellular processes including splicing, ribosome
                     biogenesis and RNA degradation. The name derives from the
                     sequence of the Walker  B motif; Region: DEADc; cd00268"
                     /db_xref="CDD:238167"
     misc_feature    303371..303385
                     /locus_tag="HPSH112_01535"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    303674..303685
                     /locus_tag="HPSH112_01535"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:238167"
     misc_feature    303767..303775
                     /locus_tag="HPSH112_01535"
                     /note="motif III; other site"
                     /db_xref="CDD:238167"
     misc_feature    303863..304252
                     /locus_tag="HPSH112_01535"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    order(303965..303976,304034..304039,304112..304120)
                     /locus_tag="HPSH112_01535"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(304136..304138,304199..304201,304211..304213,
                     304220..304222)
                     /locus_tag="HPSH112_01535"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            304672..305760
                     /locus_tag="HPSH112_01540"
                     /db_xref="GeneID:12773076"
     CDS             304672..305760
                     /locus_tag="HPSH112_01540"
                     /note="COG0330 Membrane protease subunits,
                     stomatin/prohibitin homologs"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227022.1"
                     /db_xref="GI:386753804"
                     /db_xref="GeneID:12773076"
                     /translation="MPIDLNEHLKKKNSQRETPTPNTPNDGGRFIPPSNSFNSKKLSV
                     LIVIVLLGVIAFLAKPFEVISSGEIGIKITAGKYEPTPLQPGIHFFVPIIQDILIVDT
                     RIRNINFSRTEDMGVAGKNQGIFRNDAINVMDSRGLTVSIELTVQYRLNPQTTPQTIA
                     TYGLSWEQKIINPVVRDVVRSVVGRYPAEDLPIKRNEIAALINSGINKEVSKLPNTPV
                     ELSSIQLREIVLPAKIKEQIEKVQIARQESERVKYEVERSKQEAQKQAALAKGEADAN
                     RIKAQGVADAIVIEAKAKSQANLSISQSLSDKLLRLRQIEVQGQFNEALKTNNNAQIM
                     LTPGGAVPNIWIDTKSKVKSSIAETKEP"
     misc_feature    304795..305703
                     /locus_tag="HPSH112_01540"
                     /note="Membrane protease subunits, stomatin/prohibitin
                     homologs [Posttranslational modification, protein
                     turnover, chaperones]; Region: HflC; COG0330"
                     /db_xref="CDD:223407"
     misc_feature    304852..305499
                     /locus_tag="HPSH112_01540"
                     /note="Prohibitin family; SPFH (stomatin, prohibitin,
                     flotillin, and HflK/C) superfamily; Region:
                     SPFH_prohibitin; cd03401"
                     /db_xref="CDD:259799"
     gene            305767..306306
                     /locus_tag="HPSH112_01545"
                     /db_xref="GeneID:12773077"
     CDS             305767..306306
                     /locus_tag="HPSH112_01545"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227023.1"
                     /db_xref="GI:386753805"
                     /db_xref="GeneID:12773077"
                     /translation="MASLAFIQAFLESFKGFLSQATLISVLIASVLILFCAILLLLAL
                     LLRNRLARYIAATAFLGAFLSMPFALNVLLTQTIYPIETRILHANPLSYSKAFSLQVG
                     VKNNSKFTLNKCVLRLEVLKNPHNFVEEHAFKLFVKKSYEKTFKEKILPEESKVFSFF
                     IDNYPYLKTAPYQVSLFCL"
     misc_feature    305923..306303
                     /locus_tag="HPSH112_01545"
                     /note="Protein of unknown function (DUF2393); Region:
                     DUF2393; pfam09624"
                     /db_xref="CDD:255459"
     gene            complement(306370..307920)
                     /locus_tag="HPSH112_01550"
                     /db_xref="GeneID:12773078"
     CDS             complement(306370..307920)
                     /locus_tag="HPSH112_01550"
                     /note="COG1123 ATPase components of various ABC-type
                     transport systems, contain duplicated ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide permease ATPase"
                     /protein_id="YP_006227024.1"
                     /db_xref="GI:386753806"
                     /db_xref="GeneID:12773078"
                     /translation="MLEIKNLNCVLNAHFSLQNINISLNPSERVAIVGESGSGKSSIA
                     NIIMRLNPRFKPHNGEVLFETTNLLKESEAFMQHLRGNAIAYIAQDPLSSLNPLHKIG
                     KQMSEAYFLHHKNASKTLLKEKVLNAMQQVQLDEKFLNRYPYELSGGQRQRVCIAMGI
                     INAPKLLICDEPTTALDAQIQNQILDLLKQLSVEKNIALLFISHDLKAVKRLADRVYV
                     LKKGEIVETNSTKELFNDPKHEYSKLLIQASNLPAKNLKALDETLLEVKDFSVYYLQK
                     RFFRPSLKKPLIASVNFSLKAKENIGIIGESGSGKSSLALGLLKLALNSGEEKILGQS
                     VGLLNSKAFKPYRKILQMVFQDPYASLNPRLSIQSILTEALHFAYPKASKEEWHHLAK
                     LCLEEVCLNPELLNFYAYELSGGERQRVAIARAIALKPKIILLDEPTSALDKSIQKSV
                     LELLLDLQEKQDLSYLFISHDLDVIKAFCDKVLVISEGKVVEMGTIKEVFDNPKHAYT
                     KRLLESRL"
     misc_feature    complement(306376..307920)
                     /locus_tag="HPSH112_01550"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    complement(307237..307920)
                     /locus_tag="HPSH112_01550"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(307798..307821)
                     /locus_tag="HPSH112_01550"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(307309..307311,307408..307413,
                     307654..307656,307795..307803,307807..307812))
                     /locus_tag="HPSH112_01550"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307654..307665)
                     /locus_tag="HPSH112_01550"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307456..307485)
                     /locus_tag="HPSH112_01550"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307408..307425)
                     /locus_tag="HPSH112_01550"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307390..307401)
                     /locus_tag="HPSH112_01550"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(307303..307323)
                     /locus_tag="HPSH112_01550"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<307177..307254)
                     /locus_tag="HPSH112_01550"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     misc_feature    complement(306439..307134)
                     /locus_tag="HPSH112_01550"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(306985..307008)
                     /locus_tag="HPSH112_01550"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(306511..306513,306610..306615,
                     306856..306858,306982..306990,306994..306999))
                     /locus_tag="HPSH112_01550"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306856..306867)
                     /locus_tag="HPSH112_01550"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306658..306687)
                     /locus_tag="HPSH112_01550"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306610..306627)
                     /locus_tag="HPSH112_01550"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306592..306603)
                     /locus_tag="HPSH112_01550"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(306505..306525)
                     /locus_tag="HPSH112_01550"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(<306379..306450)
                     /locus_tag="HPSH112_01550"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            complement(307930..308952)
                     /locus_tag="HPSH112_01555"
                     /db_xref="GeneID:12773079"
     CDS             complement(307930..308952)
                     /locus_tag="HPSH112_01555"
                     /note="COG4239 ABC-type uncharacterized transport system,
                     permease component"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide permease integral membrane protein"
                     /protein_id="YP_006227025.1"
                     /db_xref="GI:386753807"
                     /db_xref="GeneID:12773079"
                     /translation="MSVSSLFKMRILSFKKNKRAVFSLYLFIALLALSLLAPLWVNDR
                     PLFIYKDNKAYFPMFKDYAEVEFGGDFFTPTDYNDPYVKDTLLKDAFIIHALIPYSYD
                     TIIMDLDSPAPTPPSFKHLLGTDDQARDVLARLVYGYRVSLVFGILLTLFSVLIGVSL
                     GAFQGYYGGLIDLVGQRLSEIWSAIPMLFLLIVISSAFNSNFWIILFLVLLFSWMGLS
                     QVVRTEFLKARNMDYTKAARALGVNDLKIIFYHVLPNALVATITYVPFLMAASISTLV
                     SLDFLGFGMPIGSASLGELVNQGKDNLTTPHLAIVAFVAISLLLSVLVFIGEGVRDAF
                     NANMLK"
     misc_feature    complement(307933..308952)
                     /locus_tag="HPSH112_01555"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG4239"
                     /db_xref="CDD:226690"
     misc_feature    complement(307984..308538)
                     /locus_tag="HPSH112_01555"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(307984..307989,307996..308001,
                     308008..308013,308017..308022,308029..308034,
                     308062..308067,308113..308118,308125..308136,
                     308155..308157,308164..308169,308209..308211,
                     308260..308262,308269..308274,308284..308286,
                     308290..308295,308302..308304,308308..308310,
                     308314..308319,308368..308370,308374..308379,
                     308386..308415,308419..308430,308458..308460,
                     308473..308478,308485..308490))
                     /locus_tag="HPSH112_01555"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308119..308136,308368..308412))
                     /locus_tag="HPSH112_01555"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308032..308034,308062..308064,
                     308071..308073,308116..308118,308332..308334,
                     308368..308370))
                     /locus_tag="HPSH112_01555"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(308188..308190,308200..308205,
                     308221..308259))
                     /locus_tag="HPSH112_01555"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(309055..309130)
                     /locus_tag="HPSH112_t08198"
                     /db_xref="GeneID:12773080"
     tRNA            complement(309055..309130)
                     /locus_tag="HPSH112_t08198"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:12773080"
     gene            309238..309336
                     /locus_tag="HPSH112_01560"
                     /db_xref="GeneID:12773081"
     CDS             309238..309336
                     /locus_tag="HPSH112_01560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227026.1"
                     /db_xref="GI:386753808"
                     /db_xref="GeneID:12773081"
                     /translation="MIILKLGSFFYGLSKITYQSQSKKDIFEKPLL"
     gene            309317..310738
                     /locus_tag="HPSH112_01565"
                     /db_xref="GeneID:12773082"
     CDS             309317..310738
                     /locus_tag="HPSH112_01565"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane protein HopF, putative signal
                     peptide"
                     /protein_id="YP_006227027.1"
                     /db_xref="GI:386753809"
                     /db_xref="GeneID:12773082"
                     /translation="MKNHSFKKTIALSLLAGMSLCNAEEDGAFFVIDYQTSLARQELK
                     NPGFTQAQELKQLIRDGAVRLQTSAIPLSYYLDILGNKTKILLSESVKDNAQPPQALV
                     NLEQSLGILGKLLDLSQQYANQGVIKPLVVDVGKEQIGITDSMLLVAQNIVLALGQVD
                     LSKIQQNNNKQLYENIMQVMLLGAGGTNGAYNGVSVGDIATGMQNFSSQTGLIGANST
                     VSELNALIKSGISLDRETLGLGSFIEKNICSSASSCFSKGQLIYKKGLDRSINIISAS
                     LDQFENSASSLYKISYIPNLFSLKDYQSASMNGFGAKMGYKQFFTHKKNIGLRYYGFL
                     DYGYANFGDTNLKVGANLVTYGVGTDFLYNVYERSRRRERTTIGLFFGAQIAGQTWST
                     NVTNLLSGQRPDVKSSSFQFLFDLGVRTNFAKTNFNKHRLDQGIEFGVKIPVIAHKYF
                     ATQGSSASYMRNFSFYVGYSVGF"
     misc_feature    310247..310735
                     /locus_tag="HPSH112_01565"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            310751..312163
                     /locus_tag="HPSH112_01570"
                     /db_xref="GeneID:12773083"
     CDS             310751..312163
                     /locus_tag="HPSH112_01570"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein HopG"
                     /protein_id="YP_006227028.1"
                     /db_xref="GI:386753810"
                     /db_xref="GeneID:12773083"
                     /translation="MKNTNTKEIKNTRMKKGYSQYHALKKGLLKTALLFSLPLSMALA
                     EDDGFYMGVGYQIGGAQQNINNKGSTLRNNVIDDFRQVGVGMAGSNGLLALATNTTMD
                     ALLGIGNQIVNTNTTVGNNNLELTQFKKVLPQIEQRFETNKNAYSVQALQVYLSNVLY
                     NLVNNNGSNNGVAPEYVGIIKVLYGSQNEFALLATESVALLNALTRVNLDSNSVFLKG
                     LLAQMQLFNDTSSAKLGQIAEGLEKSGGVGSMLQKDVKTISDRIATYQENLKQLGGML
                     NNYDEPYLPQFGPGKSSQHGVINGFGIQMGYKQFFGSKRNIGLRYYAFFDYGFTQLGS
                     LSSAVKANIFTYGAGTDFLWNIFRRVFSDQSLNVGVFGGIQIAGNTWDSSLRGQIENS
                     FKETPTPTNFQFLFNLGLRAHFASTMHRRFLSASQSIQHGMEFGVKIPAINQRYLKAN
                     GADVDYRRLYAFYINYTIGF"
     misc_feature    311654..312160
                     /locus_tag="HPSH112_01570"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            312262..313497
                     /locus_tag="HPSH112_01575"
                     /db_xref="GeneID:12773084"
     CDS             312262..313497
                     /locus_tag="HPSH112_01575"
                     /EC_number="6.3.4.4"
                     /note="COG0104 Adenylosuccinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="YP_006227029.1"
                     /db_xref="GI:386753811"
                     /db_xref="GeneID:12773084"
                     /translation="MADVVVGIQWGDEGKGKIVDRIAKDYDFVVRYQGGHNAGHTIVH
                     KGVKHSLHLMPSGVLYPQCKNIISSAVVVSIKDLCEEISAFENLENRLFISDRAHVIL
                     PYHAKKDAFKEKSQNIGTTKKGIGPCYEDKMARSGIRMGDLLDDKILEERLNAHFKAI
                     DPFKEAYDLGENYEKDLREYFKTYIPKICPFIKDTTSMLIEANQKGEKILLEGAQGTL
                     LDIDLGTYPFVTSSNTTSASACVSTGLNPKAINEVIGITKAYSTRVGNGPFPSEDTTP
                     MGDHLRTKGAEFGTTTKRPRRCGWLDLVALKYACALNGCTQLALMKLDVLDGIDAIKV
                     CVAYERKGERLEAFPSDLKDCTPIYQTFKGWEKSVGVRKLDDLEPNAREYIRFIEKEV
                     GVKIRLISTSPEREDTIFL"
     misc_feature    312265..313470
                     /locus_tag="HPSH112_01575"
                     /note="Adenylosuccinate synthetase (AdSS) catalyzes the
                     first step in the de novo biosynthesis of AMP. IMP and
                     L-aspartate are conjugated in a two-step reaction
                     accompanied by the hydrolysis of GTP to GDP in the
                     presence of Mg2+. In the first step, the...; Region: AdSS;
                     cd03108"
                     /db_xref="CDD:239382"
     misc_feature    order(312295..312297,312301..312309,312376..312384,
                     312388..312390,313225..313227,313231..313233,
                     313465..313470)
                     /locus_tag="HPSH112_01575"
                     /note="GDP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239382"
     misc_feature    order(312301..312303,312310..312312,312379..312381)
                     /locus_tag="HPSH112_01575"
                     /note="ACT binding site; other site"
                     /db_xref="CDD:239382"
     misc_feature    order(312370..312372,312613..312615,312622..312624,
                     312904..312906,312949..312951)
                     /locus_tag="HPSH112_01575"
                     /note="IMP binding site; other site"
                     /db_xref="CDD:239382"
     gene            313494..313922
                     /locus_tag="HPSH112_01580"
                     /db_xref="GeneID:12773085"
     CDS             313494..313922
                     /locus_tag="HPSH112_01580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227030.1"
                     /db_xref="GI:386753812"
                     /db_xref="GeneID:12773085"
                     /translation="MKKFASVLVQLKILALEKIEQKLKSKRLELQQNEREILDKQAQL
                     SAFKNPELGGMSLFLQTQQLKSAIRMEIEYYQQESENLNKDLKILEKEYLLANQELEK
                     AKIILENEKRKEKEILEKKEQALLDENAMILHWQKEGLHA"
     misc_feature    313542..313892
                     /locus_tag="HPSH112_01580"
                     /note="Flagellar FliJ protein; Region: FliJ; pfam02050"
                     /db_xref="CDD:251059"
     gene            313915..314592
                     /locus_tag="HPSH112_01585"
                     /db_xref="GeneID:12773086"
     CDS             313915..314592
                     /locus_tag="HPSH112_01585"
                     /note="COG3334 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227031.1"
                     /db_xref="GI:386753813"
                     /db_xref="GeneID:12773086"
                     /translation="MRKILLMGLILQALFGEEATQELLQCSAIFESKKAELKDDLRRL
                     GEKEQSLRILQTENARLLDEKNDLLNKKEKEVEEKLKNLAAKEEAFKALQTEEKKRLK
                     NLIEENESILRGIKQAKDSKIGETYSKMKDSKSALILENLPTQNALEILMALKPQELG
                     KILAKMDPKKAAALTELWQKPPRENKEIPKTIPPMPPIAPMPPIAPTPSKEPMIKDPN
                     TKEPAGV"
     misc_feature    313915..314469
                     /locus_tag="HPSH112_01585"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3334"
                     /db_xref="CDD:225871"
     gene            314592..315638
                     /locus_tag="HPSH112_01590"
                     /db_xref="GeneID:12773087"
     CDS             314592..315638
                     /locus_tag="HPSH112_01590"
                     /note="COG0750 Predicted membrane-associated Zn-dependent
                     proteases 1"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227032.1"
                     /db_xref="GI:386753814"
                     /db_xref="GeneID:12773087"
                     /translation="MFIVAVLMLAFLIFVHELGHFTIARICGVKVEVFSIGFGKKLCF
                     FKLFGTQFALSLIPLGGYVKLKGMDKEENETNESANDSYAQKSPFQKLWILFGGAFFN
                     FLFAILVYFFLALGGEKVLLPVIGDLEKNALEAGLLKGDKILSINHKKIASFREIRSV
                     VAHARGELVLEIERNHQILEKRLTPKIVAVISDSNDPNEIIKYKVIGIKPDMQKTGVV
                     SYSLFQAFEKALSRFKEGVVLIVDSLRRLITGSASVKELSGVVGIVGALSHASSVSML
                     LLFGAFLSINLGILNLLPVPALDGAQMLGVVFKNIFKIALPAFMQNALWLAGVGFLVF
                     IMFLGLFNDLTRLL"
     misc_feature    314592..315632
                     /locus_tag="HPSH112_01590"
                     /note="RIP metalloprotease RseP; Region: TIGR00054"
                     /db_xref="CDD:232801"
     misc_feature    314595..315629
                     /locus_tag="HPSH112_01590"
                     /note="RseP-like Site-2 proteases (S2P), zinc
                     metalloproteases (MEROPS family M50A), cleave
                     transmembrane domains of substrate proteins, regulating
                     intramembrane proteolysis (RIP) of diverse signal
                     transduction mechanisms. In Escherichia coli, the S2P
                     homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163"
                     /db_xref="CDD:100084"
     misc_feature    order(314637..314642,314649..314651,315462..315464,
                     315486..315488)
                     /locus_tag="HPSH112_01590"
                     /note="active site"
                     /db_xref="CDD:100084"
     misc_feature    314919..315146
                     /locus_tag="HPSH112_01590"
                     /note="PDZ domain of bacterial and plant zinc
                     metalloprotases, presumably membrane-associated or
                     integral membrane proteases, which may be involved in
                     signalling and regulatory mechanisms. May be responsible
                     for substrate recognition and/or binding, as most PDZ...;
                     Region: PDZ_metalloprotease; cd00989"
                     /db_xref="CDD:238489"
     misc_feature    order(314922..314933,314937..314939,315060..315065,
                     315072..315074)
                     /locus_tag="HPSH112_01590"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238489"
     misc_feature    315462..315473
                     /locus_tag="HPSH112_01590"
                     /note="putative substrate binding region [chemical
                     binding]; other site"
                     /db_xref="CDD:100084"
     gene            315651..316913
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /db_xref="GeneID:12773088"
     CDS             315651..316913
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /EC_number="3.1.11.6"
                     /note="COG1570 Exonuclease VII, large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease VII large subunit"
                     /protein_id="YP_006227033.1"
                     /db_xref="GI:386753815"
                     /db_xref="GeneID:12773088"
                     /translation="MDVLSVSEINAQIKALLEATFLQVRVQGEVSNLTIHKVSGHAYF
                     SLKDSQSVIRCVLFKGNANRLKFALKEGQEVVVSGGISAYVPRGDYQINCFEIEPKDI
                     GSLTLALEQLKEKLRLKGYFDEANKLPKPHFPKRVAVITSQNSAAWADMKKIASKRWP
                     MCELVCINALMQGEGCVQSVVESIAYADSFHDTKNAFDAIVVARGGGSMEDLYPFNDE
                     KIADALHLAKTFSMSAIGHESDFLLSDLVADLRASTPSNAMEILLPSSDEWWQRLDGF
                     NVKLHRSFKILLHQKKVHLEHLEVSLKRLSFENKHHLNALKLEKLKIALENKTLEFLR
                     FKKTLLEKISTQTLTSPFLQTKTERLNALENALKLAHANLKLPQFGAFVSKNNQAIEL
                     EALKRGDKIELSNEKARASAEILSVDRV"
     misc_feature    315663..316910
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /note="exodeoxyribonuclease VII, large subunit; Region:
                     xseA; TIGR00237"
                     /db_xref="CDD:161783"
     misc_feature    315717..315947
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /note="ExoVII_LU_OBF: A subfamily of OB folds
                     corresponding to the N-terminal OB-fold domain of
                     Escherichia coli exodeoxyribonuclease VII (ExoVII) large
                     subunit. E. coli ExoVII is composed of two non-identical
                     subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF;
                     cd04489"
                     /db_xref="CDD:239935"
     misc_feature    order(315723..315725,315870..315872,315876..315878,
                     315882..315884,315942..315944)
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239935"
     misc_feature    order(315738..315746,315777..315788,315792..315794,
                     315810..315818,315822..315824,315867..315869,
                     315888..315896,315921..315929)
                     /gene="xseA"
                     /locus_tag="HPSH112_01595"
                     /note="generic binding surface I; other site"
                     /db_xref="CDD:239935"
     gene            complement(316932..318104)
                     /locus_tag="HPSH112_01600"
                     /db_xref="GeneID:12773089"
     CDS             complement(316932..318104)
                     /locus_tag="HPSH112_01600"
                     /note="COG2189 Adenine specific DNA methylase Mod"
                     /codon_start=1
                     /transl_table=11
                     /product="type II DNA modification enzyme
                     (methyltransferase)"
                     /protein_id="YP_006227034.1"
                     /db_xref="GI:386753816"
                     /db_xref="GeneID:12773089"
                     /translation="MHKVFIMEALECLKRIEKESIQTIYIDPPYNTKSSNFEYEDAHA
                     DYEKWIKEHLILAKAVLKQSGCIFISIDDNKMAEVKIIANEIFGTCNFLGTFITKQAT
                     RSNAKHINITHEYVLSYAKNKAFAPGFKILRTLLPIYAKPLKDLMRMIKNVFKQKGQA
                     QAQLVLKEQIKELSQKEHFNFLKNYNLVDEKGEIYFAKDLSTPSNPRSVAIQEINLFL
                     EPLKSRGWSSDEKLKELYYQNRLIFKNNRPYEKYYLKESQDNCLSVLDFYSRQGTKDL
                     EKLGLKGLFKTPKPVALIKYLLLCSTPKDSIILDFFAGSGTTAQAVIEVNKDYYLNWS
                     FYLCQKEEKIKNNPQAASILKNKGYKNTISNIMLLRLEKIVKRSEYEILKTKSILF"
     misc_feature    complement(<316938..318089)
                     /locus_tag="HPSH112_01600"
                     /note="Adenine specific DNA methylase Mod [DNA
                     replication, recombination, and repair]; Region: COG2189"
                     /db_xref="CDD:225100"
     misc_feature    complement(317115..318044)
                     /locus_tag="HPSH112_01600"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(318097..318711)
                     /locus_tag="HPSH112_01605"
                     /db_xref="GeneID:12773090"
     CDS             complement(318097..318711)
                     /locus_tag="HPSH112_01605"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227035.1"
                     /db_xref="GI:386753817"
                     /db_xref="GeneID:12773090"
                     /translation="MQFLNQSLGFFNKGHFEPIDRNFITESYQALKPIEEIQNKYNKH
                     DNDSFLNELRDSMVALYLDYELINIQKHGLDAKRSSSDEFLEIKQVSFQSKTWSATFN
                     DTTLEKAKVFCDIKTTLAVGVWNNISNLLFIVYGKHPKIGLYLEQKVKECHNESRRST
                     QTIGVSKLIKEFDFKMKPIDLKEQELINLFNLKFGHFSWENHLA"
     gene            318912..319589
                     /locus_tag="HPSH112_01610"
                     /db_xref="GeneID:12773091"
     CDS             318912..319589
                     /locus_tag="HPSH112_01610"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease MjaVIP"
                     /protein_id="YP_006227036.1"
                     /db_xref="GI:386753818"
                     /db_xref="GeneID:12773091"
                     /translation="MLERFKDFMREQPEPYKFLQVFYAQEKERFLNDKMNDCIKQNKS
                     KEEASILARQGFVSTIGRVLEKIIELLLKDFCTKNNVKMTNDKILRAKRINGELDRVK
                     RALLVHFGEYSVLPDGDIILYQTNKDNIKILAILSVKNSFRERFTEAPYWKLKLLQSP
                     ITSHIKVFMITPDNDNEISFKDKPKKARIVMEHELDGLYLAKSHFDQSSKIKGIENLL
                     EDLKRLL"
     gene            319586..320344
                     /locus_tag="HPSH112_01615"
                     /db_xref="GeneID:12773092"
     CDS             319586..320344
                     /locus_tag="HPSH112_01615"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenine specific DNA methyltransferase"
                     /protein_id="YP_006227037.1"
                     /db_xref="GI:386753819"
                     /db_xref="GeneID:12773092"
                     /translation="MKPYFSLEKLDLYHGDVSVLETFEKGFYDLCITSPPYNLSVEYQ
                     GSNDFRAYDDYLNWCKNWLKNCYFWGKEQARLCLNVPLDTNKHGKQSLGVDIIAIAKE
                     CGWKYQNTIIWNESNISRRTAWGSWLQASAPYAIAPVELIVVFYKNEYKRQKQTSTIS
                     KEEFLLYTNGLWNFSGESKKRLKHPAPFPRELPRRCIKLFSFLEDTIFDPFSGSGTTI
                     LEANALGRFSVGLEIEKEYCELSKKRILESLSLV"
     misc_feature    319670..320314
                     /locus_tag="HPSH112_01615"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            320417..322987
                     /locus_tag="HPSH112_01620"
                     /db_xref="GeneID:12773093"
     CDS             320417..322987
                     /locus_tag="HPSH112_01620"
                     /note="COG0542 ATPases with chaperone activity,
                     ATP-binding subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease binding subunit ClpB"
                     /protein_id="YP_006227038.1"
                     /db_xref="GI:386753820"
                     /db_xref="GeneID:12773093"
                     /translation="MNLFEKMTDQLHETLDSALALALHHKNAEVTPLHMLFVMLNNSQ
                     GILIQALQKMSVDIQALRLSVQSELDKFAKVSQINKQNIQLNQALIQSLENAQGLMAK
                     TGDSFIATDVYLLANMSLFESVLKPYLDTKQLQKTLESLRKGATIQSKNDDSNLESLE
                     KFGIDLTQKALENKLDPVIGRDEEIIRMMQILIRKTKNNPILLGEPGVGKTAVVEGLA
                     QRIVNKEVPKTLLNKRVVALDLSLLVAGAKYRGEFEERLKKVIEEVKKSANVILFIDE
                     IHTIVGAGASEGGMDAANILKPALARGELHTIGATTLKEYRKYFEKDMALQRRFQPIL
                     LNEPSINEALQILRGLKETLETHHNITINDSALIASAKLSSRYITDRFLPDKAIDLID
                     EGAAQLKMQMESEPAKLSSVKRSIQRLEMEKQALEMEKKESNAKRMQEILKELSDLKE
                     EKIQLEAQFENEKEVFREISRLKMETESLKKEAERFKRNGDYQQAGEIEYSKIPENKK
                     KEEELQHKWEAMQQNGALLQNALTENNIAEIVSQWTHIPVQKMLQSEKNRVLNIESEL
                     QKRVVGQEKAIKAIAKAIKRNKAGLSDSNKPIGSFLFLGPTGVGKTESAKALAQFLFD
                     SDKNLIRIDMSEYMEKHAISRLIGAAPGYVGYEEGGQLTEAVRRKPYSVVLLDEVEKA
                     HPDVFNLLLQVLDEGHLTDSKGVRVDFKNTILILTSNVASGALLEENLSEADKQKAIK
                     ESLRQFFKPEFLNRLDEIISFNALDSHAVANIVGILFENIQKKALERGINITLDEEAK
                     ELIAKAGFDRFYGARPLKRALYEMVEDKLAELILEDKIKENDSVAFVVENNEIVPKIK
                     "
     misc_feature    320435..322972
                     /locus_tag="HPSH112_01620"
                     /note="ATP-dependent chaperone ClpB; Region:
                     chaperone_ClpB; TIGR03346"
                     /db_xref="CDD:234173"
     misc_feature    320468..320626
                     /locus_tag="HPSH112_01620"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    320951..321418
                     /locus_tag="HPSH112_01620"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    321026..321049
                     /locus_tag="HPSH112_01620"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(321029..321052,321239..321241,321350..321352)
                     /locus_tag="HPSH112_01620"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    321227..321244
                     /locus_tag="HPSH112_01620"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    321401..321403
                     /locus_tag="HPSH112_01620"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    322199..322606
                     /locus_tag="HPSH112_01620"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    322229..322252
                     /locus_tag="HPSH112_01620"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(322232..322255,322445..322447,322571..322573)
                     /locus_tag="HPSH112_01620"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    322433..322450
                     /locus_tag="HPSH112_01620"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    322706..322942
                     /locus_tag="HPSH112_01620"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            323044..323763
                     /locus_tag="HPSH112_01625"
                     /db_xref="GeneID:12773094"
     CDS             323044..323763
                     /locus_tag="HPSH112_01625"
                     /note="COG0785 Cytochrome c biogenesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c biogenesis protein"
                     /protein_id="YP_006227039.1"
                     /db_xref="GI:386753821"
                     /db_xref="GeneID:12773094"
                     /translation="MFDNTLINLFETAPLLTSLLAGILTFLSPCVLPLIPAYMSYISQ
                     ISLEDIKDGKAKRVSVFLKSLMFVVGFSLVFLGVGMSMAKLIHSFSFSWVNYIAGGIV
                     ILFGLHFLGVFRFAFLYKTQSFRLASKSNSMQRFYPFLLGMSFALGWTPCIGPIFTSI
                     VIMSASKDAYGLMLMVVFVVGLAIPFLLVALMLERALLFLKSLKKYNRAIEIVSGLVL
                     ILMGILIVTNSMESLTNFLQK"
     misc_feature    323095..323724
                     /locus_tag="HPSH112_01625"
                     /note="Cytochrome C biogenesis protein transmembrane
                     region; Region: DsbD; pfam02683"
                     /db_xref="CDD:251473"
     gene            323773..324909
                     /locus_tag="HPSH112_01630"
                     /db_xref="GeneID:12773095"
     CDS             323773..324909
                     /locus_tag="HPSH112_01630"
                     /note="COG0044 Dihydroorotase and related cyclic
                     amidohydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="YP_006227040.1"
                     /db_xref="GI:386753822"
                     /db_xref="GeneID:12773095"
                     /translation="MLLKNASFYDGEVLKRADIRLKDSLIAEIKENLSPIKNEEVIEC
                     ANLFVLPSFIDLSVTGLEGYENLKQKAFKGGVGLLNVFNCDQSGIKNIMAIRNNQLAD
                     IATLKNKGGEILIVQSDAFLELISHYAKSYNLPLLISLENSFEALNSGALAYELGQNF
                     VENAFENTRLVRFMEVSRALQIPMLLDKVSSAATLKLIKAFNNLGAHLQAQTPLSHLI
                     LDESVYEDYEPRFKIAPPLRDKESQNALKETLKNDEITMLTSLHVFKNSNAELFEESA
                     FGCESIENAFSVAYTFLVQKKVISFQQLIKVMATNQARFLKLNAGEVKENQLANLMIV
                     DLNAQTRVNNKNSPFYGLELYGEVQRMILKGQTTLIKENACKKS"
     misc_feature    323773..324903
                     /locus_tag="HPSH112_01630"
                     /note="Dihydroorotase and related cyclic amidohydrolases
                     [Nucleotide transport and metabolism]; Region: PyrC;
                     COG0044"
                     /db_xref="CDD:223122"
     misc_feature    323773..>323964
                     /locus_tag="HPSH112_01630"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    323884..324846
                     /locus_tag="HPSH112_01630"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(323941..323943,323947..323949,324187..324189,
                     324334..324336,324553..324555)
                     /locus_tag="HPSH112_01630"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            324894..326123
                     /locus_tag="HPSH112_01635"
                     /db_xref="GeneID:12773096"
     CDS             324894..326123
                     /locus_tag="HPSH112_01635"
                     /note="COG0402 Cytosine deaminase and related
                     metal-dependent hydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="chlorohydrolase"
                     /protein_id="YP_006227041.1"
                     /db_xref="GI:386753823"
                     /db_xref="GeneID:12773096"
                     /translation="MQEIIGASLVFLCNEKCEVLEDYGVVFDEKIVEIGDYKSLTLKY
                     PHLKAQFFENSVLLPAFINAHTHFEFSNNKASFDYGSFSGWLGSVLNNGGAILENCQG
                     AIQNAISAQLKSGVGSVGAISNHLIEVNLLKKSPLNAVVFLEFLGSSYSLEKLKAFEA
                     KFKELKDLEDKKLKAALAVHAPYSVQKDMALSVIQLAKDSQSLLSTHFLESFEELEWV
                     ENSKGWFENFYQHFLKESHFKSLYKGANDYIDMFEDTHTLFVHNQFASLEMLKRIKSQ
                     VKNAFLITCPFSNRLLSGQALDLERTKEAGLSVSVATDGLSSNISLSLLDELRAFLLT
                     HNMPLLKLAKIALLGATRHGAKALALNNGEIEANKMADLSVFNFGEKFVKEQAVLQFL
                     LHAKEVERLFLGGKRVI"
     misc_feature    324897..326120
                     /locus_tag="HPSH112_01635"
                     /note="chlorohydrolase; Provisional; Region: PRK08418"
                     /db_xref="CDD:181419"
     misc_feature    324978..326111
                     /locus_tag="HPSH112_01635"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(325086..325088,325092..325094,325512..325514,
                     325674..325676,325833..325835)
                     /locus_tag="HPSH112_01635"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            326185..326427
                     /locus_tag="HPSH112_01640"
                     /db_xref="GeneID:12773097"
     CDS             326185..326427
                     /locus_tag="HPSH112_01640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227042.1"
                     /db_xref="GI:386753824"
                     /db_xref="GeneID:12773097"
                     /translation="MKLVLAKNTRKSDAKSVELEDLYHKFSEDKRSIFYFAPTNAHKD
                     MLKAVDFFKEKGHTAYLDEVRVSSDEKDFLYELHII"
     gene            326437..327750
                     /locus_tag="HPSH112_01645"
                     /db_xref="GeneID:12773098"
     CDS             326437..327750
                     /locus_tag="HPSH112_01645"
                     /note="COG0621 2-methylthioadenine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="(dimethylallyl)adenosine tRNA
                     methylthiotransferase"
                     /protein_id="YP_006227043.1"
                     /db_xref="GI:386753825"
                     /db_xref="GeneID:12773098"
                     /translation="MKVYIETMGCAMNSRDSEHLLSELSKLDYKETSDPKAADLILIN
                     TCSVREKPERKLFSEIGQFAKIKKPNAKIGVCGCTASHMGADILKKAPSVSFVLGARN
                     VSKISQVIHKEKAVEVAIDYDESAYAFEFFEKKAQIRSLLNISIGCDKKCAYCIVPHT
                     RGKEISIPMDLILKEAEKLASNGTKELMLLGQNVNNYGARFSSEHAKVDFSDLLDKLS
                     EIQGIERIRFTSPHPLHMNDAFLERFAKNPKVCKSIHMPLQSGSSAVLKMMRRGYSKE
                     WFLNRVERLKALVPEVGISTDIIVGFPNESDKDFEDTMEVLEKVRFDTLYSFIYSPRP
                     FTEAGAWKERVPLEVSSSRLERLQNRHKEILEEKAKLEVGKVHVVLVENRREIDNQIV
                     GFEGRSDTGKFIEVACKEKRNPGELVRVEIVSHSKGRLIATAKGN"
     misc_feature    326440..326733
                     /locus_tag="HPSH112_01645"
                     /note="Uncharacterized protein family UPF0004; Region:
                     UPF0004; pfam00919"
                     /db_xref="CDD:250224"
     misc_feature    326470..327744
                     /locus_tag="HPSH112_01645"
                     /note="(dimethylallyl)adenosine tRNA
                     methylthiotransferase; Provisional; Region: PRK14339"
                     /db_xref="CDD:184634"
     misc_feature    326860..327450
                     /locus_tag="HPSH112_01645"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(326878..326880,326884..326886,326890..326892,
                     326896..326904,327004..327006,327043..327048,
                     327121..327129,327199..327201,327331..327333,
                     327421..327426)
                     /locus_tag="HPSH112_01645"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            327790..328443
                     /locus_tag="HPSH112_01650"
                     /db_xref="GeneID:12773099"
     CDS             327790..328443
                     /locus_tag="HPSH112_01650"
                     /note="COG2121 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227044.1"
                     /db_xref="GI:386753826"
                     /db_xref="GeneID:12773099"
                     /translation="MSLKFFRKNIVLRVVPRLAFGVLWLLHKTCKNRYFLAQNLKEKP
                     FIVSCWHGELGMIGFAYLRLQKPSVYVIASQHFDGSIATGLFESFGFKNIRGSSKKGG
                     VKVLIEGLKRLKEGCDVAITPDGPKGPRHSIADGVIALAQKSGVGISACRVVCRNAWR
                     LNTWDQFEIPKPFSEVHYYMLESVIIPKEWELSKAKEYLKTRMDSVGFGESQRGLGA"
     misc_feature    327856..328401
                     /locus_tag="HPSH112_01650"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: DUF374; Region:
                     LPLAT_DUF374-like; cd07983"
                     /db_xref="CDD:153245"
     misc_feature    order(327940..327942,327949..327951,327955..327957,
                     328006..328017,328162..328170)
                     /locus_tag="HPSH112_01650"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153245"
     gene            328436..329416
                     /locus_tag="HPSH112_01655"
                     /db_xref="GeneID:12773100"
     CDS             328436..329416
                     /locus_tag="HPSH112_01655"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227045.1"
                     /db_xref="GI:386753827"
                     /db_xref="GeneID:12773100"
                     /translation="MLKGLKKALKERFCSQVYISFNVDHNLLSAQILRVKNHRIKEKF
                     FKTFETKVEIKSGEVPIQALKIARTYSQKYPYTYFSAMSKAKEVLCEKQAFEQIKREN
                     QDYQACEVNQKYCVYVESKDFLKDFKRFKIQDVDFLFSPFSLIYDFVRDHLEEKPLLY
                     LLLERSRFYFLIADKKEIFLAKSVFLEEQPEEFIESKEEDSMEMDNEAVNLFLSEIQE
                     DIDSLEEAIGLDSSKDNSEKNEDAYSLIEGMTNIPLIANALQEGLRSVYHSRDIDFVE
                     KVVVLDSCQIHQKALMHLQETLMIEVDRLDFSLVERLNILARMENENYAF"
     gene            329406..329939
                     /locus_tag="HPSH112_01660"
                     /db_xref="GeneID:12773101"
     CDS             329406..329939
                     /locus_tag="HPSH112_01660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227046.1"
                     /db_xref="GI:386753828"
                     /db_xref="GeneID:12773101"
                     /translation="MRFSYIEPRAKYLISKLSKIWVFYIFLSFVVIGGLVWFMHNAIK
                     NTQNNASDLTIQERLYRHEISRLQVKTDETLKLIKEAKKRLNYNDDIRDVLQGLLNIV
                     PDLITINSIEIDQQSVVVSGKTPSKEAFYFLFQNKLNPMFDYSRAEFFPLSDGWFNFV
                     STNFSNSLLIKNPESIK"
     gene            329936..330475
                     /locus_tag="HPSH112_01665"
                     /db_xref="GeneID:12773102"
     CDS             329936..330475
                     /locus_tag="HPSH112_01665"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227047.1"
                     /db_xref="GI:386753829"
                     /db_xref="GeneID:12773102"
                     /translation="MKPLHFSHLDREQSGDVGFIIKNLVFLGVFSLFGWLNTEYFLWP
                     SMLELKKILLEENRKKSVLEYAQRHFETALTNYRNQKETGESLLKIFNDEESRRILEK
                     ILKKCFDAYKIKPLLSQKPFQKTQFFIMARASELEKTYLFFTLINKYLPSAQSQLPLK
                     ISKDDEGLLVQFSVSIDLQ"
     gene            330492..330890
                     /locus_tag="HPSH112_01670"
                     /db_xref="GeneID:12773103"
     CDS             330492..330890
                     /locus_tag="HPSH112_01670"
                     /note="COG0727 Predicted Fe-S-cluster oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227048.1"
                     /db_xref="GI:386753830"
                     /db_xref="GeneID:12773103"
                     /translation="MQDFDFSFNHKACEGCGAKCCVGESGYIFLNIQEMQKISAFLKL
                     ELEEFSQKYVKKVGYKFSLLEKDAKELGLACVFLDLETKKCQIYSMRPKQCQTFPFWE
                     SVKTFSKEQKEAFCQSCPGITQKTKETKVR"
     misc_feature    330492..330881
                     /locus_tag="HPSH112_01670"
                     /note="Predicted Fe-S-cluster oxidoreductase [General
                     function prediction only]; Region: COG0727"
                     /db_xref="CDD:223799"
     gene            330928..332220
                     /locus_tag="HPSH112_01675"
                     /db_xref="GeneID:12773104"
     CDS             330928..332220
                     /locus_tag="HPSH112_01675"
                     /note="COG0457 FOG: TPR repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent nuclease"
                     /protein_id="YP_006227049.1"
                     /db_xref="GI:386753831"
                     /db_xref="GeneID:12773104"
                     /translation="MGIQIKKRFLASLLLFSLFCLKAETLSEDHQILLSSDAFHRGDF
                     ASAQKGYMNLYKQTNKVVYAKEAAISAASLGDIKTAMHLAMLYQKITNNRNDVSINKI
                     LVDGYVQMGQIDKAIELLHKIRKEEKTIATDNVLGTLYLTQKRLDKAFPLLSKFYNAV
                     HDEDSLEKLITIYFLQNRKKEGLDLLQSHIDRYGCSEQLCQKALNTFTQFNELDLAKT
                     TFARLYEKNPIVQNAQFYIGVLILLKEFDKAQQIAELFPFDRRLLLDLYTAQKKFAQA
                     SKQASLIYQEKKDPKFLGLEAIYHYESLSTKNKKLTKQEMLPIIQKLEKATKERQQIL
                     AKTKDKEDAQDAFFYNFLGYSLIDYDLDIKRGMDFVRKALALDSGSVLYLDSLAWGYY
                     KLGNCLEAKKIFSSIAKEFIQAEPELKEHNKIIQECKK"
     misc_feature    <331129..332142
                     /locus_tag="HPSH112_01675"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     gene            332208..332765
                     /locus_tag="HPSH112_01680"
                     /db_xref="GeneID:12773105"
     CDS             332208..332765
                     /locus_tag="HPSH112_01680"
                     /note="COG0134 Indole-3-glycerol phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227050.1"
                     /db_xref="GI:386753832"
                     /db_xref="GeneID:12773105"
                     /translation="MQEIGILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRIISKTK
                     DCVFVTPDEVLGKLLEENTRTDCVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVH
                     QDLFISHYQLLESLVQGSDGVILDEELLKEDLKGMAEFAWRLGLSVFVETHKPDYTHL
                     KDLGVLGVLEKVPHSQNQKKIVFLD"
     misc_feature    <332460..>332666
                     /locus_tag="HPSH112_01680"
                     /note="TIM barrel proteins share a structurally conserved
                     phosphate binding motif and in general share an eight
                     beta/alpha closed barrel structure. Specific for this
                     family is the conserved phosphate binding site at the
                     edges of strands 7 and 8. The phosphate...; Region:
                     TIM_phosphate_binding; cl17186"
                     /db_xref="CDD:266538"
     gene            332822..333076
                     /locus_tag="HPSH112_01685"
                     /db_xref="GeneID:12773106"
     CDS             332822..333076
                     /locus_tag="HPSH112_01685"
                     /note="COG1145 Ferredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="putative 4Fe-4S ferredoxin-type protein"
                     /protein_id="YP_006227051.1"
                     /db_xref="GI:386753833"
                     /db_xref="GeneID:12773106"
                     /translation="MSLLVNDECIACDACREECPSEAIEEGDPIYNIDPDRCTECYGY
                     DDDEPRCVSVCPVDAILPDPNNAESKEELKYKYESLKEQD"
     misc_feature    <332846..333007
                     /locus_tag="HPSH112_01685"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     misc_feature    332846..332998
                     /locus_tag="HPSH112_01685"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     gene            333086..334540
                     /locus_tag="HPSH112_01690"
                     /db_xref="GeneID:12773107"
     CDS             333086..334540
                     /locus_tag="HPSH112_01690"
                     /note="COG0248 Exopolyphosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-5'-triphosphate,3'-diphosphate
                     pyrophosphatase"
                     /protein_id="YP_006227052.1"
                     /db_xref="GI:386753834"
                     /db_xref="GeneID:12773107"
                     /translation="MAKITTVIDIGSNSVRLAIFKKTSQFGFYLLFETKSRVRISEGC
                     YAFDGVLQEIPMQRAIKALSEFKEIALKYKSKKILCVATSAVRDAPNRLEFVARVKKA
                     CGLQIKIIDGQKEALYGGIACANLLHKNSGITIDIGGGSTECALIEKGKIKDLISLDV
                     GTIRIKEMFLDKDLDVKTAKAFIQKEVSKLPFKHKNAFGVGGTIRALSKVLMKRFDYP
                     IDSLHGYEIDAHKNLAFIEKIVTLKEDQLRLLGVNEERLDSIRSGALILLVVLEHLKT
                     SLMITSGVGVREGVFLSDLLRHHYHKFPPNINPSLISLKDRFLPHEKHSQKVKKECVK
                     LFEALSPLHKIDEKYLFHLKIAGELASMGKILSVYLAHKHSAYFILNALSYGFSHQDR
                     AIICLLAQFSHKKIPKDNAIAHMSAMMPSLLTLQWLSFILSLAENLCLTDSHHLKYTL
                     EKNKLVIHSNDALYLAKEMLPKLVKPIALMIEFA"
     misc_feature    333086..334534
                     /locus_tag="HPSH112_01690"
                     /note="Exopolyphosphatase [Nucleotide transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: GppA; COG0248"
                     /db_xref="CDD:223326"
     misc_feature    333104..333589
                     /locus_tag="HPSH112_01690"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cd00012"
                     /db_xref="CDD:212657"
     misc_feature    order(333110..333121,333125..333127,333131..333133,
                     333428..333430,333491..333502)
                     /locus_tag="HPSH112_01690"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            334537..335547
                     /locus_tag="HPSH112_01695"
                     /db_xref="GeneID:12773108"
     CDS             334537..335547
                     /locus_tag="HPSH112_01695"
                     /note="COG0859 ADP-heptose:LPS heptosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide heptosyltransferase-1"
                     /protein_id="YP_006227053.1"
                     /db_xref="GI:386753835"
                     /db_xref="GeneID:12773108"
                     /translation="MKIAIVRLSALGDIIVSAVFLALIKECFTNAQIEWFVDERFGAI
                     LEHSPYIDKLHPIALKSALTTFNPLKIFKLFKSLRAYEYDIVIDMQGLIKSALITQML
                     KAPKKVGFDCASAREGLSAFFYSQKVSIAYNEPVLKRNFTLLSHALNLPKKEISEGLS
                     SRSKVFSYQDSPKIDALNLNKNKLKILFVLETSKLNKTYPIERFKELALALENFQICL
                     LWHASEDKANALYGALKNQRDVLLLPKLTLNEVKALLFKMDLIIGGDTGITHLAWALQ
                     KPSITLYGNTPMERFKLESPINVSLTGNSNANYHKKDFSIQNIEPKKIKECVLNLLKE
                     KE"
     misc_feature    334540..335409
                     /locus_tag="HPSH112_01695"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(334966..334971,335191..335193,335287..335292,
                     335326..335328,335335..335340,335347..335349)
                     /locus_tag="HPSH112_01695"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            335544..336530
                     /locus_tag="HPSH112_01700"
                     /db_xref="GeneID:12773109"
     CDS             335544..336530
                     /locus_tag="HPSH112_01700"
                     /note="COG1560 Lauroyl/myristoyl acyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis lauroyl acyltransferase"
                     /protein_id="YP_006227054.1"
                     /db_xref="GI:386753836"
                     /db_xref="GeneID:12773109"
                     /translation="MTYKERLIHEKILNQGDKGFRTELRILSIFIVESLVNILGFILA
                     KMPHLWFLRCIKAVAWLMKTFDKRRYFDAKANLDFVFGDSKSEEEKKKIIKKGYENFA
                     FILLETIRVIFIPKDEYDARFTLINEENVWKSLNKEGQAITLCMHFGYWEAVGTTLAQ
                     YYKDYGRGCLGRLTKFAPINHMIMSRREAFGVRFVNKMGAMKELIKMYNQGNGLVGIL
                     VDQNVAPKDGVVVKFFNKDATHTTIASVLSRRYNIDIQPVFIDFNDDYSHYTATYYPS
                     MRSKITDNAENDILECTQAQASLCEEVIRKHPESYFWFHRRFKSTHPEIYQR"
     misc_feature    335901..336500
                     /locus_tag="HPSH112_01700"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: LABLAT-like; Region:
                     LPLAT_LABLAT-like; cd07984"
                     /db_xref="CDD:153246"
     misc_feature    order(335982..335984,335991..335993,335997..335999,
                     336054..336065,336204..336212)
                     /locus_tag="HPSH112_01700"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153246"
     gene            complement(336585..337700)
                     /gene="tgt"
                     /locus_tag="HPSH112_01705"
                     /db_xref="GeneID:12773110"
     CDS             complement(336585..337700)
                     /gene="tgt"
                     /locus_tag="HPSH112_01705"
                     /EC_number="2.4.2.29"
                     /note="COG0343 Queuine/archaeosine
                     tRNA-ribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="queuine tRNA-ribosyltransferase"
                     /protein_id="YP_006227055.1"
                     /db_xref="GI:386753837"
                     /db_xref="GeneID:12773110"
                     /translation="MDFQLQAMDNNARAGLLNLAHSQVATPVFMPVGTQGCIKSLDAT
                     DMQDILGTKLILANTYHMYLRPGEKVVEKLGGLHRFTQFHGSFLTDSGGFQAFSLSDN
                     VKLQEDGIVFKSHIDGSKHLFTPAKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESI
                     KRSAKWANLSLEYHKQKNRPNNNLFAIIQGGTHLKMRSLSVGLTHEGFDGYAIGGLAV
                     GESADEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAIGLGVDMFDCVMPTRNARNA
                     TLFTHSGKISIKNAPYKLDDTPIEENCTCYTCKRYSKAYLHHLFRAKELTYARLASLH
                     NLHFYLELVKNARNAILEKRFLSFKKEFLEKYHSRSH"
     misc_feature    complement(336606..337700)
                     /gene="tgt"
                     /locus_tag="HPSH112_01705"
                     /note="queuine tRNA-ribosyltransferase; Provisional;
                     Region: tgt; PRK00112"
                     /db_xref="CDD:234642"
     misc_feature    complement(336603..337694)
                     /gene="tgt"
                     /locus_tag="HPSH112_01705"
                     /note="Queuine/archaeosine tRNA-ribosyltransferase
                     [Translation, ribosomal structure and biogenesis]; Region:
                     Tgt; COG0343"
                     /db_xref="CDD:223420"
     gene            337757..339193
                     /locus_tag="HPSH112_01710"
                     /db_xref="GeneID:12773111"
     CDS             337757..339193
                     /locus_tag="HPSH112_01710"
                     /note="COG3400 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227056.1"
                     /db_xref="GI:386753838"
                     /db_xref="GeneID:12773111"
                     /translation="MKKIALILDGIVAKNFLDLVLRHYSNHNFYIVVVKNESLIPKNY
                     PSTFAFHCFDATSSFRLLQVLNDEVSDAFLIIQDFKEQRIIHKIIQTHFKRMRVVLGV
                     KRDGEKTLENNEENKDEKLILIDEFEVLANKFISRLPNIPSTPREFGLGKGEIMEIDV
                     PFGSIFAYRHIGSIRQKEYRIVGLYRNDVLLLSTKSLVIQPRDILLVAGNPEILNAVY
                     LQVKSNVGQFPAPFGKSIYLYIDMRLQSRKAMMRDVYQALFLHKHLKSYKLYIQVLHP
                     TSPKFYHKFLSLETESIEVNFDFYGKSFIQKLHEDHQKKMGLIVVGRELFLSKKHRKA
                     LYKTATPVYKTNASGLSKTSQSVVVLNESLDINEDMSSVIFDVSMQMDLGLLLYDFDP
                     NKRYKNEIVNHYENLANALNRKIEIFQTDIRNPIMYLNSLRKPILHFMPFEECITHTR
                     FWWFLSTKVEKLAFLNDDNPQIFIPIAE"
     misc_feature    337757..339187
                     /locus_tag="HPSH112_01710"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3400"
                     /db_xref="CDD:225935"
     misc_feature    338219..338407
                     /locus_tag="HPSH112_01710"
                     /note="TrkA-C domain; Region: TrkA_C; pfam02080"
                     /db_xref="CDD:251075"
     gene            339198..340229
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /db_xref="GeneID:12773112"
     CDS             339198..340229
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /EC_number="4.2.3.4"
                     /note="COG0337 3-dehydroquinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate synthase"
                     /protein_id="YP_006227057.1"
                     /db_xref="GI:386753839"
                     /db_xref="GeneID:12773112"
                     /translation="MQEILIPLKEKSYKVFLGELPEIELKQKALIISDSIVAGLHLSY
                     LLKRLKALEVRVCVIESGEKYKNFNSLERILNSAFEMQLNRHSLMIALGGGVISDMVG
                     FASSIYFRGIDFINIPTTLLAQVDASVGGKTGINTPYGKNLIGSFYQPKAVYIDLAFL
                     KTLEKREFQAGVAEIIKMAVCFDKNLVEILETKDLKDCLEEVVFQSVSIKAQIVTQDE
                     KEQNIRAGLNYGHTFGHAIEKETDYERFLHGEAIAIGMRMANDLALSLGMLTLKEYER
                     IEDLLKKFDLIFNYKITDIQKFYERLFLDKKSEDKTIKFILPKGVGAFEIASHIPKET
                     IIKVLEKWH"
     misc_feature    339231..340214
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /note="Dehydroquinate synthase (DHQS) catalyzes the
                     conversion of DAHP to DHQ in shikimate pathway for
                     aromatic compounds synthesis; Region: DHQS; cd08195"
                     /db_xref="CDD:173954"
     misc_feature    order(339297..339299,339477..339485,339492..339494,
                     339501..339503,339552..339557,339561..339563,
                     339618..339620,339627..339629,339672..339674,
                     339696..339698,339717..339719,339729..339731,
                     339888..339890,339900..339902,339939..339941)
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /note="active site"
                     /db_xref="CDD:173954"
     misc_feature    order(339399..339401,339420..339425,339504..339506,
                     339513..339515,339519..339527,339591..339596,
                     339621..339638)
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173954"
     misc_feature    order(339717..339719,339888..339890,339939..339941)
                     /gene="aroB"
                     /locus_tag="HPSH112_01715"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173954"
     gene            340220..341785
                     /locus_tag="HPSH112_01720"
                     /db_xref="GeneID:12773113"
     CDS             340220..341785
                     /locus_tag="HPSH112_01720"
                     /note="COG0668 Small-conductance mechanosensitive channel"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227058.1"
                     /db_xref="GI:386753840"
                     /db_xref="GeneID:12773113"
                     /translation="MALRVLLFFCFLFLQAEDKSQELLSIQKQMALVDKKLAKDDNVW
                     LKKFENYKIYNQIYTEKESVRQELRRLKNKKSKDLLKISTLEHTLKALESQQKMFESY
                     GVNPFKDLIERPNIPNIPNIANPIAIIDGISFIKSMRLKHESLKNNQTALEEVLRLLD
                     QKHQLLNQWHALDKNAKLSDEIYQTQAKRLELQGAQNILKTTIGIFQKDSDEAISIVK
                     SQVKNQLFKLVYVFLAALLSVVFAWILKIISSKYIENNERVYTVNKAINFVNVSVIIL
                     IFLFSYLENVTYLVTVLGFASAGLAIAMKDLFMSLLGWFIILIGGSVHVGDRVRIAKG
                     TDIFIGDVLDISMLHITILEDVTFTTYTNNRRAGRIIFVPNNYIFTTMFANYSHFGMK
                     TVWDGVDFCVTFDSDFKKASKIALNIATELSKEYTDITYKQLNKMRDRYSLRSLSVKP
                     RCFLMPESNGIKISVWYQTNSYATLSLRSKIVAEIVEAFLKEENIHIAYTTSKLLKVD
                     TEGDGFGNKREQK"
     misc_feature    340811..341755
                     /locus_tag="HPSH112_01720"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    341015..341710
                     /locus_tag="HPSH112_01720"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            341782..343038
                     /locus_tag="HPSH112_01725"
                     /db_xref="GeneID:12773114"
     CDS             341782..343038
                     /locus_tag="HPSH112_01725"
                     /note="COG0621 2-methylthioadenine synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227059.1"
                     /db_xref="GI:386753841"
                     /db_xref="GeneID:12773114"
                     /translation="MKKVYFKTFGCRTNLFDTQVMGENLKDFSATLEEQEADIIIINS
                     CTVTNGADSAVRSYAKKMARLNKEVLFTGCGVKTQGKELFEKGFLKGVFGHDNKEKIN
                     ALLQEKKRFFIDDNLENKHLDTTMVSEFVGKTRAFIKIQEGCDFDCNYCIIPSVRGRA
                     RSFEERKILEQVGLLCSKGVQEVVLTGTNVGSYGKDRGSNIARLIKKLSQIAGLKRIR
                     IGSLEPNQINDEFLELLEEDFLEKHLHIALQHSHDFMLEKMNRRNRIKSDRELLEIIA
                     SKNFAIGTDFIVGHPGESGSVFEEAFKNLESLPLTHIHPFIYSKRKDTPSSLMTDSVI
                     LEDSKKRLNAIKDLISHKNKAFRQLQLKLNTPLKALVEVQKDGEFKALDQFFNPIKIK
                     SDKPLRASFLEIRDYEIKERENHAVF"
     misc_feature    341788..343029
                     /locus_tag="HPSH112_01725"
                     /note="radical SAM methylthiotransferase, MiaB/RimO
                     family; Region: TIGR00089"
                     /db_xref="CDD:232820"
     misc_feature    341788..342063
                     /locus_tag="HPSH112_01725"
                     /note="Uncharacterized protein family UPF0004; Region:
                     UPF0004; pfam00919"
                     /db_xref="CDD:250224"
     misc_feature    342181..342810
                     /locus_tag="HPSH112_01725"
                     /note="Elongator protein 3, MiaB family, Radical SAM;
                     Region: Elp3; smart00729"
                     /db_xref="CDD:214792"
     gene            343025..344677
                     /locus_tag="HPSH112_01730"
                     /db_xref="GeneID:12773115"
     CDS             343025..344677
                     /locus_tag="HPSH112_01730"
                     /note="COG0465 ATP-dependent Zn proteases"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsH"
                     /protein_id="YP_006227060.1"
                     /db_xref="GI:386753842"
                     /db_xref="GeneID:12773115"
                     /translation="MPFSKNLENLTAPFKRIKNRSLVLALGFLILTFCLLLFLVLSDV
                     SRLISSKDFFYVIQSHPKQTLTEDENYFYANKGLYKTNKEAFLRAYKIPESMPIEKRE
                     NLNKVSKIFLALLFFISSMLFGIFWCLPKRLDTKMNLESVHKNELENAFQRYDALGVR
                     FEDIAGVDEVKEELLEVIDYLKNPKKYQDLGIFLPKGVLLIGPPGVGKTMIAKALASE
                     ARVPFFYESGSAFSQIYVGAGAKKVHELFMHAKRHAPSIIFIDEIDALGKARGGHRSD
                     EREATLNQLLTEMDGFLQNDEVVVIGATNQMEVMDEALLRSKRFDRRIFISLPDLSER
                     QSILEKLLENKKHALNYLKIAKICVGFSGAMLATLINESALNALKHQRIEITESDILE
                     VKDKIAYGKKKPQTLDENQKELVALYQSAKALSAYWLEIEFDKAPLLGEFIAFNENKI
                     HSESEIKNYIKVYLSGTIILELLYKERYSLSKQDLQKAKFLNEFMASELLLAPTKESL
                     SVLYEEQLEFLKPQIAACKRLSVLLLEQEYLEHSNLYDLLNG"
     misc_feature    343106..344674
                     /locus_tag="HPSH112_01730"
                     /note="ATP-dependent Zn proteases [Posttranslational
                     modification, protein turnover, chaperones]; Region: HflB;
                     COG0465"
                     /db_xref="CDD:223541"
     misc_feature    343517..344008
                     /locus_tag="HPSH112_01730"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    343628..343651
                     /locus_tag="HPSH112_01730"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(343631..343654,343805..343807,343937..343939)
                     /locus_tag="HPSH112_01730"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    343793..343810
                     /locus_tag="HPSH112_01730"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    343979..343981
                     /locus_tag="HPSH112_01730"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            344680..345198
                     /locus_tag="HPSH112_01735"
                     /db_xref="GeneID:12773116"
     CDS             344680..345198
                     /locus_tag="HPSH112_01735"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227061.1"
                     /db_xref="GI:386753843"
                     /db_xref="GeneID:12773116"
                     /translation="MRFFSGFGFTDESVLFEKWLLKGAYDVSGFSIGAIKAIEYAYNE
                     ILQQRRINSLLLFSPCMLAHKSLAFKRLQLSSFQKDPQSYMDNFYQEVGLSAKLERFK
                     REGSLEELEFLLNYKYSDSTIRFLLEKGVKIEAFIGLRDRITDIQALLEFFMPLVQVW
                     QFKDCNHLLQKS"
     gene            345211..345684
                     /locus_tag="HPSH112_01740"
                     /db_xref="GeneID:12773117"
     CDS             345211..345684
                     /locus_tag="HPSH112_01740"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227062.1"
                     /db_xref="GI:386753844"
                     /db_xref="GeneID:12773117"
                     /translation="MKKFGLGVYLLLLGILGGSLIILGAIVAPIVFKASSILPELNLT
                     PFESGKLMAQIFVRFNYILGAIGFVVLLYEIISFIYYKRSLVYLILGVAIGALCFLFV
                     FYYTPYILNAQKAGEVALQSAEFARSHAQSEWLFKELFVLVCALFFWRLFGKNAL"
     misc_feature    345283..345561
                     /locus_tag="HPSH112_01740"
                     /note="Domain of unknown function (DUF4149); Region:
                     DUF4149; pfam13664"
                     /db_xref="CDD:257971"
     gene            345747..354446
                     /locus_tag="HPSH112_01745"
                     /db_xref="GeneID:12773118"
     CDS             345747..354446
                     /locus_tag="HPSH112_01745"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin-like outer membrane protein"
                     /protein_id="YP_006227063.1"
                     /db_xref="GI:386753845"
                     /db_xref="GeneID:12773118"
                     /translation="MKKFKKKPKSIKRSHQKTILKRPLWLAPLLISGFASGVYANNLW
                     DLLNPKVGGEYVHWVKGSQYCAWWEFAGCLKNVWGANHKGYDAGNAANYLSSQNYQAI
                     FVGSGNETGTYSLSGFTNYVGGNLTINLGNSVVLDLSGSNSFTSYQGYNQGKDDVSFN
                     VGAINLNGALEVGNRVGSGAGTHTGTATLNLNANQVNINSNISAFKTSQVNIGNANSV
                     ITIGSVSLSGDTCSSLTRVGVGANCSTSGPSYSFKGITNATNTAFSNASGSFTFEENA
                     AFSGAKLNGGTYTFNKGFSATNNTAFNSGSFNFKGASSFNGATFNNATYTFNNQATFQ
                     NSSFNGGTFTFNNQTNQTNSAQHPQILFENSSFSGNATTLKGFVDFQQAFNNSSHQLT
                     AQNASFNGANFNNTGKITIEKEVSFNNTTFNTSINTSNMTITGSVTLSGKNDLKNGST
                     LDFGSSQVTLTQGTTFNLTSLGDKNSVTILNSSGGITYNNLLNHALNSLTNALKTSEN
                     SSDPQNFAQGLWDMITYNGVTGQLLSANIVASKVADSSLSKSSTNPTKVYQVGYKIGD
                     IIYKLQETFSHNSIIIQALESGTYTPPPVISGSKFDLSASNYIDSNMPWYDHKSYIPK
                     SQNFTESGTYYLPSVQIWGSYTNSFKQTFSASGSNLVIGYNSTWTDHNVSSSDTVSFG
                     DTSGSALNGHCGPWPYYQCTGTTDGAYSAYHVYITANLRSGNRIGTGGAANLIFNGVD
                     SVNIANATITQHNAGIYSSSMTFSTQSMDNSQNWNGLNPNGTLSVYGATFTNQAKDGK
                     FIFNAGKAVFENTNFNGGSYQFSGDSLNFSNNNQFNSGSFEISAKNASFNNANFNNSA
                     SFNFNNSNATTSFVGDFTNANSNLQIAGNAVFGNSNNGSQNNANFNNTGSVNISGNAT
                     FDNVVFNSPTNMSVKGQVALNNITLKNLNAPLSFGDGTITFNAHSVINIGEAITNGNP
                     ITLVSSSKEIEYNNAFSKNLWQLINYQGHGASSEKLVSSVGNGVYDVVYSFNNQTYNF
                     QEIFSPNSISIRRLGVGMVFDYMDMEKSDHLYYQNALGFMTYMPNSYNNNLGDSNNTI
                     YYYDKSIDFYASGKTLFTKAEFSQTFTGQNSAIVFGAKSIWTNASDAPQSNTIIRFGD
                     NKGAGSNDASGHCWNLQCIGFITGHYEAQKIYITGSIESGNRISSGGGANLNFNGLQG
                     ILLTNATLYNRAAGTQSSSMNFTSKSVNIQAQNSYFIDDTAQNGGNPNFSFNALNLDF
                     SNSSFRGYVGQTQSVFKFNASNAINFTNSTNLSSGLYQMQAKSVSFDNSNLSVSVGTS
                     SIKANAINLSQNASINASNHSTLELQGGLNLNDTSSLNLNQSVINVSNNATINDYASL
                     IVNDGSRLNFNGTTNFNSANITTSLNHSSIVFKGAISLGGQFNLSNNSSLDFQGSSAI
                     TSNTAFNFYDNAFSQSPITFHQALDIKASLSLGGNLLNPDNSSVLNLKNSQLVFSDQG
                     SLNIANIDLLSDLNDNKNRVYNIIQAGMNNNWYERINFFGMRINDGVYDAINQTYSFT
                     NPLNNALKITESFKDNQLSVTLSQIPGIKNTLYNISSEVFNYQKVYNNANGMYSYSDD
                     AEGVFYLTSNVKGYYSPNQSYQASGSNNTTKNNNLTSDSSVISQTYNAQGNPISALHV
                     YNKGYNFNNIKALGQMALKLYPEIKKILGNDFSLSSLSALNSNALNQLTKLITPNDWK
                     NINELIDNANNSVVQNFNNGTLIVGAAKIGQTNANSAVVFGGLGYQKPCDYTDIVCQK
                     FRGTYLGQLLESSSADLGYIDTTFNAKEIYLTGTLGSGNAWGTGGSASVTFNSQTSLV
                     LNQANIVSSQTDGIFSMLGQEGINKVFNQAGLANILGEVAMQSINKAGGLGNLIADML
                     GSNSVIGGHLTPEQKNQTLSQLLGQNNFDNLMNDSGLNVAIKDLIRQKLGFWTGLVGG
                     LAGLGGIDLQNPEKLIGSMSINDLLSKKGLFNQITGFISANDIGQVISVVLQDIVKPS
                     SALQNDVAALSKQMIGEFLGQDTLNSLESLLQNQQIKSVLDKVLAAKGLGPIYEQGLG
                     DLMPNLGKKGLFAPYGLSQVWQKGDFNFNAQGNVFVQNSTFSNANGGALSFNAGNSLI
                     FAGNNHISFTNHAGALNLLSNQVSNINITTLNVSNGLKINAANNNVSVSQGNLFINAS
                     CAGQSDSTTANIANPCALSAQSANGASSSNASNNAQIALNNNDESLMVTANDFNFSGN
                     IYANGVVDFSKIKGSANIKNLYLYNNAQFQANNLIISNQAVLEKNASFMANNLNIQGA
                     FNNNATRKIEVLQNLTIASNASLSTGIYGLEVGGALNNFGAIHFNLENIQTPTPLIQA
                     EGIINLNTTQTPFMNVNNSMANNTTYTLLKSSRYIDYNINPNSLQSYLNLYTLINING
                     NRIEEKNGVLTYLGQRVLLQDKGLLLSVALPNSNNAHQNNILSLSVLHNQIKMSYGDK
                     VMDFTPPTLQDYIVGIQGQSALNQIEAVGGNNAIKWLSTLMMETKENPLFAPIYLKNH
                     SLNEILGVAKDLLNTASLISNPNFRNNATNLLELASYTQQTSRLTKLSDFRAREGESD
                     FSERLLELKNKRFSDPNPSEVFAKYSQPNKHPNNLWVQGIGGASFISGGNGTLYGLNV
                     GYDRLVKNVILGGYVAYGYSGFNGNIMHSLANNVDVGMYARAFLKRNEFTLSANETYE
                     GNASNINSSNPLLSVLNQRYSYNTWTTSVNGNYGYDFMFKQKSVVLKPQVGLSYHFIG
                     LSGMKGKMNDAAYKQFLMHSNPSNESVLTLNMGLESRKYFGKNSYYFVTARLGRDLLI
                     KSKGGNMVRFVGENTLLYRKGEVFNTFASVITGGEMHLWRLVYVNAGVGLKMGLQYQD
                     INITGNVGMRVAF"
     misc_feature    345996..>346433
                     /locus_tag="HPSH112_01745"
                     /note="Vacuolating cyotoxin; Region: VacA; pfam02691"
                     /db_xref="CDD:111576"
     misc_feature    347844..348023
                     /locus_tag="HPSH112_01745"
                     /note="Putative vacuolating cytotoxin; Region: VacA2;
                     pfam03077"
                     /db_xref="CDD:111918"
     misc_feature    349233..349412
                     /locus_tag="HPSH112_01745"
                     /note="Putative vacuolating cytotoxin; Region: VacA2;
                     pfam03077"
                     /db_xref="CDD:111918"
     misc_feature    350370..>351425
                     /locus_tag="HPSH112_01745"
                     /note="PPE-repeat proteins [Cell motility and secretion];
                     Region: COG5651"
                     /db_xref="CDD:227938"
     misc_feature    351141..351320
                     /locus_tag="HPSH112_01745"
                     /note="Putative vacuolating cytotoxin; Region: VacA2;
                     pfam03077"
                     /db_xref="CDD:111918"
     misc_feature    353619..>354239
                     /locus_tag="HPSH112_01745"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; pfam03797"
                     /db_xref="CDD:252169"
     gene            354494..355711
                     /locus_tag="HPSH112_01750"
                     /db_xref="GeneID:12773119"
     CDS             354494..355711
                     /locus_tag="HPSH112_01750"
                     /note="COG0019 Diaminopimelate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate decarboxylase"
                     /protein_id="YP_006227064.1"
                     /db_xref="GI:386753846"
                     /db_xref="GeneID:12773119"
                     /translation="MFNYEELFQTHKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYA
                     LKANSNLSILSLLAHLESGADCVSIGEIYRALKAGIKPYRIVFSGVGKSEFEIEQALK
                     LNILFLNVESFMELQTIEKIAQSLGIKARISIRINPNIDAKTHPYISTGLKENKFGVG
                     EKEALEMFLWAKKSAFLEPISVHFHIGSQLLDLEPIVEASQKVAKIAKSLIALGIDLR
                     FFDVGGGIGVSYENEETIKLYDYAQRILNALQGLDLTIICEPGRSIVAESGELITQVL
                     YEKKAQNKRFVIVDAGMNDFLRPSLYHAKHAIRVITPSKGRKISPCDVVGPVCESSDT
                     FLKGVNLPELEPGDKLVIEKVGAYGSSMASQYNSRPKLLELALEDHQIRVIRKREALE
                     DLWRLEEEGLKGV"
     misc_feature    354494..355687
                     /locus_tag="HPSH112_01750"
                     /note="diaminopimelate decarboxylase; Region: lysA;
                     TIGR01048"
                     /db_xref="CDD:233248"
     misc_feature    354524..355624
                     /locus_tag="HPSH112_01750"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Diaminopimelate Decarboxylase; Region:
                     PLPDE_III_DapDC; cd06828"
                     /db_xref="CDD:143501"
     misc_feature    order(354623..354625,354629..354631,354686..354688,
                     354755..354757,354896..354898,355040..355042,
                     355046..355048,355055..355057,355163..355168,
                     355268..355279,355385..355387,355397..355399,
                     355478..355480,355565..355567,355577..355579,
                     355589..355591)
                     /locus_tag="HPSH112_01750"
                     /note="active site"
                     /db_xref="CDD:143501"
     misc_feature    order(354623..354625,354629..354631,354686..354688,
                     354755..354757,354896..354898,355040..355042,
                     355046..355048,355055..355057,355163..355168,
                     355268..355279,355478..355480,355565..355567)
                     /locus_tag="HPSH112_01750"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143501"
     misc_feature    order(354629..354631,355046..355048,355055..355057,
                     355277..355279,355385..355387,355397..355399,
                     355478..355483,355565..355567,355577..355579,
                     355589..355591)
                     /locus_tag="HPSH112_01750"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143501"
     misc_feature    order(354629..354631,355478..355480)
                     /locus_tag="HPSH112_01750"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143501"
     misc_feature    order(354644..354649,354692..354697,354701..354706,
                     354761..354769,354779..354781,354824..354826,
                     354833..354835,354956..354967,355322..355324,
                     355328..355330,355349..355351,355355..355357,
                     355469..355486,355490..355492,355574..355582,
                     355586..355597,355604..355606)
                     /locus_tag="HPSH112_01750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143501"
     gene            355716..356006
                     /locus_tag="HPSH112_01755"
                     /db_xref="GeneID:12773120"
     CDS             355716..356006
                     /locus_tag="HPSH112_01755"
                     /note="COG1605 Chorismate mutase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227065.1"
                     /db_xref="GI:386753847"
                     /db_xref="GeneID:12773120"
                     /translation="MQKNLDSLLENLRAEIDVLDNELSDLLDKRLEIALKIALIKQEN
                     PIYCPKREQEILKRLSQRDFKHLNGEILTGFYAEIFKISRKFQENALKELKK"
     misc_feature    355740..356003
                     /locus_tag="HPSH112_01755"
                     /note="Chorismate mutase [Amino acid transport and
                     metabolism]; Region: PheA; COG1605"
                     /db_xref="CDD:224521"
     gene            356019..356891
                     /locus_tag="HPSH112_01760"
                     /db_xref="GeneID:12773121"
     CDS             356019..356891
                     /locus_tag="HPSH112_01760"
                     /note="COG4866 Uncharacterized conserved protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227066.1"
                     /db_xref="GI:386753848"
                     /db_xref="GeneID:12773121"
                     /translation="MFEKITLAHKDLFSRFLNAQKIVLSDVSFTNCFLWQHARLIQVA
                     VIRDCLVIQTTYDNQKPFYFYPIGKNALECVKELLKREKNLRFHSLTLEQKDDLKDNF
                     VGVFDFTYNRDRSDYIYSIEELIALKGKKYHKKKNHLNQFLTNCANFVYEKISSQNRK
                     EVLEASKEWFLESQTDDIGLINENKGIQSVLENYESLDVKGGLVRVNGEIVSFSFGEV
                     LNEETALIHIEKARMDIAGAYQIINQQLLLNEFSHLTYANREEDLGLEGLRRSKMSYN
                     PVFLIDKYEAVAKN"
     misc_feature    356019..356888
                     /locus_tag="HPSH112_01760"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG4866"
                     /db_xref="CDD:227203"
     gene            356892..358571
                     /locus_tag="HPSH112_01765"
                     /db_xref="GeneID:12773122"
     CDS             356892..358571
                     /locus_tag="HPSH112_01765"
                     /note="COG0147 Anthranilate/para-aminobenzoate synthases
                     component I"
                     /codon_start=1
                     /transl_table=11
                     /product="para-aminobenzoate synthetase"
                     /protein_id="YP_006227067.1"
                     /db_xref="GI:386753849"
                     /db_xref="GeneID:12773122"
                     /translation="MIFGDFKYQKRIKKLTATNLHELKNALDFISQNRGNGYFVGYLL
                     YEARLAFLDENFQSQTPFLYFEQFLERKKYSLEPLKEHAFYPKIHSSLDQKTYFKQFK
                     AVKEYLKNGDTYQVNLTMDLFLDTKAKLKRVFKEVIHNQNTPFKAFIENEFGSVLSFS
                     PELFFELEFLDTAIKIVTKPMKGTIARSNNPLIDEKNRLFLQNDDKNRSENVMIVDLL
                     RNDLSRLALKNSVKVNQLFEIISLPSVYQMISEIEAKLPLKTSLFEIFKALFPCGSVT
                     GCPKIKTMQIIESLEKRPRGVYCGAIGMVEEKKALFSVPIRTLEKRAREDFLHLGVGS
                     GVTYKSKAPKEYEESFLKSFFVMPKIEFEIVETMKIIKKDQKLEINNKNAHEERLMNS
                     AQYFNFKHDENLLDFELEKEGVLRVLLNKKGKLIKEYKALEPLKSLEIRLSEAPIDKR
                     NDFLYHKTTYAPFYQNARALIKQGVIFDEIFYNQDLELTEGARSNLILEIHNRLLTPY
                     FSAGALNGTGVMGLLKKGLVEHAPLKLQDLQRASKIYCINALYGLVEVKIK"
     misc_feature    356934..357959
                     /locus_tag="HPSH112_01765"
                     /note="aminodeoxychorismate synthase; Provisional; Region:
                     PRK07508"
                     /db_xref="CDD:236035"
     misc_feature    357168..357947
                     /locus_tag="HPSH112_01765"
                     /note="chorismate binding enzyme; Region: Chorismate_bind;
                     pfam00425"
                     /db_xref="CDD:249850"
     misc_feature    358044..358562
                     /locus_tag="HPSH112_01765"
                     /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
                     (PLPDE_IV). This D-amino acid superfamily, one of five
                     classes of PLPDE, consists of branched-chain amino acid
                     aminotransferases (BCAT), D-amino acid transferases
                     (DAAT), and...; Region: PLPDE_IV; cl00224"
                     /db_xref="CDD:260277"
     misc_feature    order(358260..358262,358359..358361,358440..358445,
                     358536..358538)
                     /locus_tag="HPSH112_01765"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    order(358260..358262,358359..358361)
                     /locus_tag="HPSH112_01765"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    358260..358262
                     /locus_tag="HPSH112_01765"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            358764..359783
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /db_xref="GeneID:12773123"
     CDS             358764..359783
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /EC_number="3.5.1.4"
                     /note="COG0388 Predicted amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="acylamide amidohydrolase"
                     /protein_id="YP_006227068.1"
                     /db_xref="GI:386753850"
                     /db_xref="GeneID:12773123"
                     /translation="MRHGDISSSPDTVGVAVVNYKMPRLHTKNEVLENCRNIAKVIGG
                     VKQGLPGLDLIIFPEYSTHGIMYDRQEMFDTAASVPGEETAILAEACKKNKVWGVFSL
                     TGEKHEQAEKNPYNTLILVNDKGEIVQKYRKILPWCPIECWYPGDKTYVVDGPKGLKV
                     SLIICDDGNYPEIWRDCAMRGAELIVRCQGYMYPAKEQQIAIVKAMAWANQCYVAVAN
                     ATGFDGVYSYFGHSSIIGFDGHTLGECGEEENGLQYAQLSVQQIRDARKYDQSQNQLF
                     KLLHRGYSGVFASGDGDKGVAECPFEFYKTWVNDPKKAQENVEKFTRPSVGVAACPVG
                     DLPTK"
     misc_feature    358800..359690
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /note="aliphatic amidases (class 2 nitrilases); Region:
                     aliphatic_amidase; cd07565"
                     /db_xref="CDD:143589"
     misc_feature    order(358905..358913,359100..359102,359163..359201,
                     359259..359261,359268..359282,359286..359291,
                     359295..359300,359343..359348,359355..359357,
                     359364..359369,359373..359378,359385..359390,
                     359445..359447,359475..359477,359490..359492,
                     359499..359501,359505..359525,359544..359546,
                     359559..359567,359571..359576,359580..359618,
                     359652..359654,359658..359687)
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143589"
     misc_feature    order(358938..358940,359160..359162,359172..359174,
                     359184..359186,359256..359261,359334..359336)
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /note="active site"
                     /db_xref="CDD:143589"
     misc_feature    order(358938..358940,359160..359162,359256..359258)
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143589"
     misc_feature    order(359100..359102,359163..359201,359259..359261,
                     359268..359282,359286..359291,359295..359300,
                     359346..359348,359355..359357,359364..359369,
                     359373..359378,359385..359390,359475..359477,
                     359559..359567,359571..359576,359580..359618,
                     359652..359654,359658..359687)
                     /gene="amiE"
                     /locus_tag="HPSH112_01770"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143589"
     gene            complement(359863..362343)
                     /gene="flgL"
                     /locus_tag="HPSH112_01775"
                     /db_xref="GeneID:12773124"
     CDS             complement(359863..362343)
                     /gene="flgL"
                     /locus_tag="HPSH112_01775"
                     /note="COG1344 Flagellin and related hook-associated
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="YP_006227069.1"
                     /db_xref="GI:386753851"
                     /db_xref="GeneID:12773124"
                     /translation="MRVTFGSKYNQMNNYQNALQNKINDANTQIASGLKIRYGYQNSD
                     INNQNLKFQYEENTLDQGIDVAQNAYTSTLNTDKALQEFSKTMETFKTKLIQSANDVH
                     SETSRVAIANDLERLREHMMNVANTSIGGEFLFGGSKVDRPPIDSEGKYHGNGEDLNA
                     LISSDNLVPYNISGQDLFLGADKDKHKLITTNIKLLNQNKLHPDVMDALEHSSLPEEV
                     FIKPGDTLRELIGDNDKDPTNDPKEFFYLQGIRPDGSSFKEKFALDKAYQNKESATKV
                     SDLLDKIGHAYGNTSQNKVVDVSLNNWGQIEIKNLTPGSENLDFHLISSDGDFDDLDA
                     LRSSAKRVTEYVKSAFVTDRSLSQVKAVPNMYNPRVLEIPSVFVTKDNVLANKNTKLS
                     EIFGDSVETLKINARDDTSAIKIPNLPVYLDIPILLNVKNSTIKDLKDAIKERFNNEV
                     DVEIETNGRLRIIDNSSNQSPISFALSALDQKGLEVAGIPTNNASEYQKTYFNKEGAK
                     LESNVAQIAQNGAANGSTKLSEVANGSLENSVFNMKLNDVNGSFLEAQMILDNNGAFL
                     SLPNGIKIPLYDPTSADIQASKPNEVTYRQLMDAMSIALNYSNTDPAIYQQISDNPTS
                     KESKERFIELLKQAKDNLSVNLNEEGKVIIQDNMHSNTKMQFMLFDKDANDFSQNALH
                     SDKPSLKLNANNALIIDKPSVNFFDQLENTITSVRKGIYRPDALGDTYSSDMRNLGIQ
                     NGITLIDHLSDHIEKMIAKNGAHGKTFENIIRRNEVLKTQVQSIRGETTGTDMAETYN
                     KFSNLTNNYNAVLASTNKINNLSLTKYL"
     misc_feature    complement(359866..362343)
                     /gene="flgL"
                     /locus_tag="HPSH112_01775"
                     /note="flagellar hook-associated protein FlgL; Validated;
                     Region: flgL; PRK08412"
                     /db_xref="CDD:236261"
     misc_feature    complement(361927..362319)
                     /gene="flgL"
                     /locus_tag="HPSH112_01775"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     gene            362588..362902
                     /gene="rplU"
                     /locus_tag="HPSH112_01780"
                     /db_xref="GeneID:12773125"
     CDS             362588..362902
                     /gene="rplU"
                     /locus_tag="HPSH112_01780"
                     /note="COG0261 Ribosomal protein L21"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L21"
                     /protein_id="YP_006227070.1"
                     /db_xref="GI:386753852"
                     /db_xref="GeneID:12773125"
                     /translation="MSYAIFKHGGKQYKVVEGDIVLLDKMDKEPKALVELVEVLAVSK
                     EGKLSCGKPFVNGAKIEAEVINEGRGKKVITFKKRRRKDSKTKRGFRRDFTRVRITKI
                     VA"
     misc_feature    362594..362899
                     /gene="rplU"
                     /locus_tag="HPSH112_01780"
                     /note="50S ribosomal protein L21; Validated; Region: rplU;
                     PRK05573"
                     /db_xref="CDD:235510"
     gene            362917..363183
                     /gene="rpmA"
                     /locus_tag="HPSH112_01785"
                     /db_xref="GeneID:12773126"
     CDS             362917..363183
                     /gene="rpmA"
                     /locus_tag="HPSH112_01785"
                     /note="COG0211 Ribosomal protein L27"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L27"
                     /protein_id="YP_006227071.1"
                     /db_xref="GI:386753853"
                     /db_xref="GeneID:12773126"
                     /translation="MAHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTK
                     MHPGNNVGMGKDHTLYALIDGVVKFEHKDRNRKKVSVVSQNFGE"
     misc_feature    362917..363162
                     /gene="rpmA"
                     /locus_tag="HPSH112_01785"
                     /note="50S ribosomal protein L27; Validated; Region: rpmA;
                     PRK05435"
                     /db_xref="CDD:235464"
     gene            363298..364947
                     /locus_tag="HPSH112_01790"
                     /db_xref="GeneID:12773127"
     CDS             363298..364947
                     /locus_tag="HPSH112_01790"
                     /note="COG0747 ABC-type dipeptide transport system,
                     periplasmic component"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic dipeptide-binding protein"
                     /protein_id="YP_006227072.1"
                     /db_xref="GI:386753854"
                     /db_xref="GeneID:12773127"
                     /translation="MNNVFVKGLFFFLLLFGFFLKALENPNATLNPSKENVSVEEQKR
                     FGGVLVFARGADGSSMDPALVTDGESYVATGNIYDTLVQFKYGTTEIEPALATSWEIS
                     PDGLVYTFHLRKGVYFHQTKYWNKKVEFSAKDVLFSFERQMDKAKRYYNPGAKSYKYW
                     EGMGMSHIIKSIEALDDYTIRFTLNGPEAPFLANLGMDFLSILSKDYADYLAQNNKKD
                     ELAKKPIGTGPFKFFLWNKDEKIILLKNQDYWGSKAYLDKVVVRTIPNPSTRALALRT
                     GEIMLMTGPNLSEVEQLEKVPNIVVDKSAGLLASWLSLNTQKKYFNNPLVRLAINHAI
                     NVDDYIKVLYEGFAQKMVNPFPPTIWGYNYNIKPYEYDLKKAKELLKQAGYPNGFKTT
                     IFTTATRNPKGAVFIQASLAKIGIDVKIEVYEWGAYLKRTGLGEHEMAFAGWMADIAD
                     PDNFLYTLWSKQAASAIPTQNGSFYKSDAFSDLLLKAKRVSDQKEREALYLKAQEIIH
                     KDAPYVPLAYPYSVVPHLSKVKGYKTTGVSVNRFFKVYLEK"
     misc_feature    363403..364944
                     /locus_tag="HPSH112_01790"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    363439..364893
                     /locus_tag="HPSH112_01790"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(364570..364572,364582..364584,364621..364632,
                     364636..364638)
                     /locus_tag="HPSH112_01790"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            364958..365962
                     /locus_tag="HPSH112_01795"
                     /db_xref="GeneID:12773128"
     CDS             364958..365962
                     /locus_tag="HPSH112_01795"
                     /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
                     transport systems, permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide permease"
                     /protein_id="YP_006227073.1"
                     /db_xref="GI:386753855"
                     /db_xref="GeneID:12773128"
                     /translation="MLSFIIKRVLWAIPTLFGVSIIVFMMVHLVPGDPALVILGEKAN
                     QAAIDALREQFGLNKPLIEQYFFFINNVLHGNFGTSIMTGEPVMHEFLQRFPATVELA
                     LIALFMALVLGISVGVLAAIKRYSVFDYSSMTFALAGISMPVFWLGLMLIYIFSVQLG
                     WLPVFGRLSDVYYLDGPTGFYLIDSLIARDYGAFVDTIKHLILPSIVLATVSTAVIAR
                     MTRASMAEVSKEDYVRTAKAKGCSSFRVIFVHTLRNALIPVTTIAGLMLAGLLGGSMI
                     TETVFSWPGIGKWIVNALNQRDFPIIQSMSLIIAMMYIGANLLVDILYAFIDPRIRLS
                     "
     misc_feature    364958..365959
                     /locus_tag="HPSH112_01795"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    365240..365923
                     /locus_tag="HPSH112_01795"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(365288..365293,365300..365305,365318..365320,
                     365351..365362,365366..365395,365402..365407,
                     365411..365413,365588..365593,365597..365599,
                     365603..365605,365612..365617,365621..365623,
                     365633..365638,365645..365647,365696..365698,
                     365738..365743,365750..365752,365771..365782,
                     365789..365794,365840..365845,365873..365878,
                     365885..365890,365894..365899,365906..365911,
                     365918..365923)
                     /locus_tag="HPSH112_01795"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(365369..365413,365771..365788)
                     /locus_tag="HPSH112_01795"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(365411..365413,365573..365575,365789..365791,
                     365834..365836,365843..365845,365873..365875)
                     /locus_tag="HPSH112_01795"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(365648..365686,365702..365707,365717..365719)
                     /locus_tag="HPSH112_01795"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            365962..366819
                     /locus_tag="HPSH112_01800"
                     /db_xref="GeneID:12773129"
     CDS             365962..366819
                     /locus_tag="HPSH112_01800"
                     /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
                     transport systems, permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide permease"
                     /protein_id="YP_006227074.1"
                     /db_xref="GI:386753856"
                     /db_xref="GeneID:12773129"
                     /translation="MESFREFIQQFKKNKAAVVGAWIVLLLVVCAIFAPLLAPHDPYA
                     QNAQDRLLKPIWEHGGNIKYLLGTDDLGRDILSRLIYGARISLTIGIVSMGIAVFFGT
                     ILGLIAGYFGGKTDAVIMRIMDIMFALPSILLIVIVVAVLGPSLTNAMLAIGFVGIPG
                     FARLVRSSVLGEKEKEYVIASKINGSSHLRLMCKVIFPNCIIPLIVQTTMGFASTVLE
                     AAALSFLGLGAQPPKPEWGAMLMNSMQYIATAPWMLVFPGVMIFLTVMSFNLVGDGIM
                     DALDPKRAS"
     misc_feature    365962..366810
                     /locus_tag="HPSH112_01800"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    365971..366123
                     /locus_tag="HPSH112_01800"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    366208..366756
                     /locus_tag="HPSH112_01800"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(366256..366261,366268..366273,366286..366288,
                     366316..366327,366331..366360,366367..366372,
                     366376..366378,366427..366432,366436..366438,
                     366442..366444,366451..366456,366460..366462,
                     366472..366477,366484..366486,366535..366537,
                     366577..366582,366589..366591,366610..366621,
                     366628..366633,366673..366678,366706..366711,
                     366718..366723,366727..366732,366739..366744,
                     366751..366756)
                     /locus_tag="HPSH112_01800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(366334..366378,366610..366627)
                     /locus_tag="HPSH112_01800"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(366376..366378,366412..366414,366628..366630,
                     366667..366669,366676..366678,366706..366708)
                     /locus_tag="HPSH112_01800"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(366487..366525,366541..366546,366556..366558)
                     /locus_tag="HPSH112_01800"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            366831..367694
                     /locus_tag="HPSH112_01805"
                     /db_xref="GeneID:12773130"
     CDS             366831..367694
                     /locus_tag="HPSH112_01805"
                     /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
                     transport system, ATPase component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter"
                     /protein_id="YP_006227075.1"
                     /db_xref="GI:386753857"
                     /db_xref="GeneID:12773130"
                     /translation="MILEVKNLKTYFFTDKGVNKAVDGVSFGLKKSQTLCIVGESGSG
                     KSITSLSILGLIEKPGQIVGGNIQFLGQDLLQLKEKQMQKEIRGKKIGMIFQEPMTSL
                     NPSYTVGFQINEVLKIHHPNLNKKERLERVVYELERVGIPHAGDKYHEYPFNLSGGQR
                     QRVMIAMAMVCEPEILIADEPTTALDVTIQAQILELMKELQQKKGTSILFITHDLGVV
                     AQIADEVVVMYKGHVVEQASAKELFADPRHPYTKALLSAIPKPGKEYRKKRLETVDEN
                     IDYLSFQKELR"
     misc_feature    366834..367541
                     /locus_tag="HPSH112_01805"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    366891..367601
                     /locus_tag="HPSH112_01805"
                     /note="nickel import ATP-binding protein NikD; Region:
                     nickel_nikD; TIGR02770"
                     /db_xref="CDD:131817"
     misc_feature    366945..366968
                     /locus_tag="HPSH112_01805"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(366954..366959,366963..366971,367116..367118,
                     367365..367370,367467..367469)
                     /locus_tag="HPSH112_01805"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    367107..367118
                     /locus_tag="HPSH112_01805"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    367293..367322
                     /locus_tag="HPSH112_01805"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    367353..367370
                     /locus_tag="HPSH112_01805"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    367377..367388
                     /locus_tag="HPSH112_01805"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    367455..367475
                     /locus_tag="HPSH112_01805"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    367524..>367631
                     /locus_tag="HPSH112_01805"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            367691..368497
                     /locus_tag="HPSH112_01810"
                     /db_xref="GeneID:12773131"
     CDS             367691..368497
                     /locus_tag="HPSH112_01810"
                     /note="COG4608 ABC-type oligopeptide transport system,
                     ATPase component"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transport system atp-binding protein"
                     /protein_id="YP_006227076.1"
                     /db_xref="GI:386753858"
                     /db_xref="GeneID:12773131"
                     /translation="MKLLEIKELKKSYAIDRGLFKPKRIIHALNGISFEVEQNEVLSI
                     VGESGCGKSTTAKILAGIERQDSGAIYFNGKRHLHFSKQDWFDYRKKVQMIFQDPYSS
                     LNPRWKVGEIIAEPLLLNSHFSKKEIKTKVLEIMQKVGLKLEWIDRYPHQFSGGQRQR
                     IGIARALILHPSVVICDEPVSALDVSIQAQVLNLLLDLQKEMGLTYIFISHDLGVVEH
                     ISDKIIVMNQGQIVETGDVDSVISAPKHPYTQKLLNAVPHLEKSMQRFAE"
     misc_feature    367691..368476
                     /locus_tag="HPSH112_01810"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    367697..368395
                     /locus_tag="HPSH112_01810"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    367826..367849
                     /locus_tag="HPSH112_01810"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(367835..367840,367844..367852,367979..367981,
                     368219..368224,368321..368323)
                     /locus_tag="HPSH112_01810"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    367970..367981
                     /locus_tag="HPSH112_01810"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    368147..368176
                     /locus_tag="HPSH112_01810"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    368207..368224
                     /locus_tag="HPSH112_01810"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    368231..368242
                     /locus_tag="HPSH112_01810"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    368309..368329
                     /locus_tag="HPSH112_01810"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    368384..>368476
                     /locus_tag="HPSH112_01810"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            368517..369599
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /db_xref="GeneID:12773132"
     CDS             368517..369599
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="COG0536 Predicted GTPase"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase CgtA"
                     /protein_id="YP_006227077.1"
                     /db_xref="GI:386753859"
                     /db_xref="GeneID:12773132"
                     /translation="MFVDSVEIIVASGKGGPGMVSFRREKFVIKGGPDGGDGGDGGDV
                     YFEVDNNTDTLASFRGTKHHKAKNGAPGGTRNCTGKKGEDKIIVVPPGTQVFVDDKLW
                     LDLVEPKKRVLALKGGKGGLGNAHFKSAIKQQPTYAQKGLEGVEKCVRLELKLIADIG
                     LVGFPNAGKSTLISTISNAKPKIANYEFTTLVPNLGVVSVDEKSEFLMADIPGIIEGA
                     SEGKGLGISFLKHIERTKVLAFVLDASRLDLGIKEQYQRLRLELEKFSPALANKPFGV
                     LLNKCDVVENIDEMAKDFCAFLNLEAQKLEAFGLEPYLGFLHPHLTSDFENNPNEKSA
                     LFVLPLSALSALNTHALKFVLLEALP"
     misc_feature    368517..369593
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="GTPase CgtA; Reviewed; Region: obgE; PRK12299"
                     /db_xref="CDD:237048"
     misc_feature    368520..368981
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="GTP1/OBG; Region: GTP1_OBG; pfam01018"
                     /db_xref="CDD:110047"
     misc_feature    368985..369593
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="Obg GTPase; Region: Obg; cd01898"
                     /db_xref="CDD:206685"
     misc_feature    369003..369026
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="G1 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(369012..369029,369351..369356,369360..369362,
                     369537..369542)
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206685"
     misc_feature    369048..369095
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206685"
     misc_feature    369084..369086
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="G2 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    369144..369155
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="G3 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    order(369153..369176,369183..369221)
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206685"
     misc_feature    369351..369362
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="G4 box; other site"
                     /db_xref="CDD:206685"
     misc_feature    369537..369545
                     /gene="obgE"
                     /locus_tag="HPSH112_01815"
                     /note="G5 box; other site"
                     /db_xref="CDD:206685"
     gene            369641..370636
                     /locus_tag="HPSH112_01820"
                     /db_xref="GeneID:12773133"
     CDS             369641..370636
                     /locus_tag="HPSH112_01820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227078.1"
                     /db_xref="GI:386753860"
                     /db_xref="GeneID:12773133"
                     /translation="MKRFVLFLLFMCVCVCVQAHAEQDYFFRDFKSTDLPQKLHLDKK
                     LSQTIQPCVQLNASKHYTSAGVREPDACTKSFKKSAIMSYDLALGYLVSKNKQYGLKA
                     IEILNAWAKELQSVDTYQSEDNINFYMPYMNMAYWFVKKAFPSPEYEDFIKRMHQYSQ
                     SALNTNHGAWGILFDVSSAIALDDHALLQNSANRWQEWVFKAIDENGVIPSAITRSDT
                     SDYHGGPTKGIKGIAYTNFALLALTISGELLFENGYDLWGSEAGKRLSVAYNKVATWI
                     LNPETFPYFQPNLIGVHNNAYFIILAKHYSSPSADELLKQGDLHEDGFRLKLRSL"
     misc_feature    369740..370486
                     /locus_tag="HPSH112_01820"
                     /note="Alginate lyase; Region: Alginate_lyase; pfam05426"
                     /db_xref="CDD:253191"
     gene            370885..371439
                     /locus_tag="HPSH112_01825"
                     /db_xref="GeneID:12773134"
     CDS             370885..371439
                     /locus_tag="HPSH112_01825"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227079.1"
                     /db_xref="GI:386753861"
                     /db_xref="GeneID:12773134"
                     /translation="MKKMVLVSVLLAGFLQAVNLDLSSAKLTWTAFKTKAKTPVNGSF
                     ESITYKLGKSQDSLKTLLEGASASMDSLKVNLGDDTKNKNVKEAFFALFKSTNIKVTF
                     RNVIEGDHEGSLTAYVRMNEKLVKVPMQYTVASDKLVVKGVLDLLNFGLKNELASLAK
                     RCESFHEGLTWSQVEIQFESMIKG"
     gene            371449..372741
                     /locus_tag="HPSH112_01830"
                     /db_xref="GeneID:12773135"
     CDS             371449..372741
                     /locus_tag="HPSH112_01830"
                     /EC_number="5.4.3.8"
                     /note="COG0001 Glutamate-1-semialdehyde aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde aminotransferase"
                     /protein_id="YP_006227080.1"
                     /db_xref="GI:386753862"
                     /db_xref="GeneID:12773135"
                     /translation="MELLHSINDFNEAKQVIAGGVNSPVRAFKSVKGTPPFILKGKGA
                     YLYDVDNNHYIDFVQSWGPLIFGHADEEIEENIINVLKKGTSFGAPTELETTLAKEII
                     SCYEGLDKVRLVNSGTEATMSAIRLARAYSQKDDLIKFEGCYHGHSDSLLVKAGSGCA
                     TFGSPSSLGVPNDFSKHTLVARYNDLNSTEECFKKGDVGCVIIEPIAGNMGLVPAQKE
                     FLLGLKALCEKYQAVLILDEVMSGFRASLSGSQEFYGVVPDLVTFGKVIGAGLPLACF
                     GGRAEIMDLLSPIGGVYQAGTLSGNPLAVCAGLSALYKIKRDKTLYTRLNALAVRLTQ
                     GLKKSAQNYNIALETLNRGSMFGFFFNENAVRDFDDALKSDTEMFAKFHQKMLFKGVY
                     LACSSFETGFICEPMTEEMIDLAVAKADESFDEIIKGV"
     misc_feature    371461..372726
                     /locus_tag="HPSH112_01830"
                     /note="glutamate-1-semialdehyde aminotransferase;
                     Provisional; Region: PRK00062"
                     /db_xref="CDD:234607"
     misc_feature    371476..372717
                     /locus_tag="HPSH112_01830"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(371794..371802,371878..371883,371887..371889,
                     372058..372060,372157..372159,372163..372168,
                     372241..372243)
                     /locus_tag="HPSH112_01830"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(371797..371802,371878..371883,372058..372060,
                     372157..372159,372166..372168,372241..372243)
                     /locus_tag="HPSH112_01830"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    372241..372243
                     /locus_tag="HPSH112_01830"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            372746..373003
                     /locus_tag="HPSH112_01835"
                     /db_xref="GeneID:12773136"
     CDS             372746..373003
                     /locus_tag="HPSH112_01835"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227081.1"
                     /db_xref="GI:386753863"
                     /db_xref="GeneID:12773136"
                     /translation="MKKPKYYKFIEGANYLSLGLSMVVAILMGVAIGYGLKKLTHISW
                     LFWLGVIWGVLASFLNVYKAYKNMQKDYEELAKDPKHTQNK"
     misc_feature    372782..372943
                     /locus_tag="HPSH112_01835"
                     /note="Putative F0F1-ATPase subunit (ATPase_gene1);
                     Region: ATPase_gene1; pfam09527"
                     /db_xref="CDD:255412"
     gene            373019..373423
                     /locus_tag="HPSH112_01840"
                     /db_xref="GeneID:12773137"
     CDS             373019..373423
                     /locus_tag="HPSH112_01840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227082.1"
                     /db_xref="GI:386753864"
                     /db_xref="GeneID:12773137"
                     /translation="MCQIKCLLILLSINIVSAIIIYFFQAFQGVLNFEGGFLGFFIVA
                     LSSYYGVKKRLDLRKQNSGEKEEKQKFQKFALGLEMSFNVWRLGGYGVLLGILGALLF
                     LHLFNGLIFLIGVFVSSLSSALLRFLNNNGKF"
     gene            373507..374391
                     /locus_tag="HPSH112_01845"
                     /db_xref="GeneID:12773138"
     CDS             373507..374391
                     /locus_tag="HPSH112_01845"
                     /note="COG0388 Predicted amidohydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227083.1"
                     /db_xref="GI:386753865"
                     /db_xref="GeneID:12773138"
                     /translation="MKTKNPAKRILKTATIQMQSKPYALNENLQLALNLAKEAHNKGA
                     NLIVLPELFDSGYCVNDKDAEFGIDLKAIEHRKETLKNESLRALSDFAKSNKVHLVAC
                     SIEKTDKKLYDSAYIIPPKGGIVGKHRKVYLWGDEKSRFKRGKKYEVFTLDFGDFSAK
                     VGLQICYEIGFGVGANLLALQGAEILIYPSAFGKARAYNWDLLSKARALENGCFVCAC
                     NHSGEETNAQLKQTLEFAGDSRIIAPNGKIIAQATRLNEAIIAEMDLNEAALQRQKIP
                     YLQDFDTKLTKKGFGKLT"
     misc_feature    373546..374352
                     /locus_tag="HPSH112_01845"
                     /note="Nitrilase superfamily, including nitrile- or
                     amide-hydrolyzing enzymes and amide-condensing enzymes;
                     Region: nitrilase; cd07197"
                     /db_xref="CDD:143587"
     misc_feature    order(373657..373659,373894..373896,373906..373908,
                     373915..373917,374002..374007,374011..374016,
                     374077..374079)
                     /locus_tag="HPSH112_01845"
                     /note="active site"
                     /db_xref="CDD:143587"
     misc_feature    order(373657..373659,373894..373896,374002..374004)
                     /locus_tag="HPSH112_01845"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143587"
     misc_feature    order(373897..373908,373912..373914,373933..373941,
                     374005..374007,374011..374025,374032..374037,
                     374110..374115,374119..374127,374131..374136,
                     374215..374220,374341..374352)
                     /locus_tag="HPSH112_01845"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143587"
     gene            374404..375285
                     /locus_tag="HPSH112_01850"
                     /db_xref="GeneID:12773139"
     CDS             374404..375285
                     /locus_tag="HPSH112_01850"
                     /note="COG0726 Predicted xylanase/chitin deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227084.1"
                     /db_xref="GI:386753866"
                     /db_xref="GeneID:12773139"
                     /translation="MAKEILVAYGVDIDAVAGWLGSYGGEDSPDDISRGLFAGEVGIP
                     RLLKLFKKYHLPATWFAPGHSIETFPEQMKMIVDAGHEVGAHGYSHENPIAMSTKQEE
                     DVLLKSIELIKDLTGKAPTGYVAPWWEFSNITNELLLKHGFKYDHSLMHNDFTPYFVR
                     VGDSWSKIDYSLEAKDWMKPLIRGVETDLVEIPANWYLDDLPPMMFIKKSPNSFGFVS
                     PRDIGQMWIDQFDWVYREMDYAVFSMTIHPDVSARPQVLLMHEKIIEHINKHEGVRWV
                     TFNEIADDFLKRSPRKK"
     misc_feature    374422..375261
                     /locus_tag="HPSH112_01850"
                     /note="Catalytic domain of Helicobacter pylori
                     peptidoglycan deacetylase (HpPgdA) and similar proteins;
                     Region: CE4_HpPgdA_like; cd10938"
                     /db_xref="CDD:200563"
     misc_feature    order(374437..374439,374443..374445,374659..374661,
                     374671..374673,375142..375144)
                     /locus_tag="HPSH112_01850"
                     /note="active site"
                     /db_xref="CDD:200563"
     misc_feature    order(374443..374445,375142..375144)
                     /locus_tag="HPSH112_01850"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200563"
     misc_feature    order(374443..374445,374659..374661,374671..374673)
                     /locus_tag="HPSH112_01850"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:200563"
     misc_feature    order(374461..374466,374488..374493,374497..374505,
                     374509..374514,374524..374526,374536..374538,
                     374593..374595,374602..374610,374665..374670,
                     374674..374679,374686..374691,374698..374703,
                     374710..374715,374722..374724,374782..374787,
                     374791..374793,374845..374865,374986..374994,
                     375007..375015,375019..375027,375073..375078,
                     375085..375090,375097..375099,375160..375168,
                     375172..375177,375184..375186)
                     /locus_tag="HPSH112_01850"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:200563"
     misc_feature    <374527..375258
                     /locus_tag="HPSH112_01850"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     gene            complement(375636..376031)
                     /locus_tag="HPSH112_01855"
                     /db_xref="GeneID:12773140"
     CDS             complement(375636..376031)
                     /locus_tag="HPSH112_01855"
                     /note="COG5013 Nitrate reductase alpha subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="type II restriction enzyme"
                     /protein_id="YP_006227085.1"
                     /db_xref="GI:386753867"
                     /db_xref="GeneID:12773140"
                     /translation="MSSIEDIIQVYGSVVKDIDKDAQGQDSRAYGGVIRSAKGKLLED
                     ISEAIVKIAWQNIGAKANRLEINSKKIKIPIKDSYIENIANKQVRAYILERKKDYYYG
                     LSVDKHIFVDNQLVMGIECKNYTENAMLK"
     gene            complement(376042..377151)
                     /locus_tag="HPSH112_01860"
                     /db_xref="GeneID:12773141"
     CDS             complement(376042..377151)
                     /locus_tag="HPSH112_01860"
                     /note="COG0863 DNA modification methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="YP_006227086.1"
                     /db_xref="GI:386753868"
                     /db_xref="GeneID:12773141"
                     /translation="MQDYRTLTLENIYAPDEITDALSLLQSCGIESIVNPSNITLNFD
                     IVDLKMLESTTQNTLVQKTLEELYKIRSFSSQNGKIVFKSFNKAKKVANKKQNAKARL
                     AYESYKKEFSKETNEIQSCLNQIYCEDSLEFLKKLPNNCIDIVLTSPPYNFGINYSAT
                     QDANLWHEYFNTLFAIFKECIRVLKSGGRIIVNIQPMFSDYIPTHHFISKFFIDEGLI
                     WKGEILWEKNNYNCKYCTWGSWKSPAAPYLKYSWEFIEIFCKNNLKKEGDKDSIDITD
                     DEFKKWVYGKWNFAPERNMKQYGHDAMFPEELVKRCLKLFSYQNDIILDPFNGAGTTT
                     KVAKQLGRRFIGIDISEKYCEVARARLKEVTNLFN"
     misc_feature    complement(376081..376728)
                     /locus_tag="HPSH112_01860"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            377247..377603
                     /locus_tag="HPSH112_01865"
                     /db_xref="GeneID:12773142"
     CDS             377247..377603
                     /locus_tag="HPSH112_01865"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227087.1"
                     /db_xref="GI:386753869"
                     /db_xref="GeneID:12773142"
                     /translation="MCVLCGELISSFHWTDSYENENLKGQNALISANENARERKRARI
                     KRVGLLNQILAFYGLKMDDWQGAKFVLCDKKGQSVIVNDLGDLWDKAQNLAKKEMDAL
                     DSHLLAFLNQNTNAIH"
     gene            377603..378568
                     /locus_tag="HPSH112_01870"
                     /db_xref="GeneID:12773143"
     CDS             377603..378568
                     /locus_tag="HPSH112_01870"
                     /note="COG0523 Putative GTPases (G3E family)"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_006227088.1"
                     /db_xref="GI:386753870"
                     /db_xref="GeneID:12773143"
                     /translation="MPKIPITLITGFLGSGKTSFLSEYLNQTDHQGVVLIINEIGQAA
                     LDQRILNIQYCGEKMLYLNAGCVCCNKRMDLVESLKATLNNYEWRGEILKRIIIETTG
                     LANPVPILWTILSDTFLGAHFEIQSVVVCVDALNARMHLTNNEAKEQIVFADSVLLTK
                     TDLQNDSVALIKLKERLQSINPSAEIFDKKNIHYESFFSRKNRVRNFMPRMPKDSHSQ
                     GFETLSINFEGAMEWSAFGIWLSLLLHKYGTQILRIKGIIDTGSGFLVSINGVMHIIY
                     PPKHILKDQNGSNLVFIMRHLEREKILNSLKGFKDFLGIKGFETQ"
     misc_feature    377612..378547
                     /locus_tag="HPSH112_01870"
                     /note="Putative GTPases (G3E family) [General function
                     prediction only]; Region: COG0523"
                     /db_xref="CDD:223597"
     misc_feature    377615..378166
                     /locus_tag="HPSH112_01870"
                     /note="CobW/HypB/UreG, nucleotide-binding domain; Region:
                     cobW; pfam02492"
                     /db_xref="CDD:251330"
     misc_feature    378260..378529
                     /locus_tag="HPSH112_01870"
                     /note="Cobalamin synthesis protein cobW C-terminal domain;
                     Region: CobW_C; pfam07683"
                     /db_xref="CDD:254355"
     gene            complement(378574..379719)
                     /locus_tag="HPSH112_01875"
                     /db_xref="GeneID:12773144"
     CDS             complement(378574..379719)
                     /locus_tag="HPSH112_01875"
                     /note="COG0477 Permeases of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrite extrusion protein NarK"
                     /protein_id="YP_006227089.1"
                     /db_xref="GI:386753871"
                     /db_xref="GeneID:12773144"
                     /translation="MRVFVCFLGVFVSNGLARFGYVVLIPLLILSGSLTPHQSFQLGI
                     AVLMGYVFGSFLIQFLSPLMSLESIAKISFGLIALSFLICYFDSIPFFWLWIWRFIAG
                     VASSALMILVAPLSLPYVKENKRALVGGLIFSAVGVGSVFSGFVLPWISSYNIKWAWI
                     FLGGSCLIAFILSLIGLKNHSLRKKSVKKEESAFKIPFHLWLLLISCALNAIGFLPHT
                     LFWVDYLIRHLNISPAIAGTSWAFFGFGATLGSLISGPMAQKLGAKNANIFILILKSI
                     ACFLPIFFHQISLLNLSIFIMGAATTANINLFSMMALKIAGAKHFAKASSWVVFSFGI
                     FQALFSYLFTIFLGDLGYLLIFVICGACLVLSFIVLFPIKMQTAINQ"
     misc_feature    complement(378607..379710)
                     /locus_tag="HPSH112_01875"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(378700..379701)
                     /locus_tag="HPSH112_01875"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(378712..378714,378721..378726,
                     378733..378738,378745..378750,378781..378783,
                     378790..378795,378805..378807,378814..378819,
                     378826..378828,378967..378969,378979..378981,
                     378988..378990,379000..379002,379012..379014,
                     379054..379056,379063..379068,379075..379080,
                     379087..379089,379300..379302,379318..379323,
                     379330..379335,379369..379371,379378..379383,
                     379390..379395,379402..379407,379546..379551,
                     379555..379560,379570..379572,379579..379584,
                     379591..379593,379642..379647,379651..379659,
                     379666..379668))
                     /locus_tag="HPSH112_01875"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(380216..380971)
                     /locus_tag="HPSH112_01880"
                     /db_xref="GeneID:12773145"
     CDS             complement(380216..380971)
                     /locus_tag="HPSH112_01880"
                     /note="COG0748 Putative heme iron utilization protein"
                     /codon_start=1
                     /transl_table=11
                     /product="putative heme iron utilization protein"
                     /protein_id="YP_006227090.1"
                     /db_xref="GI:386753872"
                     /db_xref="GeneID:12773145"
                     /translation="MLNRIIEHMNAHHVEDMKGLLKKFGQVHHAENVAFKSVDSQGVV
                     IGYNNNQTLRIEFNHEVKDPKDYKNAIIELCQSVEKTHDLKGVEEEVKAFKEGFDSVC
                     LATLHPNGHVVCSYAPLMTDGKQYYIYVSEVAEHFAGLKHNPHNVEVMFLEDESKAKS
                     AILRKRLRYKTNARFIERGAEFDKAFDSFIEKTGGAGGIKTIRTMQDFHLIALDFKEG
                     RFVKGFGQAYDILGDEIAYVGGKGNPHDFAHKK"
     misc_feature    complement(380237..380962)
                     /locus_tag="HPSH112_01880"
                     /note="heme oxygenase, HugZ family; Region: heme_ox_HugZ;
                     TIGR04109"
                     /db_xref="CDD:200360"
     misc_feature    complement(380750..380962)
                     /locus_tag="HPSH112_01880"
                     /note="Protein of unknown function (DUF2470); Region:
                     DUF2470; pfam10615"
                     /db_xref="CDD:256092"
     misc_feature    complement(380267..380704)
                     /locus_tag="HPSH112_01880"
                     /note="Pyridoxine 5'-phosphate (PNP) oxidase-like
                     proteins; Region: PNPOx_like; cl00381"
                     /db_xref="CDD:260394"
     gene            complement(381032..382657)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /db_xref="GeneID:12773146"
     CDS             complement(381032..382657)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /EC_number="6.1.1.19"
                     /note="COG0018 Arginyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="YP_006227091.1"
                     /db_xref="GI:386753873"
                     /db_xref="GeneID:12773146"
                     /translation="MHTLIKGVLEEILEEEVIIEYPKDREHGHYATPIAFNLAKVFKK
                     SPLVIAEELALKISTHEKTQGLFDSVVACKGYINFTLSLDFLERFTQKALELKEKFGS
                     QPKSERSQKIFLEFVSANPTGPLHIGHARGAVFGDSLAKIARFLGHEVLCEYYVNDMG
                     SQIRLLGLSVWLAYREHVLKESVTYPEVFYKGEYIIEIAKKANNDLEPSLFKENEETI
                     IEVLSGYAKDLMLLEIKDNLDALGIHFDSYASEREIFKHKDAVFERLEKANALYEKDS
                     KIWLKSSLYQDESDRVLIKEDKSYTYLAGDIVYHDEKFKQNYTKYINIWGADHHGYIA
                     RVKASLEFLGYDSNKLEVLLAQMVRLLKDNEPYKMSKRAGNFILIKDVIDDVGKDALR
                     FIFLSKRLDTHLEFDVNTLKKQDSSNPIYYIHYANSRIHTMLEKSPFSKEEILQTPLT
                     NLNAEEKYLLFSALSLPKIIESSFEEYGLQKMCEYAKTLASEFHRFYNAGKILDTPKA
                     KELLKICLMVSLSLSNAFKLLGIEIKTKISAKD"
     misc_feature    complement(382415..>382597)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="Arginyl tRNA synthetase N terminal domain; Region:
                     Arg_tRNA_synt_N; pfam03485"
                     /db_xref="CDD:251994"
     misc_feature    complement(381047..382594)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="arginyl-tRNA synthetase; Region: argS; TIGR00456"
                     /db_xref="CDD:232981"
     misc_feature    complement(381536..382327)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="catalytic core domain of arginyl-tRNA synthetases;
                     Region: ArgRS_core; cd00671"
                     /db_xref="CDD:185675"
     misc_feature    complement(order(381662..381664,381671..381673,
                     381740..381742,381752..381754,382271..382273,
                     382280..382282,382298..382300,382304..382306,
                     382313..382315))
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="active site"
                     /db_xref="CDD:185675"
     misc_feature    complement(382271..382282)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:185675"
     misc_feature    complement(381542..381553)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="KMSK motif region; other site"
                     /db_xref="CDD:185675"
     misc_feature    complement(381062..381508)
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="Anticodon-binding domain of class Ia aminoacyl tRNA
                     synthetases and similar domains; Region:
                     Anticodon_Ia_like; cl12020"
                     /db_xref="CDD:264512"
     misc_feature    complement(order(381167..381169,381176..381178,
                     381185..381187,381206..381208,381359..381364,
                     381368..381373,381383..381385,381410..381412,
                     381419..381421,381431..381433))
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153408"
     misc_feature    complement(order(381167..381169,381359..381364,
                     381371..381376,381383..381385))
                     /gene="argS"
                     /locus_tag="HPSH112_01885"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:153408"
     gene            complement(382660..382899)
                     /locus_tag="HPSH112_01890"
                     /db_xref="GeneID:12773147"
     CDS             complement(382660..382899)
                     /locus_tag="HPSH112_01890"
                     /note="COG1826 Sec-independent protein secretion pathway
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase protein
                     tatA/E-like protein"
                     /protein_id="YP_006227092.1"
                     /db_xref="GI:386753874"
                     /db_xref="GeneID:12773147"
                     /translation="MGGFTSIWHWVIVLLVIVLLFGAKKIPELAKGLGSGIKNFKKAV
                     KDDEEEAKNEPKTLDAQAAQTKVHETSEIKSKQES"
     misc_feature    complement(382672..382899)
                     /locus_tag="HPSH112_01890"
                     /note="mttA/Hcf106 family; Region: MttA_Hcf106; cl00788"
                     /db_xref="CDD:260623"
     gene            complement(382969..383589)
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /db_xref="GeneID:12773148"
     CDS             complement(382969..383589)
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /EC_number="2.7.4.8"
                     /note="COG0194 Guanylate kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_006227093.1"
                     /db_xref="GI:386753875"
                     /db_xref="GeneID:12773148"
                     /translation="MHNDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLSTTTRKPR
                     EGEVDGLHYNFVSEEEFKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDI
                     DVQGHEILKRHYPNACSVFISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLE
                     SFDYLIINEDLEKSKEIILSIAKTLVHRLKAFNFEKICKAWKNESL"
     misc_feature    complement(383050..383574)
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /note="Guanylate kinase; Region: Guanylate_kin; pfam00625"
                     /db_xref="CDD:250008"
     misc_feature    complement(383071..383571)
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /note="Guanosine monophosphate kinase (GMPK, EC 2.7.4.8),
                     also known as guanylate kinase (GKase), catalyzes the
                     reversible phosphoryl transfer from adenosine triphosphate
                     (ATP) to guanosine monophosphate (GMP) to yield adenosine
                     diphosphate (ADP) and guanosine...; Region: GMPK; cd00071"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(383347..383349,383362..383364,
                     383431..383433,383458..383460,383467..383469,
                     383488..383490,383536..383538,383554..383556))
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(383536..383538,383554..383556))
                     /gene="gmk"
                     /locus_tag="HPSH112_01895"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            complement(383582..385258)
                     /locus_tag="HPSH112_01900"
                     /db_xref="GeneID:12773149"
     CDS             complement(383582..385258)
                     /locus_tag="HPSH112_01900"
                     /codon_start=1
                     /transl_table=11
                     /product="poly E-rich protein"
                     /protein_id="YP_006227094.1"
                     /db_xref="GI:386753876"
                     /db_xref="GeneID:12773149"
                     /translation="MKMILFNQNPMITKLLESVSKKLELSMEDFNRYQELSTRLKEDP
                     EWILIADDECLEKLDQVDWLELKEIISQNKNSVCMYKKGHEAQPFLEGFEMKIKKPFL
                     PTEILKILQKKLGSNMSELEPSQNLDPTQEVLETNWDELENLGDLKALVQEEPNNEEQ
                     LLPTLNAQEEKEEVKEEVKETPQEEEKEEVKETPQEEEKEEVKETPQEEEKPKDDEIQ
                     EGETLKDKEVSKELETQEELEIPKEETQEQAKEQESIKEETQEQAKEQESIKEETQEQ
                     AKEQEPIKEETQEIKEEKQEKTQDSPSAQELEAMQELVKEIQENSNSQEDKKEAQESA
                     ETPQETPQENTETPQETEKQELETPKEEAQENAETPQETPQENTETPQETPQELETPQ
                     ELETPQELETPQELETPQENAETPQETEKQELETPQEEKQELETPQESTETPQKETQE
                     LETQEDHYESIEDIPEPVMAQAMGEALPFLSESVAKTSNNENDTETPKESVIKTPQEK
                     EGSDKTSNPLELRLNLQDLLKSLNQESLKNLLENKTLSIKITLEDKKPDA"
     misc_feature    complement(383966..384598)
                     /locus_tag="HPSH112_01900"
                     /note="Brain acid soluble protein 1 (BASP1 protein);
                     Region: BASP1; pfam05466"
                     /db_xref="CDD:253207"
     misc_feature    complement(383888..>384241)
                     /locus_tag="HPSH112_01900"
                     /note="Domain of unknown function (DUF4628); Region:
                     DUF4628; pfam15429"
                     /db_xref="CDD:259560"
     gene            complement(385271..385396)
                     /locus_tag="HPSH112_01905"
                     /db_xref="GeneID:12773150"
     CDS             complement(385271..385396)
                     /locus_tag="HPSH112_01905"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227095.1"
                     /db_xref="GI:386753877"
                     /db_xref="GeneID:12773150"
                     /translation="MILILNYTHDKNNQPSGFLIIIKDLKKAIKIDRLKEAFLIK"
     gene            385400..385942
                     /locus_tag="HPSH112_01910"
                     /db_xref="GeneID:12773151"
     CDS             385400..385942
                     /locus_tag="HPSH112_01910"
                     /note="COG1502
                     Phosphatidylserine/phosphatidylglycerophosphate/cardiolipi
                     n synthases and related enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease NucT"
                     /protein_id="YP_006227096.1"
                     /db_xref="GI:386753878"
                     /db_xref="GeneID:12773151"
                     /translation="MLNKFKKIVGAGVLVGCLGVLQAKNSLFVLPYEQKDALNSLVSG
                     ISSARESVKIAIYSFTHRDIARAIKSVASRGIKVQIIYDYESNHNNKQSTIGYLDKYP
                     NTKVCLLKGLKAKNGNYYGIMHQKVAIIDDKIVFLGSANWSKNAFENNYEVLLKTDDT
                     ETILKAKSYYQKMLGSCVGF"
     misc_feature    385409..385939
                     /locus_tag="HPSH112_01910"
                     /note="nuclease NucT; Provisional; Region: PRK13912"
                     /db_xref="CDD:184389"
     misc_feature    385481..385918
                     /locus_tag="HPSH112_01910"
                     /note="Catalytic domain of EDTA-resistant nuclease Nuc,
                     vertebrate phospholipase D6, and similar proteins; Region:
                     PLDc_Nuc_like; cd09116"
                     /db_xref="CDD:197215"
     misc_feature    order(385769..385771,385775..385777,385814..385816,
                     385820..385822,385853..385855)
                     /locus_tag="HPSH112_01910"
                     /note="putative active site [active]"
                     /db_xref="CDD:197215"
     misc_feature    385769..385771
                     /locus_tag="HPSH112_01910"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197215"
     gene            complement(385950..386687)
                     /locus_tag="HPSH112_01915"
                     /db_xref="GeneID:12773152"
     CDS             complement(385950..386687)
                     /locus_tag="HPSH112_01915"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein HorC"
                     /protein_id="YP_006227097.1"
                     /db_xref="GI:386753879"
                     /db_xref="GeneID:12773152"
                     /translation="MRTLLKMLVGASLLAHALIAKEESAAPSWTKNLYMGVNYQTGSI
                     NLMTNIHEVREITNYQTGYTNIITSVNSVKKLTNMGSNGIGLVMGYNHFFHPDKILGL
                     RYFAFLDWQGYGMRYPKGYYGGNNMITYGVGVDAVWNFFQGSFYQDDIGVDIGVFGGI
                     AIAGNSWYIGSKGKELLGITNSRAVDNTSFQFLFNFGLKALFVDEHEFEIGFKFPTIN
                     NKYYTTDALKVQMRRVFAFYVGYNYHF"
     misc_feature    complement(385953..386435)
                     /locus_tag="HPSH112_01915"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            386817..387530
                     /gene="flgH"
                     /locus_tag="HPSH112_01920"
                     /db_xref="GeneID:12773153"
     CDS             386817..387530
                     /gene="flgH"
                     /locus_tag="HPSH112_01920"
                     /note="COG2063 Flagellar basal body L-ring protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body L-ring protein"
                     /protein_id="YP_006227098.1"
                     /db_xref="GI:386753880"
                     /db_xref="GeneID:12773153"
                     /translation="MKKALYLGAVAFSVAFSMASANEPKIDFNPPNYVEETPSKEFIP
                     ELNKLGSLFGQGERPLFADRRAMKPNDLITIIVSEKASANYSSSKDYKSASGGNSTPP
                     RLTYNGLDERKKQEAQYLDDKNNYNFTKSSNNTNFKGGGSQKKSEDLEIVLSARIIKV
                     LENGNYFIYGNKEVLVDGEKQILKVSGVIRPYDIERNNTIQSKFLADAKIEYTNLGHL
                     SDSNKKKFAADAMETQMPY"
     misc_feature    386874..387527
                     /gene="flgH"
                     /locus_tag="HPSH112_01920"
                     /note="flagellar basal body L-ring protein; Reviewed;
                     Region: flgH; PRK00249"
                     /db_xref="CDD:234700"
     gene            387548..388231
                     /locus_tag="HPSH112_01925"
                     /db_xref="GeneID:12773154"
     CDS             387548..388231
                     /locus_tag="HPSH112_01925"
                     /note="COG1083 CMP-N-acetylneuraminic acid synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="CMP-N-acetylneuraminic acid synthetase"
                     /protein_id="YP_006227099.1"
                     /db_xref="GI:386753881"
                     /db_xref="GeneID:12773154"
                     /translation="MRAIAIVLARSSSKRIKNKNIIDFFNKPMLAYPIEAALNSKLFE
                     KVFISSDSMEYVHLAKNYGASFLNLRPKVLADDRATTLEVMAYHMKELELKDEDIACC
                     LYGTSALLQEKHLKNAFEILKGNTDYVFTCSPFSASPYRSFSLENGVQMAFKEHLNTR
                     TQDLKTLYHDAGLLYMGKAQAFKEMRPIFSQNSIALELSPLEVQDIDTLEDLELAKLK
                     YSRLKNACQ"
     misc_feature    387551..388192
                     /locus_tag="HPSH112_01925"
                     /note="CMP-NeuAc_Synthase activates N-acetylneuraminic
                     acid by adding CMP moiety; Region: CMP-NeuAc_Synthase;
                     cd02513"
                     /db_xref="CDD:133006"
     misc_feature    order(387569..387577,387587..387589,387605..387607,
                     387755..387757,387767..387769,387788..387790,
                     387857..387859,387863..387865,388055..388057,
                     388070..388072,388166..388168)
                     /locus_tag="HPSH112_01925"
                     /note="ligand binding site; other site"
                     /db_xref="CDD:133006"
     misc_feature    order(387614..387616,387620..387625,387935..387937,
                     387947..387952,388046..388057,388070..388072,
                     388124..388126,388130..388132,388166..388168,
                     388175..388180,388187..388189)
                     /locus_tag="HPSH112_01925"
                     /note="tetramer interface; other site"
                     /db_xref="CDD:133006"
     gene            388222..389094
                     /locus_tag="HPSH112_01930"
                     /db_xref="GeneID:12773155"
     CDS             388222..389094
                     /locus_tag="HPSH112_01930"
                     /note="COG3980 Spore coat polysaccharide biosynthesis
                     protein, predicted glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="CMP-N-acetylneuraminic acid synthetase NeuA"
                     /protein_id="YP_006227100.1"
                     /db_xref="GI:386753882"
                     /db_xref="GeneID:12773155"
                     /translation="MPVKILCDCFLTSGLGHVRRCEKILSFIEKLGVKADLYLYKHNN
                     ISAFLEGVGNDDFLIIDSYCLNSKDFYLLKEKAKSLMVIEDKEHVKGFYPKNTKIMNF
                     TLNALKHYHYLSKDYQYYLGVGFYPVDIRFVYERPINTENKEVLITLGGSEQKTLKEI
                     VKILENKGMHLHIISPHIPKNPPKNTHYYSPLSPLEFSSLMKFCACAISAAGQTLYEL
                     ALSQTPSLIIPIASNQIIQSQEFESLGIFKQTSLKTLAKDFEKLQIQKNQAWAKNLAF
                     GSELEGALREFLEI"
     misc_feature    388222..389091
                     /locus_tag="HPSH112_01930"
                     /note="Spore coat polysaccharide biosynthesis protein,
                     predicted glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: spsG; COG3980"
                     /db_xref="CDD:226488"
     gene            389091..389633
                     /locus_tag="HPSH112_01935"
                     /db_xref="GeneID:12773156"
     CDS             389091..389633
                     /locus_tag="HPSH112_01935"
                     /note="COG1670 Acetyltransferases, including N-acetylases
                     of ribosomal proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein G"
                     /protein_id="YP_006227101.1"
                     /db_xref="GI:386753883"
                     /db_xref="GeneID:12773156"
                     /translation="MKKNYCYKNIQAIDFAHLNDEEKLLVLEFRNHPNTALWMYSAFI
                     SLKTHLQFIEDLKNSPNHRYFLFKEEGVYLGVGSITKINFFHKHGYLGIYKNPFLKNR
                     GETILKALERIAFEEFQLNSLHLEVMENNFKAIAFYEKNHYELEGRLKGFVSKEKEFI
                     DVLLYYKDKKGYNDRSVLKL"
     misc_feature    389127..389588
                     /locus_tag="HPSH112_01935"
                     /note="pseudaminic acid biosynthesis N-acetyl transferase;
                     Region: PseH; TIGR03585"
                     /db_xref="CDD:132624"
     misc_feature    389139..389621
                     /locus_tag="HPSH112_01935"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     gene            complement(389566..390504)
                     /gene="lpxK"
                     /locus_tag="HPSH112_01940"
                     /db_xref="GeneID:12771551"
     CDS             complement(389566..390504)
                     /gene="lpxK"
                     /locus_tag="HPSH112_01940"
                     /EC_number="2.7.1.130"
                     /note="COG1663 Tetraacyldisaccharide-1-P 4'-kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="tetraacyldisaccharide 4'-kinase"
                     /protein_id="YP_006227102.1"
                     /db_xref="GI:386753884"
                     /db_xref="GeneID:12771551"
                     /translation="MKSDKPFLERYFYDPTLLQKGLIFALYPFSLIYQGIATLKRKTA
                     KKHDFKIPIISVGNLIAGGSGKTPFILETAPRYQEVAVISRGYQRDSKGLVVVSVKGN
                     ILVSQQTAGDEAYLLALNLKQASVIVSEKRELGVLKALELGAKIVFLDDGFRFNFNQF
                     NLLLKPKVPPYYPFCLPSGLYRESIKSYKEAHLVITEDKDYKRITSISHPTKRMLLAT
                     AIANPSRLDAFLPKEVVKKLYFRDHAPFDLKLLEKEFYQNNATSLLVTSKDLVKLQDC
                     NLPLSVLDLKLEICPKVLEQIDRYILSYPCNTKEHL"
     misc_feature    complement(389569..390495)
                     /gene="lpxK"
                     /locus_tag="HPSH112_01940"
                     /note="Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope
                     biogenesis, outer membrane]; Region: LpxK; COG1663"
                     /db_xref="CDD:224577"
     gene            complement(390501..391283)
                     /locus_tag="HPSH112_01945"
                     /db_xref="GeneID:12771552"
     CDS             complement(390501..391283)
                     /locus_tag="HPSH112_01945"
                     /EC_number="6.3.1.5"
                     /note="COG0171 NAD synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD synthetase"
                     /protein_id="YP_006227103.1"
                     /db_xref="GI:386753885"
                     /db_xref="GeneID:12771552"
                     /translation="MQKDHQKLIAYLCDFLEKEAQKRGFKKVVYGLSGGLDSAVVGVL
                     CQKVFKKNAHALLMPSLVSMPESKTDALDLCETFSIPYTEYSIAPYDAIFDSHFKDAS
                     LTRKGNFCARLRMAFLYDYSLKSDSLVIGTSNKSERMLGYGTLFGDLACAINPIGELF
                     KTEVYELACHLNIPKKILNKPPSADLFVGQSDEKDLGYPYSVIDPLLKDIEALFQNKP
                     IDAETLTQLGYDEILVKNIMSRIQKNSFKLELPTIAKRFNPK"
     misc_feature    complement(390543..391268)
                     /locus_tag="HPSH112_01945"
                     /note="NAD+ synthase is a homodimer, which catalyzes the
                     final step in de novo nicotinamide adenine dinucleotide
                     (NAD+) biosynthesis, an amide transfer from either ammonia
                     or glutamine to nicotinic acid adenine dinucleotide
                     (NaAD). The conversion of NaAD to NAD...; Region:
                     NAD_synthase; cd00553"
                     /db_xref="CDD:238309"
     misc_feature    complement(order(390546..390548,390810..390815,
                     390822..390839,390846..390851,390912..390917,
                     390921..390929,390933..390941,390945..390950,
                     390957..390959,390969..390971,391008..391013,
                     391020..391025,391032..391043,391227..391232,
                     391239..391241,391248..391253))
                     /locus_tag="HPSH112_01945"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238309"
     misc_feature    complement(order(390543..390548,390699..390701,
                     390726..390728,390732..390737,390840..390842,
                     390849..390860,390873..390875,390888..390890,
                     390942..390944,390948..390953,390960..390962,
                     390972..390974,391110..391118,391170..391172,
                     391185..391196))
                     /locus_tag="HPSH112_01945"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    complement(order(390735..390740,390801..390803,
                     390888..390890,390942..390944,391110..391115,
                     391170..391175,391185..391193))
                     /locus_tag="HPSH112_01945"
                     /note="ATP binding pocket [chemical binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    complement(order(390735..390737,390873..390875,
                     391173..391175,391185..391187))
                     /locus_tag="HPSH112_01945"
                     /note="Mg binding site [ion binding]; other site"
                     /db_xref="CDD:238309"
     misc_feature    complement(order(390696..390719,390726..390749,
                     391089..391091))
                     /locus_tag="HPSH112_01945"
                     /note="active-site loop [active]"
                     /db_xref="CDD:238309"
     gene            391368..391444
                     /locus_tag="HPSH112_t08200"
                     /db_xref="GeneID:12771553"
     tRNA            391368..391444
                     /locus_tag="HPSH112_t08200"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:12771553"
     gene            391530..392522
                     /locus_tag="HPSH112_01950"
                     /db_xref="GeneID:12771554"
     CDS             391530..392522
                     /locus_tag="HPSH112_01950"
                     /EC_number="1.1.1.86"
                     /note="COG0059 Ketol-acid reductoisomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="ketol-acid reductoisomerase"
                     /protein_id="YP_006227104.1"
                     /db_xref="GI:386753886"
                     /db_xref="GeneID:12771554"
                     /translation="MALPVYYDKDIDLGVIQSLQVGIIGYGAQGEAQALNLRDSKVRV
                     RIGLYQGSLSASKAKAEGFEVLEVKELVQQSDVIMALLPDELHKEVLEKEVIPFLKEG
                     QIVGFAHGFSVHFNQVVLPKGVGAILVAPKGPGSALREEYLKNRGLYHLIAIEQESSK
                     NNAKAVALSYAKAMGGGRMGVLETSFKEECESDLFGEQAVLCGGLEAIVRTGFETLIR
                     AGYPEELAYFECVHEVKLVADLLHYKGVEGLRKHISNTAEFGAIKNREPMGNLLEKRM
                     QKILKKIQNGSFAKDFLLEKSLNYPRLNTERKALKETKIEQIGEILRAPFNHKK"
     misc_feature    391542..392519
                     /locus_tag="HPSH112_01950"
                     /note="ketol-acid reductoisomerase; Provisional; Region:
                     PRK05479"
                     /db_xref="CDD:235491"
     misc_feature    391572..392069
                     /locus_tag="HPSH112_01950"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvN; pfam07991"
                     /db_xref="CDD:116601"
     misc_feature    392085..392519
                     /locus_tag="HPSH112_01950"
                     /note="Acetohydroxy acid isomeroreductase, catalytic
                     domain; Region: IlvC; pfam01450"
                     /db_xref="CDD:250630"
     gene            392541..393347
                     /locus_tag="HPSH112_01955"
                     /db_xref="GeneID:12771555"
     CDS             392541..393347
                     /locus_tag="HPSH112_01955"
                     /note="COG2894 Septum formation inhibitor-activating
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division inhibitor MinD"
                     /protein_id="YP_006227105.1"
                     /db_xref="GI:386753887"
                     /db_xref="GeneID:12771555"
                     /translation="MAIVVTITSGKGGVGKSTTAANLAIGLAESGKKVVAVDFDIGLR
                     NLDMILGLENRIVYDVVDVMEKNCNLSQALITDKKTKNLSFLAASQSKDKNVLDKEKV
                     AILINALRADFDYILIDSPAGIESGFEHAILHADMALVVVTPEVSSLRDSDRVIGIID
                     AKSNRAKKGMEVHKHLIINRLKPELVANGEMISIEEVLKILCLPLIGIIPEDSHIISA
                     TNKGEPVIRTDCESAKAYQRITRRILGEEVEYVEFKAKKGFFSALKGIFS"
     misc_feature    392541..393344
                     /locus_tag="HPSH112_01955"
                     /note="Septum formation inhibitor-activating ATPase [Cell
                     division and chromosome partitioning]; Region: MinD;
                     COG2894"
                     /db_xref="CDD:225447"
     misc_feature    392550..393248
                     /locus_tag="HPSH112_01955"
                     /note="Bacterial cell division requires the formation of a
                     septum at mid-cell. The site is determined by the min
                     operon products MinC, MinD and MinE. MinC is a nonspecific
                     inhibitor of the septum protein FtsZ. MinE is the
                     supressor of MinC. MinD plays a pivotal...; Region: MinD;
                     cd02036"
                     /db_xref="CDD:238993"
     misc_feature    392568..392594
                     /locus_tag="HPSH112_01955"
                     /note="P-loop; other site"
                     /db_xref="CDD:238993"
     misc_feature    order(392577..392579,392583..392594,393168..393170)
                     /locus_tag="HPSH112_01955"
                     /note="ADP binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238993"
     misc_feature    392652..392660
                     /locus_tag="HPSH112_01955"
                     /note="Switch I; other site"
                     /db_xref="CDD:238993"
     misc_feature    392895..392909
                     /locus_tag="HPSH112_01955"
                     /note="Switch II; other site"
                     /db_xref="CDD:238993"
     gene            393344..393577
                     /gene="minE"
                     /locus_tag="HPSH112_01960"
                     /db_xref="GeneID:12771556"
     CDS             393344..393577
                     /gene="minE"
                     /locus_tag="HPSH112_01960"
                     /note="COG0851 Septum formation topological specificity
                     factor"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division topological specificity factor
                     MinE"
                     /protein_id="YP_006227106.1"
                     /db_xref="GI:386753888"
                     /db_xref="GeneID:12771556"
                     /translation="MSLFDFFKNKGSAATATDRLKLILAKERTLNLPYMEEMRKEIIA
                     VIQKYTKSSDIHFKTIDGNQSVETIEVEIILPK"
     misc_feature    393344..393571
                     /gene="minE"
                     /locus_tag="HPSH112_01960"
                     /note="Septum formation topological specificity factor
                     MinE; Region: MinE; cl00538"
                     /db_xref="CDD:260486"
     gene            393589..394389
                     /locus_tag="HPSH112_01965"
                     /db_xref="GeneID:12771557"
     CDS             393589..394389
                     /locus_tag="HPSH112_01965"
                     /note="COG0758 Predicted Rossmann fold nucleotide-binding
                     protein involved in DNA uptake"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA processing protein DprA"
                     /protein_id="YP_006227107.1"
                     /db_xref="GI:386753889"
                     /db_xref="GeneID:12771557"
                     /translation="MKSNFQYSALENIPKAFDILKDPPKKLYCVGDTKLLDAPLKVAI
                     IGTRRPTPYSKQHTITLAREFAKNGAVIVSGGALGVDIIAQENALPKTIMLSPCSLDF
                     IYPTNNHKVIQEIAQNGLILSEYEKDFMPVKGSFLARNRLVIALSDAVIIPQADLKSG
                     SMSSARLAQKYQKPLFVLPQRLNESDGTNELLEKGQAQGIFNIQNFINTLLKDHHLKE
                     MPEIKDEFLEYCAKNPSYEEAYLKFGDKLLEYELLGKIKRINHIVVLA"
     misc_feature    393589..394218
                     /locus_tag="HPSH112_01965"
                     /note="DNA protecting protein DprA; Region: dprA;
                     TIGR00732"
                     /db_xref="CDD:129815"
     misc_feature    <393619..394368
                     /locus_tag="HPSH112_01965"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     gene            394386..394790
                     /locus_tag="HPSH112_01970"
                     /db_xref="GeneID:12771558"
     CDS             394386..394790
                     /locus_tag="HPSH112_01970"
                     /note="COG0816 Predicted endonuclease involved in
                     recombination (possible Holliday junction resolvase in
                     Mycoplasmas and B. subtilis)"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction resolvase-like protein"
                     /protein_id="YP_006227108.1"
                     /db_xref="GI:386753890"
                     /db_xref="GeneID:12771558"
                     /translation="MILACDVGLKRIGIAALLNGVILPLEAILRHNRNQASRDLSDLL
                     REKNIQVLVVGKPNESYADTNARIEHFIKLLDFKGEIVFINEDRSSIEAYENLGHLGK
                     KNKRLAIKDGRLDSLSACRILERYCQQVLKKC"
     misc_feature    394386..394772
                     /locus_tag="HPSH112_01970"
                     /note="Holliday junction resolvase-like protein; Reviewed;
                     Region: PRK00109"
                     /db_xref="CDD:234639"
     gene            395027..395398
                     /locus_tag="HPSH112_01975"
                     /db_xref="GeneID:12771559"
     CDS             395027..395398
                     /locus_tag="HPSH112_01975"
                     /note="COG0790 FOG: TPR repeat, SEL1 subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine-rich protein H"
                     /protein_id="YP_006227109.1"
                     /db_xref="GI:386753891"
                     /db_xref="GeneID:12771559"
                     /translation="MNNGRGCNGLGVLYRDGQGAEKNLTKAAQYASKACDLNNGRGCG
                     ALGSLYEDGKGVEKNSKKATYFYSKACDLKDGWGCNNLGWLYENGKGVGKDLIKAAYF
                     YSKACELKEGLGVWCFRGVIL"
     misc_feature    <395030..>395362
                     /locus_tag="HPSH112_01975"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    395042..395143
                     /locus_tag="HPSH112_01975"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    395150..395251
                     /locus_tag="HPSH112_01975"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    395258..395356
                     /locus_tag="HPSH112_01975"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            395692..396030
                     /locus_tag="HPSH112_01980"
                     /db_xref="GeneID:12771560"
     CDS             395692..396030
                     /locus_tag="HPSH112_01980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227110.1"
                     /db_xref="GI:386753892"
                     /db_xref="GeneID:12771560"
                     /translation="MKIMHQVMDFLDSCKQTIQKNSNEALQKTKRALFKEKSQKIREQ
                     AVKIVEKRLKKEGMKLSDFNEEELKIMFEAEEKRLLEQIHAKESEENQEKSVKHFKEV
                     WEKGDNEQER"
     misc_feature    <395830..>396027
                     /locus_tag="HPSH112_01980"
                     /note="chlorohydrolase; Provisional; Region: PRK07213"
                     /db_xref="CDD:235969"
     gene            396014..396574
                     /locus_tag="HPSH112_01985"
                     /db_xref="GeneID:12771561"
     CDS             396014..396574
                     /locus_tag="HPSH112_01985"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227111.1"
                     /db_xref="GI:386753893"
                     /db_xref="GeneID:12771561"
                     /translation="MSKKDSFISSVMGFFSEKNERWLLAHRHTRGFVIVAWLFRFKSI
                     AFSILITLLIILVDIWVYSDVRQFLLDTASSPILLLVALLIKWGVIVISVRQCYKFSK
                     KMFALIQKKRQIRESLKKRSHQQEGKTPPKERLSSVTEEIIAKKQEETQRQEAPEDTH
                     ERLSSVTEEIISKKLEELKARNDKGN"
     misc_feature    <396359..>396556
                     /locus_tag="HPSH112_01985"
                     /note="Aspartyl beta-hydroxylase N-terminal region;
                     Region: Asp-B-Hydro_N; pfam05279"
                     /db_xref="CDD:191249"
     gene            complement(396731..397612)
                     /locus_tag="HPSH112_01990"
                     /db_xref="GeneID:12771562"
     CDS             complement(396731..397612)
                     /locus_tag="HPSH112_01990"
                     /note="COG0564 Pseudouridylate synthases, 23S
                     RNA-specific"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227112.1"
                     /db_xref="GI:386753894"
                     /db_xref="GeneID:12771562"
                     /translation="MPFVEEEFEILKPTKALFFVLDVLKCSLKEAQRHLDKQRLKQNQ
                     QAVRKSQMIQGVVSLIHFKPNEKTQALVFETKDFGVFDKPPQVYTHPKGYFYHESLLD
                     YIQSHFGKNAHPAHRLDYETSGLVLAGKTLQSAKDLKALFMQKKVKKTYLALVHGLVD
                     KNIVIDKPILTLQSIQKDLRIRSKISPLGKPSTTLVEPLSYNPFLDISLLKITPLTGR
                     THQIRLHLSSVGHRIVGEGLYGVIDENAREYLQLKRENNTPLLMLHASSLAFEFKGAI
                     HEITSPMPKRFMPFLKD"
     misc_feature    complement(396758..397600)
                     /locus_tag="HPSH112_01990"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    complement(396803..397375)
                     /locus_tag="HPSH112_01990"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    complement(order(396944..396946,397256..397267))
                     /locus_tag="HPSH112_01990"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            complement(397612..399162)
                     /locus_tag="HPSH112_01995"
                     /db_xref="GeneID:12771563"
     CDS             complement(397612..399162)
                     /locus_tag="HPSH112_01995"
                     /note="COG0608 Single-stranded DNA-specific exonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease"
                     /protein_id="YP_006227113.1"
                     /db_xref="GI:386753895"
                     /db_xref="GeneID:12771563"
                     /translation="MKQKLKAQIKERVASIAYNEKGFPSPFLFKDLKKAALKIIEAMR
                     ANTEILVVGDYDADGVISSTIMAKFFESLNYKHVRIVIPNRFIDGYGISKKFLEKHHA
                     PLIITVDNGISAFEAARFCKEKNYTLIITDHHCLHHDEVPDAYAVINPKQPDCDFIQK
                     EVCGALVAFYLCYGIHQLLGKEKSHSSELLCLAGVATIADMMPLTFFNRFLVSKALYF
                     LQKESLGAMGFLRQREVFRKRSLKASDISFSIAPLINSAGRMQDAKMALDFLSANNFQ
                     DGYFLYERLKACNMKRKMIQQQVFEEAFKHAMVGEKIIIAFKDDWHEGVLGIVASKLV
                     EATQKPSLVFTFKEGVYKGSGRSSSNIDLIDALNGVSSLLLGYGGHRQACGLSVGKNN
                     IISLFETLENFDFKILPFCEKEPPLTLTLKDIDRELLEIIEAGEPYGQENPEPLFQAQ
                     NLEVIEEKIIKESHQVLRFKDKECIKEAIYFNTERFLKAGEKVNAIFSVELDECSNEP
                     KMFVKSLL"
     misc_feature    complement(397618..399093)
                     /locus_tag="HPSH112_01995"
                     /note="single-stranded-DNA-specific exonuclease RecJ;
                     Region: recJ; TIGR00644"
                     /db_xref="CDD:233070"
     misc_feature    complement(398569..399039)
                     /locus_tag="HPSH112_01995"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     misc_feature    complement(397972..398148)
                     /locus_tag="HPSH112_01995"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            complement(399172..400788)
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /db_xref="GeneID:12771564"
     CDS             complement(399172..400788)
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /EC_number="6.3.4.2"
                     /note="COG0504 CTP synthase (UTP-ammonia lyase)"
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthetase"
                     /protein_id="YP_006227114.1"
                     /db_xref="GI:386753896"
                     /db_xref="GeneID:12771564"
                     /translation="MDRAKFIFVTGGVLSSLGKGISSSSIATLLQHCNYQVSILKIDP
                     YINIDPGTMSPLEHGEVFVTSDGAETDLDIGHYERFLNRNLTRLNNFTTGQIFSSVIE
                     NERKGEYLGKTIQIVPHVTDEIKRRIKSAAKGLDFLIVEVGGTVGDMEGMFYLEAIRQ
                     LKLELGNEKVINVHVTLIPYIQTTNELKTKPTQHSVQELRRLGVTPQIILARSPKPLD
                     KELKNKIALSCDVEQDSVIVATDTKSIYACPILFLQEGILTPIARRFNLNKLHPKMAA
                     WNTLVEKIIAPKHKVKIGFVGKYLSLKESYKSLIEALIHAGAHLDTQVNIEWLDSENF
                     NEKTDLEGVDAVLVPGGFGERGIEGKICAIQRARLEKLPFLGICLGMQLAIIEFCRNV
                     LGLKGANSTEFNQRCEYPVVYLIEDFIDQNHQKQVRTYNSPLGGTMRLGEYECEIVPN
                     SLLEKAYKKPSIKERHRHRYEINPKYRQEWENKGLKVVGFGANHLIEAIELDDHPFFV
                     GVQFHPEFTSRLQSPNPIILDFIKSALHKS"
     misc_feature    complement(399175..400779)
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="CTP synthetase; Validated; Region: pyrG; PRK05380"
                     /db_xref="CDD:235437"
     misc_feature    complement(400018..400776)
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="CTP synthetase (CTPs) is a two-domain protein,
                     which consists of an N-terminal synthetase domain and
                     C-terminal glutaminase domain. The enzymes hydrolyze the
                     amide bond of glutamine to ammonia and glutamate at the
                     glutaminase domains and transfer nascent...; Region: CTGs;
                     cd03113"
                     /db_xref="CDD:239387"
     misc_feature    complement(order(400360..400362,400366..400368,
                     400558..400563,400570..400572,400576..400578,
                     400654..400662,400666..400668,400726..400737,
                     400744..400746))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:239387"
     misc_feature    complement(order(400117..400119,400219..400227,
                     400357..400359,400666..400668,400729..400743))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="active site"
                     /db_xref="CDD:239387"
     misc_feature    complement(order(400117..400119,400219..400227,
                     400339..400341,400357..400362,400654..400668))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="UTP binding site [chemical binding]; other site"
                     /db_xref="CDD:239387"
     misc_feature    complement(399196..399918)
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="Type 1 glutamine amidotransferase (GATase1) domain
                     found in Cytidine Triphosphate Synthetase; Region:
                     GATase1_CTP_Synthase; cd01746"
                     /db_xref="CDD:153217"
     misc_feature    complement(order(399244..399246,399250..399252,
                     399379..399390,399583..399585,399643..399645,
                     399652..399657,399730..399744))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="active site"
                     /db_xref="CDD:153217"
     misc_feature    complement(order(399652..399654,399736..399738))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="putative oxyanion hole; other site"
                     /db_xref="CDD:153217"
     misc_feature    complement(order(399244..399246,399250..399252,
                     399655..399657))
                     /gene="pyrG"
                     /locus_tag="HPSH112_02000"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153217"
     gene            401047..401709
                     /locus_tag="HPSH112_02005"
                     /db_xref="GeneID:12771565"
     CDS             401047..401709
                     /locus_tag="HPSH112_02005"
                     /note="COG0671 Membrane-associated phospholipid
                     phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227115.1"
                     /db_xref="GI:386753897"
                     /db_xref="GeneID:12771565"
                     /translation="MAENSFKNVTIQSKPFFLSQVKTLFLLGGVFSAFFILMVGLVFF
                     DCVNSMDNAIFNLMRSNSSNPILDQTLQRIVFLGSSQFVLPLSLLVGVFLSLYRRNLA
                     LGVWFVLSVILFEALLESLKHLLAHSIQWLSHSANFPNATALSLALFYGLLVLLIPHL
                     ITHQTLKNILSYSLFGLILLIGLALIVLGVSFSSVLGGFCLGALGACFSIGIYLSVFQ
                     KI"
     misc_feature    401167..401685
                     /locus_tag="HPSH112_02005"
                     /note="PAP2_like proteins, a super-family of histidine
                     phosphatases and vanadium haloperoxidases, includes type 2
                     phosphatidic acid phosphatase or lipid phosphate
                     phosphatase (LPP), Glucose-6-phosphatase,
                     Phosphatidylglycerophosphatase B and bacterial acid...;
                     Region: PAP2_like; cl00474"
                     /db_xref="CDD:260448"
     misc_feature    order(401410..401412,401464..401472,401599..401601,
                     401617..401619,401626..401628)
                     /locus_tag="HPSH112_02005"
                     /note="active site"
                     /db_xref="CDD:238813"
     gene            401753..403456
                     /gene="fliF"
                     /locus_tag="HPSH112_02010"
                     /db_xref="GeneID:12771566"
     CDS             401753..403456
                     /gene="fliF"
                     /locus_tag="HPSH112_02010"
                     /note="COG1766 Flagellar biosynthesis/type III secretory
                     pathway lipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar MS-ring protein"
                     /protein_id="YP_006227116.1"
                     /db_xref="GI:386753898"
                     /db_xref="GeneID:12771566"
                     /translation="MDLKVLLQRIVDFFIKLNKKQKIALIAAGVLITALLVFLLLYPF
                     KEKDYTQGGYGVLFERLDSSDNALILQHLQQNQIPYKILKDDTILIPKDKVYEERITL
                     ASQGIPKTSKVGFEIFDTKDFGATDFDQNIKLIRAIEGELSRTIESLNPILKANVHIA
                     IPKDSVFVAKEVPPSASVMLKLKPDMKLSPTQILGIKNLIAAAVPKLTTENVKIVNEN
                     GESIGEGDILENSKELALEQLRYKQNFENILENKIVNILAPIVGGKNKVVARVNAEFD
                     FSQRKSTKETFDPNNVVRSEQNLEEKKEGAPKKQVGGVPGVVSNIGPVQGLKDNKEPE
                     KYEKSQNTTNYEVGKTISEIKGEFGTLVRLNAAVVVDGKYKIALKDGANTLEYEPLSD
                     ESLKKINALVKQAIGYNQNRGDDVAVSNFEFNPMAPMLDNATLSEKIMHKTQKILGSF
                     TPLIKYILVFIVLFIFYKKVIVPFSERMLEVVPDEDKEVKSMFEEMDEEEDELNKLGD
                     LRKKVEDQLGLNATFSEEEVRYEIVLEKIRGTLKERPDEIAMLFKLLIKDEISSDSAK
                     G"
     misc_feature    401753..403441
                     /gene="fliF"
                     /locus_tag="HPSH112_02010"
                     /note="flagellar basal-body M-ring protein/flagellar
                     hook-basal body protein (fliF); Region: fliF; TIGR00206"
                     /db_xref="CDD:129310"
     misc_feature    401819..402424
                     /gene="fliF"
                     /locus_tag="HPSH112_02010"
                     /note="Secretory protein of YscJ/FliF family; Region:
                     YscJ_FliF; pfam01514"
                     /db_xref="CDD:250676"
     misc_feature    402521..403021
                     /gene="fliF"
                     /locus_tag="HPSH112_02010"
                     /note="Flagellar M-ring protein C-terminal; Region:
                     YscJ_FliF_C; pfam08345"
                     /db_xref="CDD:254746"
     gene            403475..404506
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /db_xref="GeneID:12771567"
     CDS             403475..404506
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /note="COG1536 Flagellar motor switch protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein G"
                     /protein_id="YP_006227117.1"
                     /db_xref="GI:386753899"
                     /db_xref="GeneID:12771567"
                     /translation="MATKLTPKQKAQLDELSMSEKIAILLIQVGEDTTGEILRHLDID
                     SITEISKQIVQLNGTDKQIGAAVLEEFFAIFQSNQYINTGGLEYARELLTRTLGSEEA
                     KKVMDKLTKSLQTQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSY
                     FPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEVGGLRAVAEIFNRL
                     GQKSAKTTLARIESVDNKLAGAIKEMMFTFEDISKLDNFAIREILKVADKKDLSLALK
                     TSTQDLTDKFLNNMSSRAAEQFIEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQ
                     TGEEEDVIE"
     misc_feature    403508..404503
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /note="flagellar motor switch protein FliG; Region: fliG;
                     TIGR00207"
                     /db_xref="CDD:232874"
     misc_feature    403508..403831
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /note="FliG N-terminal domain; Region: FliG_N; pfam14842"
                     /db_xref="CDD:258979"
     misc_feature    403853..404080
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /note="FliG middle domain; Region: FliG_M; pfam14841"
                     /db_xref="CDD:258978"
     misc_feature    404153..404476
                     /gene="fliG"
                     /locus_tag="HPSH112_02015"
                     /note="FliG C-terminal domain; Region: FliG_C; pfam01706"
                     /db_xref="CDD:190075"
     gene            404493..405269
                     /gene="fliH"
                     /locus_tag="HPSH112_02020"
                     /db_xref="GeneID:12771568"
     CDS             404493..405269
                     /gene="fliH"
                     /locus_tag="HPSH112_02020"
                     /note="COG1317 Flagellar biosynthesis/type III secretory
                     pathway protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein H"
                     /protein_id="YP_006227118.1"
                     /db_xref="GI:386753900"
                     /db_xref="GeneID:12771568"
                     /translation="MSLNSRKNLIQKDHLNKHDIQKYEFKSMANLPPTTNPNGASLET
                     PNPEEPLEKKAIENDLIDCLLKKTDELSSHLVKLQMQFEKAQEESKALIENAKNDGYK
                     IGFKEGEEKMRNELTHSVNEEKNQLLHAITALDEKMKKSEDHLMALEKELSAIAIDIA
                     KEVILKEVEDNSQKVALALAEELLKNVLDATDIHLKVNPLDYPYLNERLQNASKIKLE
                     SNEAISKGGVMITSSNGNLDGNLMERFKTLKESVLENFKV"
     misc_feature    404493..405266
                     /gene="fliH"
                     /locus_tag="HPSH112_02020"
                     /note="flagellar assembly protein H; Validated; Region:
                     fliH; PRK06669"
                     /db_xref="CDD:235850"
     misc_feature    404853..405236
                     /gene="fliH"
                     /locus_tag="HPSH112_02020"
                     /note="Flagellar assembly protein FliH; Region: FliH;
                     pfam02108"
                     /db_xref="CDD:111047"
     gene            405272..407122
                     /locus_tag="HPSH112_02025"
                     /db_xref="GeneID:12771569"
     CDS             405272..407122
                     /locus_tag="HPSH112_02025"
                     /EC_number="2.2.1.7"
                     /note="COG1154 Deoxyxylulose-5-phosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="1-deoxy-D-xylulose-5-phosphate synthase"
                     /protein_id="YP_006227119.1"
                     /db_xref="GI:386753901"
                     /db_xref="GeneID:12771569"
                     /translation="MQNKTFDLNPNDIAGLELVCQTLRSRILEVVSANGGHLSSSLGA
                     VELIVSMHALFDCQKNPFIFDTSHQAYAHKLLTGRFESFSTLRQFKGLSGFTKPSESA
                     YDYFIAGHSSTSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDRKY
                     PMIMILNDNEMSISTPIGALSKALSQLMKGPFYQSFRSKVKKILNTLPESVNYLASRF
                     EESFKLITPGVFFEELGINYIGPINGHDLSAIIETLKLAKELKEPVLIHAQTLKGKGY
                     KIAEGRYEKWHGVGPFDLDTGLSKKSKSAILSPTEAYSNTLLELAKKDEKIVGVTAAM
                     PSGTGLDKLIDTYPLRFFDVAIAEQHALTSSSAMAKEGFKPFVSIYSTFLQRAYDSIV
                     HDACISSLPIKLAIDRAGIVGEDGETHQGLLDVSYLRSIPNMVIFAPRDNETLKNAVH
                     FANEHHSSPCAFRYPRGSFALKEGVFEPSGFVLGQSELLKKEGEILLIGYGNGVGRAY
                     LVQLALKEKNIECALLDLRFLKPLDQNLSAIIAPYQKLYVFSDNYKLGGVASAILEFL
                     SEQNILKPVKSFEIIDEFIMHGNTALVEKSLGLDTESLTDAILKDLGQER"
     misc_feature    405272..407110
                     /locus_tag="HPSH112_02025"
                     /note="1-deoxy-D-xylulose-5-phosphate synthase; Region:
                     dxs; TIGR00204"
                     /db_xref="CDD:129308"
     misc_feature    405374..406099
                     /locus_tag="HPSH112_02025"
                     /note="Thiamine pyrophosphate (TPP) family, DXS subfamily,
                     TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate
                     synthase (DXS) is a regulatory enzyme of the
                     mevalonate-independent pathway involved in terpenoid
                     biosynthesis. Terpeniods are plant natural products...;
                     Region: TPP_DXS; cd02007"
                     /db_xref="CDD:238965"
     misc_feature    order(405602..405604,405686..405697,405776..405778,
                     405782..405784)
                     /locus_tag="HPSH112_02025"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238965"
     misc_feature    406202..406669
                     /locus_tag="HPSH112_02025"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    order(406244..406246,406250..406252,406268..406270,
                     406319..406321,406328..406330,406334..406351,
                     406358..406363,406367..406375,406427..406429,
                     406436..406441,406514..406516,406523..406525,
                     406571..406576,406637..406639)
                     /locus_tag="HPSH112_02025"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(406268..406270,406328..406330,406337..406345,
                     406424..406429,406433..406435,406514..406516,
                     406520..406522,406547..406552,406556..406561,
                     406565..406567)
                     /locus_tag="HPSH112_02025"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    order(406337..406339,406343..406345,406418..406420,
                     406427..406429)
                     /locus_tag="HPSH112_02025"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    406721..407083
                     /locus_tag="HPSH112_02025"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            407137..408927
                     /locus_tag="HPSH112_02030"
                     /db_xref="GeneID:12771570"
     CDS             407137..408927
                     /locus_tag="HPSH112_02030"
                     /note="COG0481 Membrane GTPase LepA"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein LepA"
                     /protein_id="YP_006227120.1"
                     /db_xref="GI:386753902"
                     /db_xref="GeneID:12771570"
                     /translation="MKNIRNFSIIAHIDHGKSTLADCLIAECNAISNREMTSQVMDTM
                     DIEKERGITIKAQSVRLNYTLKGEDYVLNLIDTPGHVDFSYEVSRSLCSCEGALLVVD
                     ATQGVEAQTIANVYIALDNHLEILPVINKIDLPNANVLEVKQDIEDTIGIDCSSANEV
                     SAKARLGIKDLLEKIITTIPAPSGDFNAPLKALIYDSWFDNYLGALALVRIMDGSINT
                     EQEILVMGTGKKHGVLGLYYPNPLKKIPTKSLECGEIGIVSLGLKSVTDIAVGDTLTD
                     AKNPTPKPIEGFMPAKPFVFAGLYPIETDRFEDLREALLKLQLNDCALNFEPESSVAL
                     GFGFRVGFLGLLHMEVIKERLEREFGLNLIATAPTVVYEVHLTDNSIKYVQNPSELPP
                     ENHIACIKEPFVRATIITPSEFLGNLMQLLNNKRGIQEKMEYLNQSRVMLTYSLPSNE
                     IVMDFYDKLKSCTKGYASFDYEPIENREAHLVKLDVRVAGDVVDALSIIIDKNKAYEK
                     GRALVETMKELIPRQLFEVAIQASVGNKIIARETIKSVGKNVTAKCYGGDITRKRKLL
                     EKQKEGKKRMKAIGKVELPQEAFLAILKID"
     misc_feature    407137..408924
                     /locus_tag="HPSH112_02030"
                     /note="GTP-binding protein LepA; Provisional; Region:
                     PRK05433"
                     /db_xref="CDD:235462"
     misc_feature    407149..407682
                     /locus_tag="HPSH112_02030"
                     /note="LepA also known as Elongation Factor 4 (EF4);
                     Region: LepA; cd01890"
                     /db_xref="CDD:206677"
     misc_feature    407167..407190
                     /locus_tag="HPSH112_02030"
                     /note="G1 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    order(407170..407172,407176..407178,407188..407193,
                     407200..407202,407209..407214,407305..407310,
                     407374..407379,407446..407451,407557..407559,
                     407569..407571)
                     /locus_tag="HPSH112_02030"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206677"
     misc_feature    order(407176..407193,407524..407529,407533..407535,
                     407617..407625)
                     /locus_tag="HPSH112_02030"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206677"
     misc_feature    407272..407307
                     /locus_tag="HPSH112_02030"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206677"
     misc_feature    407293..407295
                     /locus_tag="HPSH112_02030"
                     /note="G2 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    407362..407373
                     /locus_tag="HPSH112_02030"
                     /note="G3 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    407368..407424
                     /locus_tag="HPSH112_02030"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206677"
     misc_feature    407524..407535
                     /locus_tag="HPSH112_02030"
                     /note="G4 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    407617..407625
                     /locus_tag="HPSH112_02030"
                     /note="G5 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    407704..407964
                     /locus_tag="HPSH112_02030"
                     /note="Translation_Factor_II_like: Elongation factor Tu
                     (EF-Tu) domain II-like proteins. Elongation factor Tu
                     consists of three structural domains, this family
                     represents the second domain. Domain II adopts a beta
                     barrel structure and is involved in binding to...; Region:
                     Translation_Factor_II_like; cl02787"
                     /db_xref="CDD:261449"
     misc_feature    408337..408576
                     /locus_tag="HPSH112_02030"
                     /note="lepA_C: This family represents the C-terminal
                     region of LepA, a GTP-binding protein localized in the
                     cytoplasmic membrane.   LepA is ubiquitous in Bacteria and
                     Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is
                     missing from Archaea. LepA exhibits...; Region: lepA_C;
                     cd03709"
                     /db_xref="CDD:239680"
     misc_feature    408598..408921
                     /locus_tag="HPSH112_02030"
                     /note="GTP-binding protein LepA C-terminus; Region:
                     LepA_C; pfam06421"
                     /db_xref="CDD:203441"
     gene            408936..409865
                     /locus_tag="HPSH112_02035"
                     /db_xref="GeneID:12771571"
     CDS             408936..409865
                     /locus_tag="HPSH112_02035"
                     /note="COG0270 Site-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-cytosine methyltransferase"
                     /protein_id="YP_006227121.1"
                     /db_xref="GI:386753903"
                     /db_xref="GeneID:12771571"
                     /translation="MKVGSLFAGIGGFECAFLQAGFEIGWANELDKDACNTYRANFKH
                     KLLEQDIKDLNPNELEDVGLISAGFPCQAFSIAGLQKGLNDERGAIVMEMFRIIQAKK
                     PQVLLLENVKNLVSHNKGETLKFILETLKNLGYFVHYKILNTYEYSTVPQNRERIYII
                     GFLDKNHYKRFHFPLKINHTQSIKDLLEIKVGEEFYYKQYRFYETLKKEITKRDTCYQ
                     WRRHYVRENKNNLCPTLTANMGTGGHNVPLVLDEQGIRKLTPKECLNFQGFAKDYVLP
                     NTAKSKLYKQIGNSVSVPVIKALALEIKKVVYG"
     misc_feature    408936..409850
                     /locus_tag="HPSH112_02035"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    order(408954..408971,409017..409028,409080..409091,
                     409137..409139,409143..409145)
                     /locus_tag="HPSH112_02035"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    order(409137..409139,409146..409151,409158..409169,
                     409176..409178,409194..409196,409260..409262,
                     409266..409271,409395..409397,409401..409403,
                     409497..409499,409527..409529,409632..409637,
                     409641..409646,409800..409802)
                     /locus_tag="HPSH112_02035"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    order(409137..409139,409146..409148,409158..409160,
                     409260..409262,409266..409268,409395..409397,
                     409401..409403,409800..409802)
                     /locus_tag="HPSH112_02035"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            409858..410328
                     /locus_tag="HPSH112_02040"
                     /db_xref="GeneID:12771572"
     CDS             409858..410328
                     /locus_tag="HPSH112_02040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227122.1"
                     /db_xref="GI:386753904"
                     /db_xref="GeneID:12771572"
                     /translation="MDNYTHQTWVINLTGIDKGIFRTMNGNADELIAIGRVIKAGFPC
                     SRVDVTNAKYDAIVDLGGKQKLLRIQIKGTGGDTLNFTGGYRSGVQIDRNAPKRTYKY
                     TKKDCDLILGIDTRTSECYIIPIEDIQEWGNTKSLSQLQHYKENWQILIDLALE"
     gene            complement(410759..411568)
                     /locus_tag="HPSH112_02045"
                     /db_xref="GeneID:12771573"
     CDS             complement(410759..411568)
                     /locus_tag="HPSH112_02045"
                     /note="COG4786 Flagellar basal body rod protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal-body rod protein"
                     /protein_id="YP_006227123.1"
                     /db_xref="GI:386753905"
                     /db_xref="GeneID:12771573"
                     /translation="MQNGYYAATGAMATQFNRLDLTSNNLANLNTNGFKRDDAITGDF
                     LRLYQQYREQLPLEDQTKASAKYLNRNLNRVPILSEIYTDRSLGAFEETHNPLDFALT
                     SPNLYFAIQTNEGVAYTRDGHFSVDKDGFLVTLNGFRVLSRSGLNEKGGIMLMPNAEI
                     EVNQNGEITFRDNEAPIQAGALALVSFSEPKNLKKIGQNLYTYQGEGVHQISDSGSLR
                     QYMLEKSNVNAVREMSALIGINRFLDMYSKVLKTHQDDMNAEAINKLASKA"
     misc_feature    complement(410771..411568)
                     /locus_tag="HPSH112_02045"
                     /note="Flagellar basal body rod protein [Cell motility and
                     secretion]; Region: FlgG; COG4786"
                     /db_xref="CDD:227125"
     misc_feature    complement(411464..411553)
                     /locus_tag="HPSH112_02045"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    complement(410846..411115)
                     /locus_tag="HPSH112_02045"
                     /note="flagellar basal-body rod protein FlgF; Region:
                     flgF; TIGR02490"
                     /db_xref="CDD:233892"
     gene            complement(411623..412909)
                     /locus_tag="HPSH112_02050"
                     /db_xref="GeneID:12771574"
     CDS             complement(411623..412909)
                     /locus_tag="HPSH112_02050"
                     /note="COG0477 Permeases of the major facilitator
                     superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-ketoglutarate permease"
                     /protein_id="YP_006227124.1"
                     /db_xref="GI:386753906"
                     /db_xref="GeneID:12771574"
                     /translation="MNPQTQPATKKPLKSLLAASSGNLVEWYDFYAYAFLAPYFAKEF
                     THTNDPTLALISAFLVFMLGFFMRPLGSLFFGKLGDKKGRKTSMVYSIILMALGSFML
                     ALLPTKEIVGEWAFLFLLLARLLQGFSVGGEYGVVATYLSELGKNGKKGFYGSFQYVT
                     LVGGQLLAIFSLFIVENIYTHEQISAFAWRYLFALGGILALLSLFLRNIMEETMDSQT
                     TSKTTIKEETQRGSLKELLNHKKALMIVFGLTMGGSLCFYTFTVYLKIFLTNSSSFSP
                     KESSFIMLLALSYFIFLQPLCGMLADKIKRTQMLMVFAIAGLIVTPVVFYGIKHASGV
                     YEALFYEMLALSAMSFYTCIAGVIKAELFPEHVRALGVGLAYAIANALFGGSASYVAL
                     QFKQHGFEWGFVGYVMFSIVIFMVMVIIFPKKTYLE"
     misc_feature    complement(411662..412900)
                     /locus_tag="HPSH112_02050"
                     /note="alpha-ketoglutarate transporter; Provisional;
                     Region: PRK10406"
                     /db_xref="CDD:182433"
     misc_feature    complement(411647..412864)
                     /locus_tag="HPSH112_02050"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(411761..411763,411770..411775,
                     411782..411787,411794..411799,411830..411832,
                     411839..411844,411854..411856,411863..411868,
                     411875..411877,412028..412030,412040..412042,
                     412049..412051,412061..412063,412073..412075,
                     412115..412117,412124..412129,412136..412141,
                     412148..412150,412415..412417,412433..412438,
                     412445..412450,412484..412486,412493..412498,
                     412505..412510,412517..412522,412682..412687,
                     412691..412696,412724..412726,412733..412738,
                     412745..412747,412796..412801,412805..412813,
                     412820..412822))
                     /locus_tag="HPSH112_02050"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(413072..415599)
                     /note="potential frameshift: common BLAST hit:
                     gi|108562782|ref|YP_627098.1| cell division protein"
     gene            complement(415596..417932)
                     /locus_tag="HPSH112_02065"
                     /db_xref="GeneID:12771575"
     CDS             complement(415596..417932)
                     /locus_tag="HPSH112_02065"
                     /note="COG3893 Inactivated superfamily I helicase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227125.1"
                     /db_xref="GI:386753907"
                     /db_xref="GeneID:12771575"
                     /translation="MNLEKLFSQKNPLFVFSSTRRLKHFYLEQGEGFLPNAMSMGSFF
                     EQAFYIPNKKKIPNSARQILMIDTIKAIAKEKKSILEGLLLFENSFLGYLESTSFLFD
                     LFDELSSACIKLNELSSKDIYLDYEKHLEVLEMIYKRYIKKLEELGFYDKIMQEKPTI
                     LKEFFEHFFSIEWHLDGFMSVFERQCLLEVAELVPITLHLSCDQYNQKFLEFLNLKLE
                     TDCDYSIDFKTQKILSQTPKHQKIEPKLYANSSYLKQSALVLQTIEEYLQKDNDPNKM
                     AIITPNADFLPFLKLLDKNNNLNFAMGLGAKNSPYYIELVKISEDLETSGFDLSASPL
                     LDLENLTLALLEQQSSKEKAPLKEAHSQIMHQFHLLKDTLTNYSLKDLLHLYLQEFEA
                     NFRLDDSSGGKIRVMDTLETRGMQFDKIVIVDFNETCVPSLKDCDLFLNSALRKSLNL
                     PTLSDKKNLQKHYYYQLFKNSKEMALSYIESETSKVSNMLLELDLHIEPIKDAYTLFA
                     PTPLKDYQEEEIQATIPKDFSFSASSLNTFLTCKRRFYYHYIKRFKESPKDESNSTIG
                     SLLHELLKEAYEKDKNPYALEERLIQLLETKGNITPKERLDTLIALKKIQAFYVKEKE
                     RFNAKIKILDLEKSFETTIQGVAFKGRIDRIDKTADNEIILLDYKFKSDLKLDNMSEK
                     QRGSLSPIEIAQISADYQMAIYAFALKNLGYKGPIKAFFYDLRKGKLLEEEEPILQAK
                     MDYLKSSLIPKLKQEIDFEKTLEVKDCEYCSFKDMCNR"
     misc_feature    complement(416355..417932)
                     /locus_tag="HPSH112_02065"
                     /note="Inactivated superfamily I helicase [DNA
                     replication, recombination, and repair]; Region: COG3893"
                     /db_xref="CDD:226409"
     misc_feature    complement(415599..416378)
                     /locus_tag="HPSH112_02065"
                     /note="RecB family exonuclease [DNA replication,
                     recombination, and repair]; Region: COG2887"
                     /db_xref="CDD:225441"
     gene            complement(417929..419854)
                     /locus_tag="HPSH112_02070"
                     /db_xref="GeneID:12771576"
     CDS             complement(417929..419854)
                     /locus_tag="HPSH112_02070"
                     /EC_number="2.2.1.1"
                     /note="COG0021 Transketolase"
                     /codon_start=1
                     /transl_table=11
                     /product="transketolase"
                     /protein_id="YP_006227126.1"
                     /db_xref="GI:386753908"
                     /db_xref="GeneID:12771576"
                     /translation="MRLSNADLERLKSMANTLRFLCADMIDKANSGHPGVCLGLADVM
                     VVLSLHLNLNPTNPKWLNRDRLVFSGGHASALAYSLLHLWGFDLSLEDLKRFRQLHSK
                     TPGHPELHHTKGIEITTGPLGQGFANAVGFSMASQYAQNLLDKEAISHKVYCLCGDGD
                     LQEGISYESASLAGHLNLSNLIVIYDSNQISIEGAINISFSEQVKMRFLAQNWEVLEC
                     DGHDYQAIHNALEEAKKSTKPTLLIAHTIIGKGAIGLEGSEKTHGSPLNKEVLKQSKE
                     NAQINPDESFIVSLKNKMHFEEVKVRGVSLEALWEKSLSPKTKEKIHALKDFDFNAIN
                     YPTFKKDESLATRVSNGMILNAIAKECEGFLGGSADLAPSNNTQLKHSGDFPLGQNLH
                     FGIREHAMGAITNALAAYGLFVPFCATFFVFSDYLMPSIRLSALMKLKALFIFTHDSI
                     GVGEDGATHQPVEQLSHLRALPNFYAFRPSDAFENTACMQVALSLSAPSGLILSRQNL
                     PVLDEVSKEQVLKGAYVKYEAKNPAITLVASGSEVSLALESAKMLERENIPTQVVSAP
                     CFDLLVEQDESYLKELFKGKVLVIEASRAIEWYRFADKIIGMDSFGSSAKGNKLFEKF
                     GFSVENITAQAKRLLHA"
     misc_feature    complement(417938..419821)
                     /locus_tag="HPSH112_02070"
                     /note="transketolase, bacterial and yeast; Region:
                     tktlase_bact; TIGR00232"
                     /db_xref="CDD:232887"
     misc_feature    complement(419030..419809)
                     /locus_tag="HPSH112_02070"
                     /note="Thiamine pyrophosphate (TPP) family, Transketolase
                     (TK) subfamily, TPP-binding module; TK catalyzes the
                     transfer of a two-carbon unit from ketose phosphates to
                     aldose phosphates. In heterotrophic organisms, TK provides
                     a link between glycolysis and the...; Region: TPP_TK;
                     cd02012"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(419069..419071,419279..419281,
                     419285..419287,419291..419293,419366..419368,
                     419378..419383,419489..419491,419495..419497,
                     419639..419641))
                     /locus_tag="HPSH112_02070"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(order(419234..419236,419279..419284,
                     419330..419332,419342..419344,419351..419356,
                     419363..419374,419483..419485,419489..419494,
                     419531..419533,419537..419542,419564..419566))
                     /locus_tag="HPSH112_02070"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238970"
     misc_feature    complement(418340..418804)
                     /locus_tag="HPSH112_02070"
                     /note="Pyrimidine (PYR) binding domain of
                     1-deoxy-D-xylulose-5-phosphate synthase (DXS),
                     transketolase (TK), and related proteins; Region:
                     TPP_PYR_DXS_TK_like; cd07033"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(418367..418369,418430..418435,
                     418481..418483,418490..418492,418565..418570,
                     418577..418579,418634..418642,418646..418651,
                     418658..418675,418679..418681,418688..418690,
                     418745..418747,418763..418765,418769..418771))
                     /locus_tag="HPSH112_02070"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(418439..418441,418445..418450,
                     418454..418459,418484..418486,418490..418492,
                     418571..418573,418577..418582,418664..418672,
                     418679..418681,418745..418747))
                     /locus_tag="HPSH112_02070"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(order(418577..418579,418586..418588,
                     418664..418666,418670..418672))
                     /locus_tag="HPSH112_02070"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132916"
     misc_feature    complement(<418082..418288)
                     /locus_tag="HPSH112_02070"
                     /note="Transketolase, C-terminal domain; Region:
                     Transketolase_C; pfam02780"
                     /db_xref="CDD:251527"
     gene            complement(419901..420743)
                     /locus_tag="HPSH112_02075"
                     /db_xref="GeneID:12771577"
     CDS             complement(419901..420743)
                     /locus_tag="HPSH112_02075"
                     /EC_number="2.7.1.26"
                     /note="COG0196 FAD synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional riboflavin kinase/FMN
                     adenylyltransferase"
                     /protein_id="YP_006227127.1"
                     /db_xref="GI:386753909"
                     /db_xref="GeneID:12771577"
                     /translation="MLNFLSISSEPKIKSLAIGKFDGLHLGHQALFKELKDPKALLII
                     EKKHYTKGYLTPLKYRAKLVGMPLFFVYLEEISPLNASEFLDLLKKKFPHLERLVVGY
                     DFRFGHERQNDALFLKERFEKTIIVPEVKIKEISVHSKTIKLALSHGDLSLANKLLGR
                     PYEVCGEVISDQGLGHKELAPTLNIKTKDFILPSFGVYASLVKIKDPIYQKSVSFIGN
                     RLSTDQHFAIECHVLDTIIENPPQEIALRLVQKIRDNMRFSSLKELKNQIQQDILRAK
                     EILR"
     misc_feature    complement(420234..420704)
                     /locus_tag="HPSH112_02075"
                     /note="FAD synthetase, N-terminal domain of the
                     bifunctional enzyme; Region: FAD_synthetase_N; cd02064"
                     /db_xref="CDD:185679"
     misc_feature    complement(419904..420701)
                     /locus_tag="HPSH112_02075"
                     /note="riboflavin kinase/FMN adenylyltransferase; Region:
                     ribF; TIGR00083"
                     /db_xref="CDD:232818"
     misc_feature    complement(order(420327..420335,420357..420359,
                     420435..420437,420660..420662,420669..420671,
                     420678..420689))
                     /locus_tag="HPSH112_02075"
                     /note="active site"
                     /db_xref="CDD:185679"
     misc_feature    complement(419904..420275)
                     /locus_tag="HPSH112_02075"
                     /note="Riboflavin kinase; Region: Flavokinase; smart00904"
                     /db_xref="CDD:214901"
     gene            complement(420709..421416)
                     /locus_tag="HPSH112_02080"
                     /db_xref="GeneID:12771578"
     CDS             complement(420709..421416)
                     /locus_tag="HPSH112_02080"
                     /note="COG1189 Predicted rRNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="YP_006227128.1"
                     /db_xref="GI:386753910"
                     /db_xref="GeneID:12771578"
                     /translation="MRLDYALFNRHLVGSREKAKALVLKNQVLVNKMVVSKPSFIVKE
                     DDKIELIATNLFVSRAGEKLAAFLETHFVDFKGKVVLDVGASKGGFSEVALLKGAKKV
                     LCVDVGKMQLDESLKQDKRIECHEECDIRGFKTPETIDLALCDVSFISLYCILEAILP
                     LSDEFLTLFKPQFEVGRATKRNKKGVVVDKKAILNALENFKNHLKTKDFQILKIQESL
                     VKGKNGNVEFFIHFKRA"
     misc_feature    complement(<421267..421416)
                     /locus_tag="HPSH112_02080"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(420736..421413)
                     /locus_tag="HPSH112_02080"
                     /note="hemolysin TlyA family protein; Region: tly;
                     TIGR00478"
                     /db_xref="CDD:129570"
     misc_feature    complement(order(421288..421290,421294..421317,
                     421336..421338,421342..421347,421354..421359,
                     421363..421368,421372..421377,421411..421413))
                     /locus_tag="HPSH112_02080"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    complement(420904..421179)
                     /locus_tag="HPSH112_02080"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(420982..420984,421027..421035,
                     421096..421101,421150..421170))
                     /locus_tag="HPSH112_02080"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(421416..421931)
                     /locus_tag="HPSH112_02085"
                     /db_xref="GeneID:12771579"
     CDS             complement(421416..421931)
                     /locus_tag="HPSH112_02085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227129.1"
                     /db_xref="GI:386753911"
                     /db_xref="GeneID:12771579"
                     /translation="MGLKNLSTLLVFLFFCLGCVSNFNEDTYTPDLILEKKIQASRKG
                     EITQDNVPIITAIATHLNDVDSGAYYDHEYFLVEIFTQNNNWIDDGYISYELFGTKPI
                     GKEPLWVREITKDEFDGILETTNRWSRAFLLAFDKLDYLAVQEAKLELDAYSLGKIVF
                     NFAYQVPLPQF"
     gene            421998..422921
                     /gene="pyrB"
                     /locus_tag="HPSH112_02090"
                     /db_xref="GeneID:12771580"
     CDS             421998..422921
                     /gene="pyrB"
                     /locus_tag="HPSH112_02090"
                     /EC_number="2.1.3.2"
                     /note="COG0540 Aspartate carbamoyltransferase, catalytic
                     chain"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="YP_006227130.1"
                     /db_xref="GI:386753912"
                     /db_xref="GeneID:12771580"
                     /translation="MPKKCRHLLQTSDLSLDEIKLLLKKASVYASDFNAVSLETKEKM
                     QNKIIVALFFENSTRTVSSFEIASLRLGAKIVKLNMQTSSASKGETLTDTFKNIHAMQ
                     PDAIITRHAFSSAPFKLAEFSQCPLINAGSGVSAHPTQALLDLLTLYQHFGGLENLKG
                     KKIAFIGDVKNSRVANSNIKLLQRLGLEIMLCAPSSMLPIASLKTTHNIEEAIEFADI
                     LMSLRTQTERHNAPIFASLKDYGNAYCITQKRLETHAKNKEIIILHPGPVHRDIDIES
                     TVLEDKRSKVLEQVKNGVAMRMAVLEFLLLD"
     misc_feature    421998..422912
                     /gene="pyrB"
                     /locus_tag="HPSH112_02090"
                     /note="aspartate carbamoyltransferase catalytic subunit;
                     Provisional; Region: pyrB; PRK00856"
                     /db_xref="CDD:234849"
     misc_feature    422013..422450
                     /gene="pyrB"
                     /locus_tag="HPSH112_02090"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    422472..422909
                     /gene="pyrB"
                     /locus_tag="HPSH112_02090"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            423216..424655
                     /locus_tag="HPSH112_02095"
                     /db_xref="GeneID:12771581"
     CDS             423216..424655
                     /locus_tag="HPSH112_02095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227131.1"
                     /db_xref="GI:386753913"
                     /db_xref="GeneID:12771581"
                     /translation="MKNSTPLKNKVFCGLYVLSLSASLQAFDYKIEVLAESFSKVGFN
                     KKKIDISRGIYPTETFVTAVGQGNIYADFLSKGLKDQGHVLEGKVGGTLGGVAYDDTK
                     FNQGGSVIYNYIGYWDGYLGGKRALLDGTSIHECALGSDGKVIDSIACGNARANKIRR
                     NYLMNNAFLEYRYKDIFLAKGGRYQSSAPYMSGYTQGFEISAKVKDKSEGIHKLWWFS
                     SWGRAFAYGEWIYDFYSPRTVIKNGRTLNYGIHLVNYTYERKGVSISPFFQFSPGTYY
                     SPGVVVGYDSNPNFDGVGFRSETKAYILLPVHDPLKRDTYRYAIKAGTAGQSLLIRQR
                     FDYNEFNFGGAFYKVWKNANAYIGTTGNPLGIDFWTNSVYDIGQAISHVVTADAISGW
                     VFGGGVHKKWLWGTLWRWTSGTLANEASAAVNVGYKISKSLTASVKLEYFGVMTHSGF
                     TVGSYKPTPGSKALYSDRSHLMTTLSAKF"
     misc_feature    423234..424652
                     /locus_tag="HPSH112_02095"
                     /note="Putative outer membrane protein; Region: HP_OMP_2;
                     pfam02521"
                     /db_xref="CDD:251350"
     gene            424747..426402
                     /locus_tag="HPSH112_02100"
                     /db_xref="GeneID:12771582"
     CDS             424747..426402
                     /locus_tag="HPSH112_02100"
                     /note="COG1132 ABC-type multidrug transport system, ATPase
                     and permease components"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein MsbA"
                     /protein_id="YP_006227132.1"
                     /db_xref="GI:386753914"
                     /db_xref="GeneID:12771582"
                     /translation="MKLFFRRYSKYLKEHYKSFIVVLFSSLVVALSTAWGTYLVKPTL
                     DEIFINKDTHMLKILPFLVILAYLGKSGGMYLGTYFTNFIGLDIVKKIRNTMLESLLK
                     MEMDFFNRTKKGELIARITNDIGLIRASLSNYLSESIREGLTIVGLVGVVVYQSPKLA
                     LVGLVIMPLAAIPISKIIRKVKKLAKSHQESNAKITSRLSEVFNNVEAIKISNGEKLE
                     HKAFVKENEAFFKIGIKNIAVAEISSPLMEFLGSIAIALVIYLGGNEVIRGHISVGAF
                     FSFITALFMLYTPIKRLTRIVSNFQEALVASDRIHEILEREPAIVDGELTLNDAIHTI
                     EFKKVWLAYTLDNQERYVLSDISLKFQQNEIIALKGESGSGKSSLVNLILRLYEPSKG
                     EIFINDQKIESITQKSLREKISVVTQRVFIFNGSVAENVAYGLEIDEVKIKECLKKAQ
                     ALDFVEKMPHGIESVLDEFGANLSGGQRQRIAIARALYKDAQVLIFDEATSALDNNTE
                     ESVKQSILELKQNRLIILISHNPSTLKLATKHVKLEHGRLIEC"
     misc_feature    424759..426396
                     /locus_tag="HPSH112_02100"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    424801..425616
                     /locus_tag="HPSH112_02100"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    425746..426396
                     /locus_tag="HPSH112_02100"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    425854..425877
                     /locus_tag="HPSH112_02100"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(425863..425868,425872..425880,425998..426000,
                     426235..426240,426331..426333)
                     /locus_tag="HPSH112_02100"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    425989..426000
                     /locus_tag="HPSH112_02100"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    426163..426192
                     /locus_tag="HPSH112_02100"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    426223..426240
                     /locus_tag="HPSH112_02100"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    426247..426258
                     /locus_tag="HPSH112_02100"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    426319..426339
                     /locus_tag="HPSH112_02100"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            426396..427019
                     /locus_tag="HPSH112_02105"
                     /db_xref="GeneID:12771583"
     CDS             426396..427019
                     /locus_tag="HPSH112_02105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227133.1"
                     /db_xref="GI:386753915"
                     /db_xref="GeneID:12771583"
                     /translation="MLRVLSVGVVFILLGCQFFNKTTLHLKYKNYPKNSTLKTAVTLT
                     PPKIFFNARFVPPFYQKEFKKAIIQQIAYFLKDKSAFILNVSGNVFFSFEESPKDLKA
                     IKERLKKTIEPNADPKSVMRFLNLQASLILECTPQTTCPFDTLLIPTAFSVPVYYANR
                     LGDNPSLFSQEDKTYHNALIKALNKAYYSLMEGLEKRLNAIENAEWL"
     misc_feature    426468..426989
                     /locus_tag="HPSH112_02105"
                     /note="Neuraminyllactose-binding hemagglutinin precursor
                     (NLBH); Region: NLBH; pfam05211"
                     /db_xref="CDD:253089"
     gene            427023..427592
                     /locus_tag="HPSH112_02110"
                     /db_xref="GeneID:12771584"
     CDS             427023..427592
                     /locus_tag="HPSH112_02110"
                     /note="COG1787 Predicted endonuclease distantly related to
                     archaeal Holliday junction resolvase and Mrr-like
                     restriction enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="archaeal Holliday junction resolvase/Mrr
                     protein-like protein"
                     /protein_id="YP_006227134.1"
                     /db_xref="GI:386753916"
                     /db_xref="GeneID:12771584"
                     /translation="MKKIVFFIFVILFSVGIYLAWHVLLEKALELKLVTSANDLLLKL
                     LALLGVFSMLVLFQGVISSYKKRQLKRALQKIDAMNGFEFEEYSKIFFTSKGFEVSIT
                     QKSGDYGADLIIEKDGIKWAVQAKRYSHKVSPKAIQEVVSSKAYYACEKACVITNSYF
                     TQAAQKLAQANEVLLIDRDEWVRFLNEKR"
     misc_feature    427023..427589
                     /locus_tag="HPSH112_02110"
                     /note="Predicted endonuclease distantly related to
                     archaeal Holliday junction resolvase and Mrr-like
                     restriction enzymes [Defense mechanisms]; Region: COG1787"
                     /db_xref="CDD:224701"
     misc_feature    427248..427577
                     /locus_tag="HPSH112_02110"
                     /note="Restriction endonuclease; Region: Mrr_cat;
                     pfam04471"
                     /db_xref="CDD:252617"
     gene            427697..428881
                     /locus_tag="HPSH112_02115"
                     /db_xref="GeneID:12771585"
     CDS             427697..428881
                     /locus_tag="HPSH112_02115"
                     /note="COG1106 Predicted ATPases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227135.1"
                     /db_xref="GI:386753917"
                     /db_xref="GeneID:12771585"
                     /translation="MIQSVRIKNFKNFKDTTIDGFTKLNIITGENNAGKSNLLEALYY
                     LVGKSMHPCANIVEIYDNIRKEPLTSESKSLMFYGLDTKKEIQIVTTLDNNQTLDLQI
                     KFIASEYQNTIESQIIPTVEQAQAFSQLKFIFKKGKEEIYNDYLNIARIPNFPPIPNQ
                     SSYNRQFNNFRPDLSRKLLPFESAAIITPSDVARKRDIMNPNAIHIMDPNIIQAMRKI
                     LDNNQLEKRLNQSLNQFDKSIQAIRFSANNQLKLKVKGIKEKIPLSMFGDGLMKYLHI
                     VSAFIVNNATTIYIDEVENGLHFSRMGLLLEEIIDFINNNKDRNLQVFMTTHSQEFVE
                     ILDQVIREKDFANQTKLFCLEQYNGSIVAEPYYGENLSLYFKNHANLFGGKERFKENN
                     YE"
     misc_feature    427697..428851
                     /locus_tag="HPSH112_02115"
                     /note="Predicted ATPases [General function prediction
                     only]; Region: COG1106"
                     /db_xref="CDD:224031"
     misc_feature    427706..>428116
                     /locus_tag="HPSH112_02115"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:257800"
     misc_feature    427781..427804
                     /locus_tag="HPSH112_02115"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(427790..427795,427799..427807)
                     /locus_tag="HPSH112_02115"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    428324..428698
                     /locus_tag="HPSH112_02115"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     gene            428874..429557
                     /locus_tag="HPSH112_02120"
                     /db_xref="GeneID:12771586"
     CDS             428874..429557
                     /locus_tag="HPSH112_02120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227136.1"
                     /db_xref="GI:386753918"
                     /db_xref="GeneID:12771586"
                     /translation="MSKKTLIYTEGKSDKNFLGWCLDVWKNEDRFDIIHVEGKDKLFS
                     DEFCERIKNILKNKNQEYRQVCIIFDADIKKENQESDAGFDNKLEYIREKFKEKGIDF
                     PKEQIFLFPNNQDDGDLEDLLLKIAKHDKFFECFEGYLECIKSKEHYKPIKNIRKSKW
                     YAYLEALGLEDLYTKKNIFDIEGKVKNEYEEDYERLKKAIEFESDILIPLKNFLELTK
                     NTKPNKSKK"
     gene            429632..430627
                     /locus_tag="HPSH112_02125"
                     /db_xref="GeneID:12771587"
     CDS             429632..430627
                     /locus_tag="HPSH112_02125"
                     /note="COG3376 High-affinity nickel permease"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity nickel-transport protein"
                     /protein_id="YP_006227137.1"
                     /db_xref="GI:386753919"
                     /db_xref="GeneID:12771587"
                     /translation="MKLWFPYFLAIVFLHALGLALLFMANNASFYAAASMAYMLGAKH
                     AFDADHIACIDNTIRKLTQQGKNAYGVGFYFSMGHSSVVILMTIISAFAIAWAKEHTP
                     MLEEIGGVVGTLVSGLFLLIIGLLNAIILVDLLKIFKKSHSNESLSQQQNEEIERLLT
                     SRGLLNRFFKPLFNFISKSWHIYPIGFLFGLGFDTASEIALLALSSSAIKVSVVGMLS
                     LPILFAAGMSLFDTLDGAFMLKAYDWAFKTPLRKIYYNISITALSVFIALFIGLIELF
                     QVVSEKLHLKFENRLLNALQSLEFTDLGYYLVGLFVIAFLGSFFLWKIKFSKLES"
     misc_feature    429632..430615
                     /locus_tag="HPSH112_02125"
                     /note="High-affinity nickel permease [Inorganic ion
                     transport and metabolism]; Region: HoxN; COG3376"
                     /db_xref="CDD:225911"
     gene            complement(430631..431146)
                     /locus_tag="HPSH112_02130"
                     /db_xref="GeneID:12771588"
     CDS             complement(430631..431146)
                     /locus_tag="HPSH112_02130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227138.1"
                     /db_xref="GI:386753920"
                     /db_xref="GeneID:12771588"
                     /translation="MDILKTLQKHLGDVETSDFKTNAIEKSQQIAKFSRDMKNINESV
                     GALQVLQIACKKLFNKSMGLEDKDALQASIIKQELREIVENCQFLASPLFDTQLNIAI
                     NDEVFSMVVDNPLDLLENAGEFQAYLEEKLNEIKELLGYLSESLSNPKAFMPSFSNKS
                     LKDLLSDNLRA"
     gene            431279..432595
                     /locus_tag="HPSH112_02135"
                     /db_xref="GeneID:12771589"
     CDS             431279..432595
                     /locus_tag="HPSH112_02135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227139.1"
                     /db_xref="GI:386753921"
                     /db_xref="GeneID:12771589"
                     /translation="MKKIWLLVWGLYSLVFVHAIETIEKVPTNVEDKDKAPHLLLLAG
                     IQGDEPGGFNAANLFLMHYSVLKGLVEVVPVLNKPSMLRNHRGLYGDMNRKFAALDKN
                     DPEYPTIQEIKSLIAKPNIDAVLHLHDGGGYYRPVYVDAMLNPKRWGNCFIIDQDEIK
                     GAKFPNLLAFANNTIESINAHLLHPIEEYHLKNTRTAQGDTEMQKALTFYAINQKKSA
                     FANEASKELPLASRVFYHLQAIEGLLNQLNIPFKRDFELNPSSVHALINDKSLWAKIS
                     SLPKMPLFNLRPKLNHFPLPYNTKIPQIPIESNAYIVGLVKNKQEVFLKYGNKLMTRL
                     SPFYIEFDHSLEEVKMQIDNKDQMVKIGSVVEVKESFYIHAMDNIRANVIGFSVSNES
                     KPNEAGYTIKFKDFQKRFSLDKQERIYRIEFYKNNAFSGMILVKFV"
     misc_feature    431393..432010
                     /locus_tag="HPSH112_02135"
                     /note="M14 family of metallocarboxypeptidases and related
                     proteins; Region: Peptidase_M14_like; cl11393"
                     /db_xref="CDD:264346"
     misc_feature    order(431414..431416,431423..431425,431555..431560,
                     431660..431665,431678..431680,431942..431944)
                     /locus_tag="HPSH112_02135"
                     /note="active site"
                     /db_xref="CDD:199839"
     misc_feature    order(431414..431416,431423..431425,431660..431662)
                     /locus_tag="HPSH112_02135"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:199839"
     gene            complement(433053..433253)
                     /locus_tag="HPSH112_02140"
                     /db_xref="GeneID:12771590"
     CDS             complement(433053..433253)
                     /locus_tag="HPSH112_02140"
                     /note="COG2608 Copper chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="Copper-associated protein"
                     /protein_id="YP_006227140.1"
                     /db_xref="GI:386753922"
                     /db_xref="GeneID:12771590"
                     /translation="MKATFQVPSITCNHCVDKIEKFVGEIEGVSFIDVSVEKKSVVVE
                     FDAPATQDLIKEALLDAGQEVM"
     misc_feature    complement(433059..433244)
                     /locus_tag="HPSH112_02140"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(433209..433211,433218..433226))
                     /locus_tag="HPSH112_02140"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            complement(433254..435479)
                     /locus_tag="HPSH112_02145"
                     /db_xref="GeneID:12771591"
     CDS             complement(433254..435479)
                     /locus_tag="HPSH112_02145"
                     /note="COG2217 Cation transport ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="copper-transporting ATPase"
                     /protein_id="YP_006227141.1"
                     /db_xref="GI:386753923"
                     /db_xref="GeneID:12771591"
                     /translation="MKESFYIEGMTCTACSSGIERSLGRKSFVKKIEVSLLNKSANIE
                     FDENQTNLDEIFKLIEKLGYSPKKTLAKEKKGFFSPNVKLALAVVFTLFVVYLSMGAM
                     LSPSLLPESLLTIDNHSNFLNACLQLIGALIVMHLGRDFYIQGFKALWHRQPNMSSLI
                     AIGTSAALISSLWPLYLVYTNQWSYGHYYFESVCVILMFVMVGKRIENVSKDKALDAM
                     QALMKNAPKTALKMQNNQQIEVLVDSIVVGDILKVLPGSAIAVDGEIIEGEGELDESM
                     LSGEALPVYKKVGDKVFSGTLNSHTSFLMKATQNNKNSTLSQIIEMIHNAQSSKAEIS
                     RLADKVSSVFVPSVIAIAILAFVVWLIIAPKPDFWWNFGIALEVFVSVLVISCPCALG
                     LATPMSILVANQKASSLGLFFKDAKSLEKARLVNTIVFDKTGTLTNGKPVVKSVHSKI
                     ELLELLSLAGSIEKSSEHVIAKGIVEYAKENNAPLKEMSEVKVKTGFGISAKTDYQGT
                     KEIIKVGNSEFFNPINTLEIKENGILVFVGRAISEKEDELLGVFVLEDLPKKGVKEHI
                     AQIKKLGINTLLLSGDNRENVKKCALELGIDGYISNAKPQDKLNKIKELKEKGQIVMM
                     VGDGLNDAPSLAMSDVAVVMAKGSDVSVQAADIVSFNNDIKSVYSAIQLSRATIKNIK
                     ENLFWAFCYNSVFIPLACGVLYKANIMLSPAIAGLAMSLSSVSVVLNSQRLRNFKIKD
                     H"
     misc_feature    complement(435279..435467)
                     /locus_tag="HPSH112_02145"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(435435..435437,435444..435452))
                     /locus_tag="HPSH112_02145"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(434745..>435173)
                     /locus_tag="HPSH112_02145"
                     /note="fungal transcription factor regulatory middle
                     homology region; Region: fungal_TF_MHR; cd12148"
                     /db_xref="CDD:213391"
     misc_feature    complement(433335..435068)
                     /locus_tag="HPSH112_02145"
                     /note="copper-(or silver)-translocating P-type ATPase;
                     Region: ATPase-IB1_Cu; TIGR01511"
                     /db_xref="CDD:233445"
     misc_feature    complement(434217..434897)
                     /locus_tag="HPSH112_02145"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(433506..>433802)
                     /locus_tag="HPSH112_02145"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     gene            complement(435476..436189)
                     /locus_tag="HPSH112_02150"
                     /db_xref="GeneID:12771592"
     CDS             complement(435476..436189)
                     /locus_tag="HPSH112_02150"
                     /note="COG1183 Phosphatidylserine synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine synthase"
                     /protein_id="YP_006227142.1"
                     /db_xref="GI:386753924"
                     /db_xref="GeneID:12771592"
                     /translation="MPINPLYLFPNLFTASSIFLGMMSIFYASSYQFVMACWLVVASL
                     ILDGLDGRVARLTNTTSKFGIEFDSLADVVAFGVAPSLITYFYVGYNFGRIGMAVSAL
                     FVIFGAIRLARFNISTNTSDPYSFIGIPIPAAAVLVVLCVLLDNKYHFLEGNTEKLFL
                     GFIALLGVLMVSNIRYPNFKKVKWNLKLFILVLIFLSLVFVRPLETLSVFMGLYLIYG
                     IIRWLFLMVKIIFNKNKST"
     misc_feature    complement(435515..436174)
                     /locus_tag="HPSH112_02150"
                     /note="Phosphatidylserine synthase [Lipid metabolism];
                     Region: PssA; COG1183"
                     /db_xref="CDD:224104"
     misc_feature    complement(435659..436150)
                     /locus_tag="HPSH112_02150"
                     /note="CDP-diacylglycerol--serine
                     O-phosphatidyltransferase; Region: pssA; TIGR00473"
                     /db_xref="CDD:232991"
     gene            complement(436179..436433)
                     /locus_tag="HPSH112_02155"
                     /db_xref="GeneID:12771593"
     CDS             complement(436179..436433)
                     /locus_tag="HPSH112_02155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227143.1"
                     /db_xref="GI:386753925"
                     /db_xref="GeneID:12771593"
                     /translation="MRAYKRIFDKGLKPYYKHSVCLEFFFRLCFLKTHAYQQRYKAFA
                     LTLFPCKFFNACEVFIPTMDFKIVFIPILKAKLKRASNAY"
     gene            complement(436436..438334)
                     /locus_tag="HPSH112_02160"
                     /db_xref="GeneID:12771594"
     CDS             complement(436436..438334)
                     /locus_tag="HPSH112_02160"
                     /note="COG0465 ATP-dependent Zn proteases"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein (ftsH)"
                     /protein_id="YP_006227144.1"
                     /db_xref="GI:386753926"
                     /db_xref="GeneID:12771594"
                     /translation="MKPTNEPKKPFFQSPIILAVLGGILLIFFLRSFNSDGSFSDNFL
                     ASSTKNVSYHEIKQLISNNEVENVSIGQTLIKASHKEGNNRVIYIAKRVPDLTLVPLL
                     DEKKINYSGFSESNFFTDMLGWLMPILVILGLWMFMANRMQKNMGGGIFGMGSAKKLI
                     NAEKPNVRFNDMAGNEEAKEEVVEIVDFLKYPERYANLGAKIPKGVLLVGPPGTGKTL
                     LAKAVAGEAHVPFFSMGGSSFIEMFVGLGASRVRDLFETAKKQAPSIIFIDEIDAIGK
                     SRAAGGVVSGNDEREQTLNQLLAEMDGFGSENAPVIVLAATNRPEILDPALMRPGRFD
                     RQVLVDKPDFNGRVEILKVHIKGVKLANDVNLQEVAKLTAGLAGADLANIINEAALLA
                     GRNNQKEVRQQHLKEAVERGIAGLEKKSRRISPKEKKIVAYHESGHAVISEMTKGSAR
                     VNKVSIIPRGMAALGYTLNTPEENKYLMQKHELIAEIDVLLGGRAAEDVFLEEISTGA
                     SNDLERATDIIKGMVSYYGMSSVSGLMVLEKQRNAFLGGGYGSSREFSEKTAEEMDLF
                     IKNLLEERYKHVKQTLSDYREAIEIMVKELFDKEVITGERVREIISEYEAANNLESRL
                     IPLEEQAS"
     misc_feature    complement(437993..438289)
                     /locus_tag="HPSH112_02160"
                     /note="FtsH Extracellular; Region: FtsH_ext; pfam06480"
                     /db_xref="CDD:253758"
     misc_feature    complement(436499..437986)
                     /locus_tag="HPSH112_02160"
                     /note="ATP-dependent metalloprotease FtsH; Region:
                     FtsH_fam; TIGR01241"
                     /db_xref="CDD:233327"
     misc_feature    complement(437312..437818)
                     /locus_tag="HPSH112_02160"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(437684..437707)
                     /locus_tag="HPSH112_02160"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(437381..437383,437528..437530,
                     437681..437704))
                     /locus_tag="HPSH112_02160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(437525..437542)
                     /locus_tag="HPSH112_02160"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(437339..437341)
                     /locus_tag="HPSH112_02160"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(436505..437074)
                     /locus_tag="HPSH112_02160"
                     /note="Peptidase family M41; Region: Peptidase_M41;
                     pfam01434"
                     /db_xref="CDD:250619"
     gene            complement(438343..439332)
                     /gene="prmA"
                     /locus_tag="HPSH112_02165"
                     /db_xref="GeneID:12771595"
     CDS             complement(438343..439332)
                     /gene="prmA"
                     /locus_tag="HPSH112_02165"
                     /EC_number="2.1.1.-"
                     /note="COG2264 Ribosomal protein L11 methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11 methyltransferase"
                     /protein_id="YP_006227145.1"
                     /db_xref="GI:386753927"
                     /db_xref="GeneID:12771595"
                     /translation="MLKPMYYEFFFIFPKEQELFESFLLDTTHLALEESSLENLKAFD
                     DKETIEFISQSSWHYFATHDPLKENLKEKPPHLKNFVILRSQKDLNDLLIPALEAFCL
                     SLQQNLQSGFDFFYLSRNLASKDWLEAYKQAILPVQCAKFYIYSSWHQKPSHVATDDS
                     IMIDPALAFGSGHHESTSMCLELLSNLDLKRKNALDVGCGSGILSIALKKQGVSALSA
                     CDTDSLAVEETLKNFSLNQITLLAQDKVIHGSTQKIEGRFDIIVANIVADVIKSLYSE
                     FVRLCNHTLILSGILETHLNSVLQIYYNGFEVLEQRQRNEWVALKLLKKQSIN"
     misc_feature    complement(438379..439317)
                     /gene="prmA"
                     /locus_tag="HPSH112_02165"
                     /note="ribosomal protein L11 methyltransferase; Region:
                     prmA; TIGR00406"
                     /db_xref="CDD:232960"
     misc_feature    complement(438478..438756)
                     /gene="prmA"
                     /locus_tag="HPSH112_02165"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(438541..438543,438592..438594,
                     438601..438606,438670..438675,438724..438744))
                     /gene="prmA"
                     /locus_tag="HPSH112_02165"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(439333..439707)
                     /locus_tag="HPSH112_02170"
                     /db_xref="GeneID:12771596"
     CDS             complement(439333..439707)
                     /locus_tag="HPSH112_02170"
                     /note="COG0784 FOG: CheY-like receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_006227146.1"
                     /db_xref="GI:386753928"
                     /db_xref="GeneID:12771596"
                     /translation="MKLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLNAN
                     ADTKVLITDWNMPEMNGLDLVIKVRADERFKEIPIIMITTEGGKAEVITALKAGVNNY
                     IVKPFTPQVLKEKLEVVLGTND"
     misc_feature    complement(<439348..439707)
                     /locus_tag="HPSH112_02170"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(439348..439698)
                     /locus_tag="HPSH112_02170"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(439390..439395,439402..439404,
                     439459..439461,439525..439527,439549..439551,
                     439684..439689))
                     /locus_tag="HPSH112_02170"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(439549..439551)
                     /locus_tag="HPSH112_02170"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(439525..439533,439537..439542))
                     /locus_tag="HPSH112_02170"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(439387..439395)
                     /locus_tag="HPSH112_02170"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            439998..440600
                     /locus_tag="HPSH112_02175"
                     /db_xref="GeneID:12771597"
     CDS             439998..440600
                     /locus_tag="HPSH112_02175"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein HorD"
                     /protein_id="YP_006227147.1"
                     /db_xref="GI:386753929"
                     /db_xref="GeneID:12771597"
                     /translation="MYYLRILILSISFLNILNAENLSYMSSSYQVGMVFMRPLNTNKL
                     LQGASILQGYEVNPKNDWAYSRYYFFIDYGNVLFNNDSTLQANMFTYGVGGDFMVAYA
                     KNPINRWAFFFGLQLAANTWILNNKVKDLVVNTWDSLKDFNFRNTYFRAIGKFGVQFR
                     TIVLYHKVDVEIGMKIFLTPERRSLFERSFLFFVSHSWHF"
     misc_feature    440142..440597
                     /locus_tag="HPSH112_02175"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            complement(440602..440689)
                     /locus_tag="HPSH112_t08202"
                     /db_xref="GeneID:12771598"
     tRNA            complement(440602..440689)
                     /locus_tag="HPSH112_t08202"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:12771598"
     gene            complement(440732..441139)
                     /locus_tag="HPSH112_02180"
                     /db_xref="GeneID:12771599"
     CDS             complement(440732..441139)
                     /locus_tag="HPSH112_02180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227148.1"
                     /db_xref="GI:386753930"
                     /db_xref="GeneID:12771599"
                     /translation="MLILGHPLIPSDRFIFIKNTDGVHSSTNNDIVCFEAHPKNLELA
                     KYCCENSVHFSVIFLSHKIETDTFFLFNAFKPLYCIFKDIKQAILAQQHATNYLLDSK
                     ILFSMDLNDTELWEICAKNQVDGVISKDSLLLK"
     gene            complement(441142..441372)
                     /locus_tag="HPSH112_02185"
                     /db_xref="GeneID:12771600"
     CDS             complement(441142..441372)
                     /locus_tag="HPSH112_02185"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227149.1"
                     /db_xref="GI:386753931"
                     /db_xref="GeneID:12771600"
                     /translation="MLRILIPLLIIVWVLWRLFLRQKPLKDNHSYTQQTPKELEDHMI
                     VCSKCQTYVSSKDAIYSGAVAYCSETCLKDKR"
     gene            complement(441366..441902)
                     /gene="gidB"
                     /locus_tag="HPSH112_02190"
                     /db_xref="GeneID:12771601"
     CDS             complement(441366..441902)
                     /gene="gidB"
                     /locus_tag="HPSH112_02190"
                     /note="COG0357 Predicted S-adenosylmethionine-dependent
                     methyltransferase involved in bacterial cell division"
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase GidB"
                     /protein_id="YP_006227150.1"
                     /db_xref="GI:386753932"
                     /db_xref="GeneID:12771601"
                     /translation="MNPLLQDYARILLEWNQTHNLSGAKHLSELEPQITDALKPLEFI
                     KDFKSCLDIGSGAGLPAIPLALEKPEVKFILLEPRIKRAAFLSYLKSVLPLRNIEIVK
                     KRLEDYQNLLQVDLITSRAVASSSFLIEKSQRFLKDKGYFLFYKGEQLKDEIACKDTE
                     CFMHQRRIYFYKSKESLC"
     misc_feature    complement(441471..441752)
                     /gene="gidB"
                     /locus_tag="HPSH112_02190"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(441543..441545,441588..441596,
                     441669..441674,441726..441746))
                     /gene="gidB"
                     /locus_tag="HPSH112_02190"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(441899..442936)
                     /gene="queA"
                     /locus_tag="HPSH112_02195"
                     /db_xref="GeneID:12771602"
     CDS             complement(441899..442936)
                     /gene="queA"
                     /locus_tag="HPSH112_02195"
                     /EC_number="5.-.-.-"
                     /note="COG0809
                     S-adenosylmethionine:tRNA-ribosyltransferase-isomerase
                     (queuine synthetase)"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine--tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="YP_006227151.1"
                     /db_xref="GI:386753933"
                     /db_xref="GeneID:12771602"
                     /translation="MKEFDLESYDYDLPKELIANYPILPKEKAKLLVYERRSQKITHT
                     TFEHVLDFFPKNALVVLNDTKVIKARLFGSKHAFLPSKTTEVFFHRFFKDNTALTQIK
                     GKIKVGDKIFFDANYHAEVLELLHNGQRLIAFYGNKTPLNQANILKLLEQYGHMPLPP
                     YIKRADESLDTHEYQSVFAKHMGAVAAPTASLHFSQNTLEKLLKDFKHAFLTLHVGAG
                     TFLGVETKDIREHQIHTEVLRIPKKSQEILQKTQEILCIGTTALRSVEYFKRLENPNQ
                     EAFECDIFLHLANPILHVNYLLTNFHLPKSSLLMLVSAMIGLEKTKEIYQIAIEKKYR
                     FYSYGDGMLIL"
     misc_feature    complement(441902..442924)
                     /gene="queA"
                     /locus_tag="HPSH112_02195"
                     /note="S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase; Region: queA; TIGR00113"
                     /db_xref="CDD:232830"
     gene            complement(442937..443734)
                     /locus_tag="HPSH112_02200"
                     /db_xref="GeneID:12771603"
     CDS             complement(442937..443734)
                     /locus_tag="HPSH112_02200"
                     /note="COG0805 Sec-independent protein secretion pathway
                     component TatC"
                     /codon_start=1
                     /transl_table=11
                     /product="Sec-independent protein translocase protein
                     tatC-like protein"
                     /protein_id="YP_006227152.1"
                     /db_xref="GI:386753934"
                     /db_xref="GeneID:12771603"
                     /translation="MFEDLKPHLQELRKRLMVSVGTILVAFLGCFHFWKSIFEFVKNS
                     YKGTLIQLSPIEGVMVAVKISFSAAIVISMPIIFWQLWLFIAPGLYKNEKKVILPFVF
                     FGSGMFLIGAAFSYYVVFPFIIEYLATFGSDVFAANISASSYVSFFTRLILGFGVAFE
                     LPVLAYFLAKVGLITDASLKAYFKYAIVVIFIVAAIITPPDVVSQIFMALPLVGLYGL
                     SILIAKMVNPAPKDSENDNENDNENDNENDNAKDSENNAKENEKSES"
     misc_feature    complement(443036..443734)
                     /locus_tag="HPSH112_02200"
                     /note="Sec-independent protein secretion pathway component
                     TatC [Intracellular trafficking and secretion]; Region:
                     TatC; COG0805"
                     /db_xref="CDD:223876"
     gene            complement(443727..444209)
                     /locus_tag="HPSH112_02205"
                     /db_xref="GeneID:12771604"
     CDS             complement(443727..444209)
                     /locus_tag="HPSH112_02205"
                     /note="COG1826 Sec-independent protein secretion pathway
                     components"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent translocase"
                     /protein_id="YP_006227153.1"
                     /db_xref="GI:386753935"
                     /db_xref="GeneID:12771604"
                     /translation="MFGMGFFEILVVLVVAIIFLGPEKFPQAVVDMVKFFRAVKKTLN
                     DAKDTLDKEINIEEIKKETLEYQKLFENKVESLKGVKIEELEDAKVTAENEIKSIQDL
                     MQDYQRSLETNTTPNHLSEEVSNEEALNKEVSSDESPKEVKLATDNNTKEHDKEKEHV
                     "
     misc_feature    complement(443739..444209)
                     /locus_tag="HPSH112_02205"
                     /note="sec-independent translocase; Provisional; Region:
                     PRK04098"
                     /db_xref="CDD:235219"
     gene            complement(444477..446591)
                     /locus_tag="HPSH112_02210"
                     /db_xref="GeneID:12771605"
     CDS             complement(444477..446591)
                     /locus_tag="HPSH112_02210"
                     /note="COG0270 Site-specific DNA methylase"
                     /codon_start=1
                     /transl_table=11
                     /product="putative site-specific DNA-methyltransferase"
                     /protein_id="YP_006227154.1"
                     /db_xref="GI:386753936"
                     /db_xref="GeneID:12771605"
                     /translation="MLTYADLFAGIGGFRLALDSLGLKCVFSAENNPHAIAMYQANFD
                     DDSTCDITLLNPNTMPNFDILCAGFPCQAFSVCGKQKGFEDTTRGTLFFDICRILKNK
                     KPKIFILENVKNLLKHNKGNTLFVMLQALSNLGYSVSYQILNAKNFSVPQNRERIIIV
                     GYLGSQVFDFNPIKTNPITDMQNFLDKSGHFEILEPYEYTLLDNQLLKRQNSGLIFCG
                     YRNKKIRTKGTRENTEHLSRVHKQPNRIYHVKGIHPTIASQEQSGRYFIYTDNLVRKL
                     TLNECFSFMGFPKDFKKIGTNSQLYERIGNSVCVPMIKAIMKEVLNQFYKQPLKENNM
                     QNKILEFLEKIYKECVSLKNLDSLNLSKTQLQKAQMIVEKEETFKGVYTVLITSLVYK
                     SNYHEQDIRFHQANMKNGYSGRSFDTKFITPFLKQKQFLGAMKESGWLTRSLEQNLPY
                     TIDYPGKISSVSIKKAFLEILDDVEKNPNLSTPYLKALFYLSIREKTRKAIILVKPII
                     KESSYSIDFIINTLQKHFNYAYKSRGASILPVVALFSIYECLILELGRFTNKSLKPLD
                     SHYSCDRSSGNAGDIVILDEQKQLFEVIEIKFNIAIDSIMLQDAYKKIAQTPIKRYYI
                     LSTLPIQNKTELQKIIDKIEHEHGCQVIVNGIYDTLKYYLRLIKNTEHFINNYLKNIS
                     QNTEINEEHKLAWNNIIDSKIN"
     misc_feature    complement(445626..446588)
                     /locus_tag="HPSH112_02210"
                     /note="Cytosine-C5 specific DNA methylases; Methyl
                     transfer reactions play an important role in many aspects
                     of biology. Cytosine-specific DNA methylases are found
                     both in prokaryotes and eukaryotes. DNA methylation, or
                     the covalent addition of a methyl group...; Region:
                     Cyt_C5_DNA_methylase; cd00315"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(446382..446384,446388..446390,
                     446436..446444,446496..446507,446553..446570))
                     /locus_tag="HPSH112_02210"
                     /note="cofactor binding site; other site"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(445674..445676,445911..445916,
                     445992..445997,446016..446018,446034..446036,
                     446124..446126,446130..446132,446253..446258,
                     446262..446264,446328..446330,446349..446351,
                     446358..446369,446376..446381,446388..446390))
                     /locus_tag="HPSH112_02210"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238192"
     misc_feature    complement(order(445674..445676,446124..446126,
                     446130..446132,446256..446258,446262..446264,
                     446367..446369,446379..446381,446388..446390))
                     /locus_tag="HPSH112_02210"
                     /note="substrate interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:238192"
     gene            complement(446749..447765)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /db_xref="GeneID:12771606"
     CDS             complement(446749..447765)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /EC_number="3.6.1.-"
                     /note="COG2255 Holliday junction resolvasome, helicase
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="YP_006227155.1"
                     /db_xref="GI:386753937"
                     /db_xref="GeneID:12771606"
                     /translation="MKERIVNLETLDFETSQEASLRPNLWEDYIGQEKIKSNLQVSIC
                     AAKKRQESLDHMLFFGPPGLGKTSISHIIAKEMETNLKITAAPMIEKSGDLAAILTNL
                     QAKDILFIDEIHRLSPAIEEVLYPAMEDFRLDIIIGSGPAAQTIKIDLPPFTLIGATT
                     RAGMLSNPLRDRFGMSFRMQFYNPSELALIIKKAAAKLNQDIKEESADEIAKRSRGTP
                     RIALRLLKRVRDFALVKNSSLMDLNITLHALNELGVNELGFDEADLAYLSLLANAQGR
                     PVGLNTIAASMREDEGTIEDVIEPFLLANGYLERTAKGRIATPKTHALLKIPTTTPTP
                     ASLF"
     misc_feature    complement(446782..447756)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="Holliday junction DNA helicase RuvB; Reviewed;
                     Region: ruvB; PRK00080"
                     /db_xref="CDD:234619"
     misc_feature    complement(447226..447678)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(447565..447588)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(447286..447288,447433..447435,
                     447562..447585))
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(447430..447447)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(447250..447252)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(446782..447003)
                     /gene="ruvB"
                     /locus_tag="HPSH112_02215"
                     /note="Holliday junction DNA helicase ruvB C-terminus;
                     Region: RuvB_C; pfam05491"
                     /db_xref="CDD:253217"
     gene            complement(447766..448578)
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /db_xref="GeneID:12771607"
     CDS             complement(447766..448578)
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /EC_number="2.1.2.11"
                     /note="COG0413 Ketopantoate hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="YP_006227156.1"
                     /db_xref="GI:386753938"
                     /db_xref="GeneID:12771607"
                     /translation="MSMQTAPIKKITLNHLQAKKNQEKIIAITAYDALFAQIFDPLVD
                     VILVGDSLNMSFFNQNDTLNASVGMMLYHTKAVCAGAKIPFIITDMPFGSYKDEKTAL
                     KNAIRVYKETQASAIKLEGGKEKAKLVKTLTDEGVIVVGHIGLMPQFVRLDGGYKIKG
                     KNEEQQKKLLEDALSLEEAGAGLLVLEGITTPIAQKITQTIKIPTIGIGSGKDCDGQI
                     LVWSDMLGFFDSFKPKFVREYLKGKELVQNAIKQYADDVKKGNFPNELESYH"
     misc_feature    complement(447790..448542)
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /note="Ketopantoate hydroxymethyltransferase (KPHMT) is
                     the first enzyme in the pantothenate biosynthesis pathway.
                     Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes
                     the first committed step in the biosynthesis of
                     pantothenate (vitamin B5), which is a...; Region:
                     KPHMT-like; cd06557"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(447838..447852,447859..447861,
                     447901..447906,447913..447915,448033..448035,
                     448117..448128,448132..448137,448165..448182,
                     448234..448236,448249..448254,448261..448263,
                     448273..448275,448300..448305,448342..448344,
                     448351..448353,448360..448365,448372..448374,
                     448387..448392,448402..448419,448423..448425,
                     448465..448467,448474..448485,448537..448542))
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /note="oligomerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(447919..447921,447925..447927,
                     448018..448020,448138..448140,448153..448155,
                     448225..448227,448312..448314,448426..448434,
                     448438..448440,448492..448494))
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /note="active site"
                     /db_xref="CDD:119342"
     misc_feature    complement(order(448225..448227,448312..448314,
                     448429..448431))
                     /gene="panB"
                     /locus_tag="HPSH112_02220"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119342"
     gene            448727..449449
                     /locus_tag="HPSH112_02225"
                     /db_xref="GeneID:12771608"
     CDS             448727..449449
                     /locus_tag="HPSH112_02225"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227157.1"
                     /db_xref="GI:386753939"
                     /db_xref="GeneID:12771608"
                     /translation="MGLKKYVILWFLMGFYSGLNALDYDTLDPKYYKYIKYYKAYEDK
                     EVEELIKDLKRANAKSGLILGINTGFFYNHEIMVRTNSSSITGNILNYLFAYGLRFGY
                     QTFRPSFFARLVKPNIIGRRIYIQYYGGAPKKAGFGSVGFQSVMLNGDFLLDIPLPFV
                     GKYLYMGGYMGLGLGVVAHGVNYTAEWGMSFNAGLALTVLEKNRIELEFKILNNFPFL
                     QSNSSKETWWGAIASIGYQYVF"
     gene            449439..450293
                     /locus_tag="HPSH112_02230"
                     /db_xref="GeneID:12771609"
     CDS             449439..450293
                     /locus_tag="HPSH112_02230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227158.1"
                     /db_xref="GI:386753940"
                     /db_xref="GeneID:12771609"
                     /translation="MCSKKIKNLILCFGFILGLNAEENTAQENMTEENTPKDAPVLLE
                     EKRTQTLEFEENKEAKKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNK
                     SGFFIGVILGDIGINAHPNARSYESFEPSSNIQASPLLYGLRSGYQKYFANGISALRF
                     YGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWNGMYQ
                     NLKEIKGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKEASQTFLYYFKSTNIY
                     YISYNYLL"
     misc_feature    449862..450284
                     /locus_tag="HPSH112_02230"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            450305..451246
                     /locus_tag="HPSH112_02235"
                     /db_xref="GeneID:12771610"
     CDS             450305..451246
                     /locus_tag="HPSH112_02235"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227159.1"
                     /db_xref="GI:386753941"
                     /db_xref="GeneID:12771610"
                     /translation="MKFKYCLIYIALILGLQATDYDNLEEENQQLDEKINHLKQQLTE
                     KGVSPKEINKDKFEEEYIDRSYPKISSKKKEKLLKSFSIADDKSGVFLGGGYAYGELN
                     LSYQGEMLDRYGTNAPSAFKNNISLNAPVSMISTKFGYQKYFVPYFGTRFYGDLLLGG
                     GVLKENALKQPVGSFIYVLGAMNTDLLFDMPLDFKTKKHFLGVYAGFGIGLMLYQDKP
                     NQNGRNLVVGGYSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMGV
                     EEGAVYQNKEDDERLLVSANNQFKRSSFLLVNYAFIF"
     misc_feature    450707..451243
                     /locus_tag="HPSH112_02235"
                     /note="Helicobacter outer membrane protein; Region:
                     HP_OMP; pfam01856"
                     /db_xref="CDD:250918"
     gene            451256..452578
                     /locus_tag="HPSH112_02240"
                     /db_xref="GeneID:12771611"
     CDS             451256..452578
                     /locus_tag="HPSH112_02240"
                     /note="COG0739 Membrane proteins related to
                     metalloendopeptidases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227160.1"
                     /db_xref="GI:386753942"
                     /db_xref="GeneID:12771611"
                     /translation="MELRFKILAIVVLILVGYLIFNALITKPKALSFSLNSKEGALNS
                     NDEALFWDLKKPIKIKIVAPKGIKRYELKVTTQDDLILYEKENLVLDKPKSLEVPLIK
                     PEIMGLEDKCLLYEIQANDWSYANFFNGNKASFKQEVCVDTIKPSITILSRSPSIAYG
                     GSAIVVFEALDKNLSQAFVRVKKKDFEAFRLLEFKQRNVFIALVPWSYKNKDFKAFIV
                     AKDKAYNSNTIPILFKRKTHRLREKDIDLSALKDKIAKQEKSQNHTEQTLLERFSNAR
                     PKDLEKIHKIVLEQGDFYKDFSHFQALKPLNGPFKMASNFLENRRILRDNQVLFQFLH
                     LGVDLIPGKDLSLAFDSSVKRVFKGELDFYGNSLINCYGLGLCVFLAHLKDDESVGSS
                     GLKLGSGLHLGTLLQGVFVRPNEWLNEQWIKTNIIAPIEQAKWLLMKG"
     misc_feature    <451886..452575
                     /locus_tag="HPSH112_02240"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     gene            452581..453168
                     /gene="minC"
                     /locus_tag="HPSH112_02245"
                     /db_xref="GeneID:12771612"
     CDS             452581..453168
                     /gene="minC"
                     /locus_tag="HPSH112_02245"
                     /note="COG0850 Septum formation inhibitor"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation inhibitor"
                     /protein_id="YP_006227161.1"
                     /db_xref="GI:386753943"
                     /db_xref="GeneID:12771612"
                     /translation="MLKTNQKNVHAFEIEKQEPEAVIGFLEKNHALLQYFLIIFKYDI
                     EPEVKAILRKHQLLFLETNRPLNGRHIKTMSIKEETNHPAPNHSKTEPKTTIYERHIR
                     SGEEIYSANHLIFLGNIHNGAKIISEGCVSVYGVCEGAIVCFGECLILKEVKSVQIVF
                     QNKILSLKEIERLLVNKNIKIITKNDDILDIKEVL"
     misc_feature    452584..453165
                     /gene="minC"
                     /locus_tag="HPSH112_02245"
                     /note="septum formation inhibitor; Reviewed; Region: minC;
                     PRK00556"
                     /db_xref="CDD:234791"
     misc_feature    452860..453159
                     /gene="minC"
                     /locus_tag="HPSH112_02245"
                     /note="Septum formation inhibitor MinC, C-terminal domain;
                     Region: MinC_C; pfam03775"
                     /db_xref="CDD:146423"
     gene            453165..454052
                     /gene="lpxC"
                     /locus_tag="HPSH112_02250"
                     /db_xref="GeneID:12771613"
     CDS             453165..454052
                     /gene="lpxC"
                     /locus_tag="HPSH112_02250"
                     /EC_number="3.5.1.-"
                     /note="COG0774 UDP-3-O-acyl-N-acetylglucosamine
                     deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
                     deacetylase"
                     /protein_id="YP_006227162.1"
                     /db_xref="GI:386753944"
                     /db_xref="GeneID:12771613"
                     /translation="MKQTTINHSVELVGIGLHKGVPVKLVLEPLEENQGIVFYRSDLG
                     VKLPLKPENIVDTKMATVLGKDNARISTIEHLLSAVHAYGIDNLKISVDNEEIPIMDG
                     SALAYCMLLDEAGIKELDAPKKVMEIKQAIEVREGDKFVKIEPDSQLSLNFAIDFNHP
                     VIAKQAHHFVFSKTAYKEQVAKARTFGFLQEVNYLRSIGLAKGGSLNNCIVLDENSIL
                     NKEGLRCEKEFVCHKILDAMGDLMVLGMPVMGKYTSFSGSHKLNSMLVKAILADAKNY
                     EVLIATDPAKEFALQKAFA"
     misc_feature    453165..454046
                     /gene="lpxC"
                     /locus_tag="HPSH112_02250"
                     /note="UDP-3-0-acyl N-acetylglucosamine deacetylase;
                     Region: lpxC; TIGR00325"
                     /db_xref="CDD:188041"
     misc_feature    453165..453986
                     /gene="lpxC"
                     /locus_tag="HPSH112_02250"
                     /note="UDP-3-O-acyl N-acetylglycosamine deacetylase;
                     Region: LpxC; pfam03331"
                     /db_xref="CDD:202596"
     gene            454074..454547
                     /locus_tag="HPSH112_02255"
                     /db_xref="GeneID:12771614"
     CDS             454074..454547
                     /locus_tag="HPSH112_02255"
                     /note="COG1214 Inactive homolog of metal-dependent
                     proteases, putative molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227163.1"
                     /db_xref="GI:386753945"
                     /db_xref="GeneID:12771614"
                     /translation="MELDLVLVSLGEKVLLGVYQNNFLCASYTSKAKTSEALVEVFSQ
                     LFEDFKNPTLPAIKGVYYAKGPGSFTSLKLTHVFLHTLALIHDFELYSTTGFDFNGNT
                     PILAYANKYFVSKEMESLSDFKDLKIAPKDFMLPPFLEKDKFTQLNTPFYILPPI"
     misc_feature    454074..454544
                     /locus_tag="HPSH112_02255"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214"
                     /db_xref="CDD:224135"
     gene            454602..455483
                     /locus_tag="HPSH112_02260"
                     /db_xref="GeneID:12771615"
     CDS             454602..455483
                     /locus_tag="HPSH112_02260"
                     /EC_number="2.7.1.39"
                     /note="COG0083 Homoserine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine kinase"
                     /protein_id="YP_006227164.1"
                     /db_xref="GI:386753946"
                     /db_xref="GeneID:12771615"
                     /translation="MVVSVPATSANLGPGFDCLGLSLNLRNRFFIEPSSFHAVKLVGE
                     GEGIPKFLTNNIFTKVFYEILKKHGNDGSFKFLLHNKVPITRGMGSSSAMIVGAVASA
                     FAFLGFAFDRENIVNTALIYENHPDNITPAVFGGYNAAFVEKKKVISLKTTIPSFLKA
                     VMVIPNRAISTKQSRHLLPKRYSVQESVFNLSHASLMTMAIVQGKWDLLRCCSKDRMH
                     QYKRMQTYPVLFAIQKLALENNALMSTLSGSGSSFFNMCYEEDAPKLKQVLSKKFPKF
                     RVAVLDFDNDGVLVEKD"
     misc_feature    454602..455474
                     /locus_tag="HPSH112_02260"
                     /note="homoserine kinase; Region: thrB; TIGR00191"
                     /db_xref="CDD:129295"
     misc_feature    454824..455009
                     /locus_tag="HPSH112_02260"
                     /note="GHMP kinases N terminal domain; Region:
                     GHMP_kinases_N; pfam00288"
                     /db_xref="CDD:249743"
     gene            455470..455724
                     /locus_tag="HPSH112_02265"
                     /db_xref="GeneID:12771616"
     CDS             455470..455724
                     /locus_tag="HPSH112_02265"
                     /note="COG2740 Predicted nucleic-acid-binding protein
                     implicated in transcription termination"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227165.1"
                     /db_xref="GI:386753947"
                     /db_xref="GeneID:12771616"
                     /translation="MRKTEIKIRMCVACRMRQPQKDLLRLKSFENQIMEFDGKGRSFY
                     VCENCLKNGEKKLLKAVSKIKNAPKDTKNIITWIKERSIA"
     misc_feature    455470..455718
                     /locus_tag="HPSH112_02265"
                     /note="Predicted nucleic-acid-binding protein implicated
                     in transcription termination [Transcription]; Region:
                     COG2740"
                     /db_xref="CDD:225350"
     misc_feature    order(455494..455496,455542..455544,455599..455601)
                     /locus_tag="HPSH112_02265"
                     /note="putative RNA binding cleft [nucleotide binding];
                     other site"
                     /db_xref="CDD:238173"
     gene            455721..458576
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /db_xref="GeneID:12771617"
     CDS             455721..458576
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="COG0532 Translation initiation factor 2 (IF-2;
                     GTPase)"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-2"
                     /protein_id="YP_006227166.1"
                     /db_xref="GI:386753948"
                     /db_xref="GeneID:12771617"
                     /translation="MSEMVDLKKFLTELGKTQKELKNVIEQAKDIGLELKTNSKMTPE
                     QAGKLYKYIVDGIKEQIQANKPTKNPEQDNKDDLNITATPKPLNKKVSKTPKKEETKS
                     QPKPKKTKEKKKEAPVPIAKKKGGIEIVNTFEDQTLENTPKVVSHSQIEKAKQKLQEI
                     QKSREALSKLTQSNANSANNANNVNNANNVNNAKKEISEVKKQEQEIKRHENIKRRTG
                     FRVIKRNDETENETENSVAESKRPTQSAAAIFEDIKKEWQEKDKQEAKKAKKPSKPKA
                     TPTAKNNKSHKIDFSDARDFKGNDIYDDETDEILLFDLHEQDNFNKEEEEKEIRQNIN
                     DRVRVQRKNPWMNESGIKRQSKKKHAFRNDNSQKVIQSAISIPEEVRVYEFAQKANLN
                     LADVIKTLFNLGLMVTKNDFLDKDSIEILAEEFHLEISVQNTLEEFEVEEVLEGVKKE
                     RPPVVTIMGHVDHGKTSLLDKIRDKRVAHTEAGGITQHIGAYMVEKNDKWVSFIDTPG
                     HEAFSQMRNRGAQVTDIAVIVIAADDGVKQQTIEALEHAKAANVPVIFAMNKMDKPNV
                     NPDKLKAECAELGYNPVDWGGEYEFIPVSAKTGDGIDNLLETILIQADIMELKAIEEG
                     SARAVVLEGSVEKGRGAVATVIVQSGTLSVGDSFFAETAFGKVRTMTDDQGKSIQNLK
                     PSMVALITGLSEVPPAGSVLIGVENDSIARLQAQKRATYLRQKALSKSTKVSFDELSE
                     MVANKELKNIPVVIKADTQGSLEAIKNSLLELNNEEVAIQVIHSGVGGITENDLSLVS
                     SSDHAVILGFNIRPTGNVKNKAKEYNVSIKTYTVIYALIEEMRSLLLGLMSPIIEEEH
                     TGQAEVRETFNIPKVGTIAGCVVSDGVIARGIKARLIRDGVVIHTGEILSLKRFKDDV
                     KEVSKGYECGIMLDNYNEIKVGDVFETYKEIHKKRTL"
     misc_feature    456825..458573
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="translation initiation factor IF-2; Region: IF-2;
                     TIGR00487"
                     /db_xref="CDD:232995"
     misc_feature    456849..457004
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="Translation initiation factor IF-2, N-terminal
                     region; Region: IF2_N; pfam04760"
                     /db_xref="CDD:252785"
     misc_feature    457077..457568
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="Initiation Factor 2 (IF2)/ eukaryotic Initiation
                     Factor 5B (eIF5B) family; Region: IF2_eIF5B; cd01887"
                     /db_xref="CDD:206674"
     misc_feature    457095..457118
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="G1 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(457098..457100,457104..457106,457116..457121,
                     457128..457130,457137..457142,457188..457193,
                     457245..457250,457317..457322,457425..457427,
                     457437..457439)
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206674"
     misc_feature    order(457101..457121,457248..457250,457395..457400,
                     457404..457409,457503..457511)
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206674"
     misc_feature    457170..457190
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206674"
     misc_feature    457176..457178
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="G2 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    457233..457244
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="G3 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    457239..457295
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206674"
     misc_feature    457395..457406
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="G4 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    457503..457511
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="G5 box; other site"
                     /db_xref="CDD:206674"
     misc_feature    457596..457877
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="This family represents the domain II of bacterial
                     Initiation Factor 2 (IF2) and its eukaryotic mitochondrial
                     homologue mtIF2. IF2, the largest initiation factor is an
                     essential GTP binding protein. In E. coli three natural
                     forms of IF2 exist in the cell; Region: IF2_mtIF2_II;
                     cd03702"
                     /db_xref="CDD:239673"
     misc_feature    457917..458243
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="Translation-initiation factor 2; Region: IF-2;
                     pfam11987"
                     /db_xref="CDD:256778"
     misc_feature    458292..458543
                     /gene="infB"
                     /locus_tag="HPSH112_02270"
                     /note="mtIF2_IVc: this family represents the C2 subdomain
                     of domain IV of mitochondrial translation initiation
                     factor 2 (mtIF2) which adopts a beta-barrel fold
                     displaying a high degree of structural similarity with
                     domain II of the translation elongation factor...; Region:
                     mtIF2_IVc; cd03692"
                     /db_xref="CDD:239663"
     gene            458576..458911
                     /gene="rbfA"
                     /locus_tag="HPSH112_02275"
                     /db_xref="GeneID:12771618"
     CDS             458576..458911
                     /gene="rbfA"
                     /locus_tag="HPSH112_02275"
                     /note="COG0858 Ribosome-binding factor A"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-binding factor A"
                     /protein_id="YP_006227167.1"
                     /db_xref="GI:386753949"
                     /db_xref="GeneID:12771618"
                     /translation="MNAHKERLESNLLELLQEALASLNDSELNSLSVTKVECSKGKHH
                     AFVFVLSQDHKILSKLKKAEGLIRQFVLQASGWFKCPKLSFVLDNSLEKQLRLDAIFN
                     EIAKGKDND"
     misc_feature    458576..458896
                     /gene="rbfA"
                     /locus_tag="HPSH112_02275"
                     /note="Ribosome-binding factor A; Region: RBFA; cl00542"
                     /db_xref="CDD:260489"
     gene            458904..459344
                     /locus_tag="HPSH112_02280"
                     /db_xref="GeneID:12771619"
     CDS             458904..459344
                     /locus_tag="HPSH112_02280"
                     /note="COG0779 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribosome maturation factor rimP"
                     /protein_id="YP_006227168.1"
                     /db_xref="GI:386753950"
                     /db_xref="GeneID:12771619"
                     /translation="MTKKIEEKIEGVIESLGYLLYDVSLIKENEQHVLRVSLKNPNGA
                     VSLDICQQVSEIISPLLDVCDFIQDAYILEVSSMGLERTLKTPKHFKLSLGEKVGVKL
                     TNKESFQAVLKDANDLSADFELEDHAIKSVEYKDLKKVKTLFEW"
     misc_feature    458913..>459206
                     /locus_tag="HPSH112_02280"
                     /note="Sm and related proteins; Region: Sm_like; cl00259"
                     /db_xref="CDD:260307"
     misc_feature    459138..459341
                     /locus_tag="HPSH112_02280"
                     /note="Bacillus subtilis YxlS-like, C-terminal domain;
                     Region: YlxS_C; cd01734"
                     /db_xref="CDD:212481"
     misc_feature    order(459204..459206,459219..459221,459225..459227,
                     459243..459245,459264..459266,459288..459296,
                     459300..459305,459309..459326)
                     /locus_tag="HPSH112_02280"
                     /note="putative oligomer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212481"
     misc_feature    order(459249..459251,459255..459257,459300..459302)
                     /locus_tag="HPSH112_02280"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212481"
     gene            complement(459452..461440)
                     /locus_tag="HPSH112_02285"
                     /db_xref="GeneID:12771620"
     CDS             complement(459452..461440)
                     /locus_tag="HPSH112_02285"
                     /EC_number="6.2.1.1"
                     /note="COG0365 Acyl-coenzyme A synthetases/AMP-(fatty)
                     acid ligases"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="YP_006227169.1"
                     /db_xref="GI:386753951"
                     /db_xref="GeneID:12771620"
                     /translation="MQSDDDLEFAKKVFNPNRAFAKQARIKNMCEYKDLVHEANEDYE
                     HFWGELAKQKLTWFKPFDKVLNSDNTPFFKWFENGKINVSYNCIDRHLKDKKNKVAII
                     FEGEMGDYNVITYRKLHSEVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACAR
                     IGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPALDKALENNACP
                     SVEKVLIVIRNAKEIDYVRGRDFVYNEMVNYQSGKCQPEMMDSEDPLFLLYTSGSTGK
                     PKGVQHSSAGYLLWAQMTMEWVFDIRDNDNFWCTADIGWITGHTYVVYGPLACGATTL
                     ILEGTMSYPDYGRWWRMIEEYRVDKFYTSPTAIRMLHAKGENEPLKYNLDSLKVLGTV
                     GEPINPTAWKWFYEKIGNSKCSIVDTWWQTETGGHIISPLPGATPIRASCATLPLPGI
                     HAEVLNEDGTQTKPGEQGFLCITKPWPSMIRNVWGDEKRYIDSYFSQIKLNGEYVYLS
                     GDGAIVDENGYITIIGRTDDIVNVSGHRIGTAEVESAISKHEMVAECAVVGIPDTIKG
                     EGLFAFVVLCDGAKCNLGESLELLKEMNHILSIEIGKIAKLDNVMYVPGLPKTRSGKI
                     MRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQMEE"
     misc_feature    complement(459455..461404)
                     /locus_tag="HPSH112_02285"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     misc_feature    complement(459500..461332)
                     /locus_tag="HPSH112_02285"
                     /note="Acetyl-CoA synthetase (also known as acetate-CoA
                     ligase and acetyl-activating enzyme); Region: ACS;
                     cd05966"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(459629..459634,459647..459649,
                     459833..459844,459866..459868,459875..459877,
                     459911..459913,460175..460192,460256..460267,
                     460334..460336,460343..460348,460418..460426,
                     460490..460495,460508..460510,460835..460837,
                     460841..460843,460850..460852,460928..460936))
                     /locus_tag="HPSH112_02285"
                     /note="active site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(459632..459634,459647..459649,
                     459836..459844,460334..460336,460343..460348,
                     460418..460426,460490..460492,460508..460510,
                     460835..460837,460841..460843,460850..460852,
                     460928..460936))
                     /locus_tag="HPSH112_02285"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(460607..460612,460616..460633,
                     460640..460642))
                     /locus_tag="HPSH112_02285"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(459833..459835,459866..459868,
                     459875..459877,459911..459913,460175..460192,
                     460256..460267,460490..460495))
                     /locus_tag="HPSH112_02285"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213313"
     misc_feature    complement(order(460181..460183,460262..460267,
                     460490..460495))
                     /locus_tag="HPSH112_02285"
                     /note="acetate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213313"
     gene            461640..462752
                     /locus_tag="HPSH112_02290"
                     /db_xref="GeneID:12771621"
     CDS             461640..462752
                     /locus_tag="HPSH112_02290"
                     /note="COG1408 Predicted phosphohydrolases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227170.1"
                     /db_xref="GI:386753952"
                     /db_xref="GeneID:12771621"
                     /translation="MLISIAFLLVLCLLNYSSFRMLKSFLTLKKISQYAYLGFFILLS
                     VGEAAFAFYRNIMPSHLFVLTSACSFVSFIVFIFSLSFYGFSYSIEKIDFLHSRRKSL
                     KNFLKLGFYLALLGYFWRGFYEGLARPKIKETPIYLDKLDKELKIILLTDMHVGSLLQ
                     KDFVDYIVEEVNQKEVDMVLIGGDLVDENIEKVKSFLLPLNNLKSAHGTFYVPGNHEY
                     YHGIEPILSFLDTLNLTILGNECVHLGGINLCGVYDYFARKHQNFAPDIDKALKKCNE
                     SKPTILLAHQPKQIRSLKESHSVDLVLSGHTHAGQIFPFSLLVKLAQTYLYGLYKHSD
                     TTQIYVSSGAGYWGVPLRFLAPSEIAYLRLLPKNQA"
     misc_feature    462069..462731
                     /locus_tag="HPSH112_02290"
                     /note="Bacillus subtilis YkuE and related proteins,
                     C-terminal metallophosphatase domain; Region: MPP_YkuE_C;
                     cd07385"
                     /db_xref="CDD:163628"
     misc_feature    462072..>462635
                     /locus_tag="HPSH112_02290"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    order(462093..462095,462099..462101,462189..462191,
                     462282..462287,462492..462494,462555..462557,
                     462561..462563)
                     /locus_tag="HPSH112_02290"
                     /note="putative active site [active]"
                     /db_xref="CDD:163628"
     misc_feature    order(462093..462095,462099..462101,462189..462191,
                     462282..462284,462492..462494,462555..462557,
                     462561..462563)
                     /locus_tag="HPSH112_02290"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163628"
     gene            463093..463764
                     /locus_tag="HPSH112_02295"
                     /db_xref="GeneID:12771622"
     CDS             463093..463764
                     /locus_tag="HPSH112_02295"
                     /note="COG0745 Response regulators consisting of a
                     CheY-like receiver domain and a winged-helix DNA-binding
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_006227171.1"
                     /db_xref="GI:386753953"
                     /db_xref="GeneID:12771622"
                     /translation="MRVLLIEKNSVLGGEIEKGLNAKGFMADVTESLEDGEYLMDIRN
                     YDLVMVSDKNALSFVSRIKEKHSSIVVLVSSDNPTSEEEIHAFEQGADDYIAKPYRSI
                     KALVARIEARLRFWGSNVIEIGDLIISPDEEKIIYKGREVEVKGKPFEVLTHLARHRD
                     QIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMDKPLGISTVETVRRRGYRFCYPK
                     PACEE"
     misc_feature    463093..463743
                     /locus_tag="HPSH112_02295"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    463102..463431
                     /locus_tag="HPSH112_02295"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(463111..463116,463255..463257,463315..463317,
                     463372..463374,463381..463386)
                     /locus_tag="HPSH112_02295"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    order(463240..463245,463249..463257)
                     /locus_tag="HPSH112_02295"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    463381..463389
                     /locus_tag="HPSH112_02295"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    463453..463734
                     /locus_tag="HPSH112_02295"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    order(463525..463527,463582..463587,463639..463641,
                     463648..463650,463672..463677,463708..463710,
                     463723..463725)
                     /locus_tag="HPSH112_02295"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(464090..465133)
                     /locus_tag="HPSH112_02300"
                     /db_xref="GeneID:12771623"
     CDS             complement(464090..465133)
                     /locus_tag="HPSH112_02300"
                     /note="COG2404 Predicted phosphohydrolase (DHH
                     superfamily)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227172.1"
                     /db_xref="GI:386753954"
                     /db_xref="GeneID:12771623"
                     /translation="MQVYHLSHIDLDGYACQLVSKQFFKNIQCYNANYGREVSARIYE
                     ILNAIAQSKESKFLILISDLNLNLNEAQYLQDKIQEHRLQNRNIQIQLLDHHISGKEV
                     AESFHWYFLDTNRCATKIVYEFLKKHYAILEPKNTAWLEPLVEMVNSVDIWDTQGYGF
                     ELGKVCMRMINQSSELNRFMFDDENRNYKLKLLEEVKNYLFLENASVAYDNDLFKLKK
                     IALGGDPDTETMDNISSNAQTHLLSLKKHDCSVYYQDKKGFLSYSMGGISVLANLFLT
                     QNPDFDFYMDVNAKGNVSLRANGNCDVCELSQMCFNGGGHRNASGGKIDGFRESFNYR
                     DIKEQIEEIFNNA"
     misc_feature    complement(464102..465127)
                     /locus_tag="HPSH112_02300"
                     /note="Predicted phosphohydrolase (DHH superfamily)
                     [General function prediction only]; Region: COG2404"
                     /db_xref="CDD:225268"
     misc_feature    complement(464714..465127)
                     /locus_tag="HPSH112_02300"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     gene            complement(465164..467365)
                     /gene="flhA"
                     /locus_tag="HPSH112_02305"
                     /db_xref="GeneID:12771624"
     CDS             complement(465164..467365)
                     /gene="flhA"
                     /locus_tag="HPSH112_02305"
                     /note="COG1298 Flagellar biosynthesis pathway, component
                     FlhA"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="YP_006227173.1"
                     /db_xref="GI:386753955"
                     /db_xref="GeneID:12771624"
                     /translation="MANERSKLAFKKTFPVFKRFLQSKDLALVVFVIAILAIIIVPLP
                     PFVLDFLLTISIALSVLIILIGLYIDKPTDFSAFPTLLLIVTLYRLALNVATTRMILT
                     QGYKGPSAVSDIITAFGEFNVSGNYVIGAIIFSILVLVNLLVVTNGSTRVTEVRARFA
                     LDAMPGKQMAIDADLNSGLIDDKEAKKRRAALSQEADFYGAMDGASKFVKGDAIASII
                     ITLINIIGGFLVGVFQRDMSLSFSASTFTILTIGDGLVGQIPALIIATATGIVATRTT
                     QNEEEDFASKLITQLTNKSKTLVIVGAILLLFATIPGLPTFSLAFVGTLFLFIAWLIS
                     REGKDGLLTKLENYLSQKFGLDLSEKPHSSKIKPHTQTTRAKTQEELKREEEQAIDEV
                     LKIEFLELALGYQLISLADMKQGGDLLERIRGIRKKIASDYGFLMPQIRIRDNLQLPP
                     THYEIKLKGIVIGEGMVMPDKFLAMNTGFVNKEIEGIPTKEPAFGMDALWIETKNKEE
                     AIIQGYTIIDPSTVIATHTSELVKKYAEDFITKDEVKSLLERLAKDYPTIVEESKKIP
                     TGAIRSVLQALLHEKVPIKDMLTILETITDIAPLVQNDVNILTEQVRARLSRVITNAF
                     KSEDGRLKFLTFSTDSEQFLLNKLRENGTSKSLLLNVGELQKLIEVVSEEAMKVLQKG
                     IAPVILIVEPNLRKALSNQMEQARIDVIVLSHAELDPNSNFEALGTIHINF"
     misc_feature    complement(465179..467299)
                     /gene="flhA"
                     /locus_tag="HPSH112_02305"
                     /note="flagellar biosynthesis protein FlhA; Region: FlhA;
                     TIGR01398"
                     /db_xref="CDD:162338"
     gene            467504..467776
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /db_xref="GeneID:12771625"
     CDS             467504..467776
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /note="COG0184 Ribosomal protein S15P/S13E"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S15"
                     /protein_id="YP_006227174.1"
                     /db_xref="GI:386753956"
                     /db_xref="GeneID:12771625"
                     /translation="MALNLEKKQEIIKAFATKENDTGSCEVQVALLNERIKLLTEHLK
                     ANPKDHSSRLGLLKLVAQRRNLLKYIKRTDHARYVVLIEKLGIKDR"
     misc_feature    467522..467761
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /note="Ribosomal protein S15 (prokaryotic)_S13
                     (eukaryotic) binds the central domain of 16S rRNA and is
                     required for assembly of the small ribosomal subunit and
                     for intersubunit association, thus representing a key
                     element in the assembly of the whole ribosome; Region:
                     Ribosomal_S15p_S13e; cd00353"
                     /db_xref="CDD:238213"
     misc_feature    order(467525..467527,467576..467578,467585..467587,
                     467606..467608,467618..467620,467627..467629,
                     467639..467641,467645..467650,467654..467659,
                     467696..467698,467708..467710)
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /note="16S/18S rRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(467591..467593,467600..467605,467612..467614,
                     467621..467623,467741..467743,467753..467755)
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /note="S13e-L30e interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:238213"
     misc_feature    order(467681..467683,467693..467695,467756..467761)
                     /gene="rpsO"
                     /locus_tag="HPSH112_02310"
                     /note="25S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238213"
     gene            467807..469096
                     /locus_tag="HPSH112_02315"
                     /db_xref="GeneID:12771626"
     CDS             467807..469096
                     /locus_tag="HPSH112_02315"
                     /note="COG3307 Lipid A core - O-antigen ligase and related
                     enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227175.1"
                     /db_xref="GI:386753957"
                     /db_xref="GeneID:12771626"
                     /translation="MLKERLKAFFSADSVFTLIFALFFLTSFKKPLTQVLLIVLMVFL
                     FFRCCFQASLKEIFGINHLKTMPFKWLTLAFLGVFLSIFPNMFNMHDSQTFRYNLFAL
                     NMSLTYACGALCLLFASCLRIKLNQKILFYSMAVANFINGLLSLVQKIYFNMPRAQGF
                     STVKEYVVLVSVSILGCYIYALYSRNQKEKLFFTLSVFVGFLVVILSATRSATIAFIM
                     TFLILSCFILYAKKSLKPLGYMVVVSLILSALYMGSNALEKKGAIEQSRVQNQSFEED
                     LKRYAKKDADSSIGWRLERWKEALTVLRLRPFFGMAASEKCQRLEEILSLSHSYRAKD
                     LILCYERYDNQIIHVLATRGIIGFLIWLFFLLVIVKIFWSGIKQNSLISLFILTTITF
                     YLIFGIGFDPFDFFITGSFFVGMVMMAVFLKKDKSAF"
     misc_feature    467846..469075
                     /locus_tag="HPSH112_02315"
                     /note="Lipid A core - O-antigen ligase and related enzymes
                     [Cell envelope biogenesis, outer membrane]; Region: RfaL;
                     COG3307"
                     /db_xref="CDD:225844"
     misc_feature    468389..468892
                     /locus_tag="HPSH112_02315"
                     /note="O-Antigen ligase; Region: Wzy_C; pfam04932"
                     /db_xref="CDD:252887"
     gene            469225..469728
                     /locus_tag="HPSH112_02320"
                     /db_xref="GeneID:12771627"
     CDS             469225..469728
                     /locus_tag="HPSH112_02320"
                     /EC_number="4.2.1.10"
                     /note="COG0757 3-dehydroquinate dehydratase II"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydroquinate dehydratase"
                     /protein_id="YP_006227176.1"
                     /db_xref="GI:386753958"
                     /db_xref="GeneID:12771627"
                     /translation="MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLD
                     VELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVH
                     LTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQQNNPN
                     NPINNQK"
     misc_feature    469228..469653
                     /locus_tag="HPSH112_02320"
                     /note="Dehydroquinase (DHQase), type II. Dehydroquinase
                     (or 3-dehydroquinate dehydratase) catalyzes the reversible
                     dehydration of 3-dehydroquinate to form
                     3-dehydroshikimate. This reaction is part of two metabolic
                     pathways: the biosynthetic shikimate pathway...; Region:
                     DHQase_II; cd00466"
                     /db_xref="CDD:238262"
     misc_feature    order(469252..469254,469258..469260,469381..469395,
                     469402..469404,469411..469413,469459..469461,
                     469480..469482,469489..469494,469501..469503,
                     469561..469563)
                     /locus_tag="HPSH112_02320"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     misc_feature    order(469273..469275,469288..469290,469450..469452,
                     469456..469461,469468..469470,469489..469491,
                     469528..469536,469561..469563)
                     /locus_tag="HPSH112_02320"
                     /note="active site"
                     /db_xref="CDD:238262"
     misc_feature    order(469537..469539,469543..469548,469579..469584,
                     469588..469599,469603..469611,469618..469620,
                     469630..469632,469642..469644,469651..469653)
                     /locus_tag="HPSH112_02320"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238262"
     gene            469742..470815
                     /locus_tag="HPSH112_02325"
                     /db_xref="GeneID:12771628"
     CDS             469742..470815
                     /locus_tag="HPSH112_02325"
                     /note="COG0006 Xaa-Pro aminopeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="X-Pro aminopeptidase"
                     /protein_id="YP_006227177.1"
                     /db_xref="GI:386753959"
                     /db_xref="GeneID:12771628"
                     /translation="MRELERDAHFTLDENAMFFECAYSCDNALFLQLEDRSFFITDSR
                     YTQEAKESIQPKNGVLAEVVESSDLVQSAIDLIAKSSLKKLFFDPNQVNLQTYKRLNS
                     ALGDKVTLEGVPGYHRQKRIIKNDHEIQLLKKSQALNVEAFENFAEYVKKVFDEKESL
                     SERYLQHKVKDFLTKEGVYDLSFEPILALNANASKPHALPSAKDFLKAEHSILLDMGI
                     KYERYCSDRTRTAFFDPKDFVFTREQSFKDKERQKIYDIVKEAQEKAISGIRAGMTGK
                     EADSLARGVISDHGYGQYFTHSTGHGIGLDIHELPYISSRSETILEEGMVFSVEPGIY
                     IPGFFGVRIEDLVVIKNSRAELL"
     misc_feature    469742..470812
                     /locus_tag="HPSH112_02325"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    469742..470110
                     /locus_tag="HPSH112_02325"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:250531"
     misc_feature    470126..470791
                     /locus_tag="HPSH112_02325"
                     /note="Similar to Prolidase and Aminopeptidase P. The
                     members of this subfamily presumably catalyse hydrolysis
                     of Xaa-Pro dipeptides and/or release of any N-terminal
                     amino acid, including proline, that is linked with
                     proline; Region: APP-like; cd01092"
                     /db_xref="CDD:238525"
     misc_feature    order(470330..470332,470384..470386,470417..470419,
                     470642..470644,470729..470731,470771..470773)
                     /locus_tag="HPSH112_02325"
                     /note="active site"
                     /db_xref="CDD:238525"
     gene            470812..471303
                     /locus_tag="HPSH112_02330"
                     /db_xref="GeneID:12771629"
     CDS             470812..471303
                     /locus_tag="HPSH112_02330"
                     /note="COG0801
                     7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_006227178.1"
                     /db_xref="GI:386753960"
                     /db_xref="GeneID:12771629"
                     /translation="MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCF
                     LYFKNHSKIGKIFSSPVYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRF
                     GRQRKRDFKDAPRTLDIDIIAFNQVILRQNDLTLPHPKWNERDSVLVPLALQQILFKK
                     GEW"
     misc_feature    470884..471267
                     /locus_tag="HPSH112_02330"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    order(470899..470901,471001..471006,471010..471012,
                     471034..471036,471040..471042,471085..471087,
                     471097..471099,471106..471108,471121..471123,
                     471127..471129,471145..471147,471154..471156,
                     471163..471165,471169..471174,471214..471216,
                     471223..471228,471241..471243,471247..471249)
                     /locus_tag="HPSH112_02330"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(471085..471087,471097..471099,471106..471108,
                     471121..471123,471127..471129,471154..471156,
                     471169..471174,471214..471216,471223..471228,
                     471241..471243)
                     /locus_tag="HPSH112_02330"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            471300..472676
                     /gene="flhF"
                     /locus_tag="HPSH112_02335"
                     /db_xref="GeneID:12771630"
     CDS             471300..472676
                     /gene="flhF"
                     /locus_tag="HPSH112_02335"
                     /note="COG1419 Flagellar GTP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="YP_006227179.1"
                     /db_xref="GI:386753961"
                     /db_xref="GeneID:12771630"
                     /translation="MKFYTYSGETAAEALKIAQSHHGVDTLVFKTQEIRKKTLTSSGL
                     YEIVVAVEEESENKPPKAPLIPESLYDEELNEEDVVMQLSSTVEEMRKLAGVSSSQRN
                     YSFSKNKTLLEKDAPLEDAPLEANQQDALLQALKDEANHKKEREKREVKQEEEIKGIN
                     LQLSKIRDSLKLIQNMFWDEKNPNSINIPQEFAEIYKLAKQSGMKSSHSDEIMQLSLE
                     LMPLRMRENSVTIKRYFREVLRKMILCRPEDLNLRQKRILMLVGPTGVGKTTTLAKLA
                     ARYSRMLAKKYKVGIITLDNYRIGALEQLSWYANKMKMSIEAVIDAKDFAKEIEALEY
                     CDFILVDTTGHSQYDKEKIAGLKEFIDGGYNIDVSLVLSVTTKYEDMKDIYDSFGVLG
                     IDTLIFTKLDESRGLGNLFSLVHESQKPISYLSVGQEVPMDLKVATNEYLVDCMLDGF
                     SNPNKEQA"
     misc_feature    471300..472670
                     /gene="flhF"
                     /locus_tag="HPSH112_02335"
                     /note="flagellar biosynthesis regulator FlhF; Validated;
                     Region: flhF; PRK05703"
                     /db_xref="CDD:235570"
     misc_feature    472068..472643
                     /gene="flhF"
                     /locus_tag="HPSH112_02335"
                     /note="SRP54-type protein, GTPase domain; Region: SRP54;
                     pfam00448"
                     /db_xref="CDD:249866"
     gene            472673..473557
                     /locus_tag="HPSH112_02340"
                     /db_xref="GeneID:12771631"
     CDS             472673..473557
                     /locus_tag="HPSH112_02340"
                     /note="COG0455 ATPases involved in chromosome
                     partitioning"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_006227180.1"
                     /db_xref="GI:386753962"
                     /db_xref="GeneID:12771631"
                     /translation="MNNQASRLDNLINIKNPKSFFDNKGNTKFIAITSGKGGVGKSNI
                     SANLAYALYKKGYKVGVFDADIGLANLDVIFGVKTHKNIFHALKGEAKLQEIICEIEP
                     GLCLIPGDSGEEILKYISGAEALDQFVDEEGVLSSLDYIVVDTGAGIGTTTQAFLNAS
                     DCVVIVTTPDPSAITDAYACIKINSKNKDELFLIANMVAQPKEGRATYERLLKVAKNN
                     IASLELHYLGAIENSSLLKRYVRERKILRKIAPNDLFSQSIDQIAGLLVSKLETGALE
                     IPKEGFKSFFKRLLSYLG"
     misc_feature    472748..473542
                     /locus_tag="HPSH112_02340"
                     /note="Antiactivator of flagellar biosynthesis FleN, an
                     ATPase [Cell motility]; Region: flhG; COG0455"
                     /db_xref="CDD:223531"
     misc_feature    472757..473365
                     /locus_tag="HPSH112_02340"
                     /note="FleN is a member of the Fer4_NifH superfamily. It
                     shares the common function as an ATPase, with the
                     ATP-binding domain at the N-terminus. In Pseudomonas
                     aeruginosa, FleN gene is involved in regulating the number
                     of flagella and chemotactic motility by...; Region:
                     FleN-like; cd02038"
                     /db_xref="CDD:238995"
     misc_feature    472760..>473104
                     /locus_tag="HPSH112_02340"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    472775..472798
                     /locus_tag="HPSH112_02340"
                     /note="P-loop; other site"
                     /db_xref="CDD:238995"
     gene            473562..473876
                     /locus_tag="HPSH112_02345"
                     /db_xref="GeneID:12771632"
     CDS             473562..473876
                     /locus_tag="HPSH112_02345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227181.1"
                     /db_xref="GI:386753963"
                     /db_xref="GeneID:12771632"
                     /translation="MKVQNFIHFSVVVGFFLGLVVSVLKFNEPESILLWTVLSTLGGY
                     LIALLFASIFIACTDLDICLFDKKGTEESLLRFNHEFKNREKEVASILEYIRSYDFDD
                     GK"
     gene            473854..474630
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /db_xref="GeneID:12771633"
     CDS             473854..474630
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /note="COG1191 DNA-directed RNA polymerase specialized
                     sigma subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis sigma factor"
                     /protein_id="YP_006227182.1"
                     /db_xref="GI:386753964"
                     /db_xref="GeneID:12771633"
                     /translation="MILMMENRMPKEIQKTQTSETNEKNIEKVLNAYDKQQHHHQDAL
                     AIQYLPAVRAMAFRLKERLPSSIDFNDLVSIGTEELIKLARRYESALNDSFWGYAKTR
                     VNGAMLDYLRSLDVISRSNRKLIKSIDNEITKHLNEHGKEPSDAYLAEVLGENIEKIK
                     EAKTASDIYALVPIDEQFNAIEQDEITKKIEAEELLEHVQKALNQMSEREQILIQLYY
                     FEELNLSEIKEILGITESRISQIIKEVIKKVRKSLGVDHG"
     misc_feature    473947..474624
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /note="flagellar biosynthesis sigma factor; Validated;
                     Region: fliA; PRK06986"
                     /db_xref="CDD:235901"
     misc_feature    473983..474198
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    474439..474603
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(474472..474474,474502..474504,474520..474525,
                     474553..474555,474559..474564,474568..474576,
                     474580..474585,474589..474591)
                     /gene="fliA"
                     /locus_tag="HPSH112_02350"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            474623..475687
                     /gene="fliM"
                     /locus_tag="HPSH112_02355"
                     /db_xref="GeneID:12771634"
     CDS             474623..475687
                     /gene="fliM"
                     /locus_tag="HPSH112_02355"
                     /note="COG1868 Flagellar motor switch protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="YP_006227183.1"
                     /db_xref="GI:386753965"
                     /db_xref="GeneID:12771634"
                     /translation="MADILSQEEIDALLEVVDENVDIQNVQKKDIIPQRSVTLYDFKR
                     PNRVSKEQLRSFRSIHDKMARNLSSQVSSIMRSIVEIQLHSVDQMTYGEFLMSLPSPT
                     SFNVFSMKPMGGTGVLEINPSIAFPMIDRLLGGKGSAYDQNREFSDIELNLLDTILRQ
                     VMQILKEVWSPVVEMFPTIDAKESSANVVQIVAQNEISIMVVLEIIIGHSRGMMNICY
                     PVISIESILSKMGSRDLMLSETNSKKSRNKELQALLSGVSVDMMVFLGAVELSLKEML
                     DLDVGDTIRLNKIANDEVSVYVHKKKRYLASVGFQGYRKTIQIKEVVYSEKERTKEIL
                     EMLEEQRRDKVGDIMKIEEE"
     misc_feature    474623..475630
                     /gene="fliM"
                     /locus_tag="HPSH112_02355"
                     /note="flagellar motor switch protein FliM; Validated;
                     Region: fliM; PRK06666"
                     /db_xref="CDD:235849"
     misc_feature    475382..475591
                     /gene="fliM"
                     /locus_tag="HPSH112_02355"
                     /note="Surface presentation of antigens (SPOA); Region:
                     SpoA; pfam01052"
                     /db_xref="CDD:250325"
     gene            475691..476581
                     /locus_tag="HPSH112_02360"
                     /db_xref="GeneID:12771635"
     CDS             475691..476581
                     /locus_tag="HPSH112_02360"
                     /note="COG1776 Chemotaxis protein CheC, inhibitor of MCP
                     methylation"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliY"
                     /protein_id="YP_006227184.1"
                     /db_xref="GI:386753966"
                     /db_xref="GeneID:12771635"
                     /translation="MQDFIKIFIQEVVSTLEGLVGKAPSVGLEKEVSNSEEAWESLIS
                     APYARVVISAIEKEESSIELLAPVVLVTALSDLMLGGEGASKEEMDNDDLDAFKEMAS
                     NIFGAIATSLKSQELLPKLNFTTINAEIAKELPKKEDYAKMMVFSFKMEALKESQIIL
                     LTTAAFERQFEKTHQEEKEEKEEKEEKEETTKSATEEVKTHDASLENIEIRNISMLLD
                     VKLNVKVRIGQKKMILKDVVSMDIGSVVELDQLVNDPLEILVDDKVIAKGEVVIVDGN
                     FGIQITDIGTKKERLEQLKH"
     misc_feature    475691..476578
                     /locus_tag="HPSH112_02360"
                     /note="flagellar motor switch protein FliY; Validated;
                     Region: PRK08432"
                     /db_xref="CDD:236264"
     misc_feature    476324..476554
                     /locus_tag="HPSH112_02360"
                     /note="flagellar motor switch protein FliN; Region: fliN;
                     TIGR02480"
                     /db_xref="CDD:131533"
     gene            476610..477146
                     /locus_tag="HPSH112_02365"
                     /db_xref="GeneID:12771636"
     CDS             476610..477146
                     /locus_tag="HPSH112_02365"
                     /note="COG2731 Beta-galactosidase, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227185.1"
                     /db_xref="GI:386753967"
                     /db_xref="GeneID:12771636"
                     /translation="MAIFGELSSLGHLFKKTQELEILYEYLKDVMQKGSKANQRVLNL
                     ASSTEFQVPLGHGMFSIEQSYCLEHAKESAKGFFESHKKYVDFQLIVKGVEGAKVVGI
                     NQAAIKNPYNEKKDLIVYEPVSEASFLRLDAGMLAIFFESDAHALRFYGESFEKYREE
                     PIFKAVVKAPKGLIKLKL"
     misc_feature    476643..477131
                     /locus_tag="HPSH112_02365"
                     /note="Domain of unknown function (DUF386); Region:
                     DUF386; cl01047"
                     /db_xref="CDD:260763"
     gene            477143..477643
                     /locus_tag="HPSH112_02370"
                     /db_xref="GeneID:12771637"
     CDS             477143..477643
                     /locus_tag="HPSH112_02370"
                     /note="COG4731 Uncharacterized protein conserved in
                     bacteria"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227186.1"
                     /db_xref="GI:386753968"
                     /db_xref="GeneID:12771637"
                     /translation="MKLVSLVIVFCCFLGAVELPGIYQTQEFLYMKSSFVEFFEHNGK
                     FYAYGISDADGSKAKKDKFNPNPKLRNRSDKGVVFLSDLIKVGERSYKGGKAYNFYDG
                     KTYYVRVTQNSNGDLEFTSSYDKWGYVGKTFTWKRLSDEEIKNLKLKRFDLDEVLKTI
                     KDSRPI"
     misc_feature    477164..477634
                     /locus_tag="HPSH112_02370"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4731"
                     /db_xref="CDD:227074"
     gene            complement(477663..478115)
                     /locus_tag="HPSH112_02375"
                     /db_xref="GeneID:12771638"
     CDS             complement(477663..478115)
                     /locus_tag="HPSH112_02375"
                     /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ferric uptake regulation protein"
                     /protein_id="YP_006227187.1"
                     /db_xref="GI:386753969"
                     /db_xref="GeneID:12771638"
                     /translation="MKRLETLESILERLRMSIKKNGLKNSKQREEVVSVLYRSGTHLS
                     PEEITHSIRQKDKNTSISSVYRILNFLEKENFICVLETSKSGRRYEIAAKEHHDHIIC
                     LHCGKIIEFADPEIEHRQNEVVKKYQAKLISHDMKMFVWCKECQESAY"
     misc_feature    complement(477690..478037)
                     /locus_tag="HPSH112_02375"
                     /note="Ferric uptake regulator(Fur) and related
                     metalloregulatory proteins; typically iron-dependent,
                     DNA-binding repressors and activators; Region: Fur_like;
                     cd07153"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(477786..477788,477819..477821,
                     477825..477827,477846..477848,477990..477992))
                     /locus_tag="HPSH112_02375"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(477894..477938)
                     /locus_tag="HPSH112_02375"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(477714..477716,477765..477767,
                     477822..477824,477828..477830))
                     /locus_tag="HPSH112_02375"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(477693..477719,477723..477731,
                     477756..477761,477807..477815))
                     /locus_tag="HPSH112_02375"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(477690..477692,477801..477803,
                     477810..477812))
                     /locus_tag="HPSH112_02375"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            complement(478275..479450)
                     /locus_tag="HPSH112_02380"
                     /db_xref="GeneID:12771639"
     CDS             complement(478275..479450)
                     /locus_tag="HPSH112_02380"
                     /note="COG2256 ATPase related to the helicase subunit of
                     the Holliday junction resolvase"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination factor protein RarA"
                     /protein_id="YP_006227188.1"
                     /db_xref="GI:386753970"
                     /db_xref="GeneID:12771639"
                     /translation="MSLTSLLNPKSLEDFLGQEHLIGKDAPLFKALQSKHFPHAFFYG
                     PPGVGKTSLAQIIARMLERPILLFNATDFKLEDLRLKLKNYQNTLLKPVVFIDETHRL
                     NKTQQEFLLPIMEKDHALILGASTQDPNYSLSHAIRSRSFIFELTPLNKSDLDKLCAK
                     ALTLLKKQIEPSAKTYLLNNSAGDARALLNLLDLSAKIEDPITLETLQSLRPHSLNDG
                     SYSDDTHYNLTSALIKSLRGSDENASIYYLARLIAGGENPEFIARRLVIFASEDIGNA
                     NPNALNLAASCLLSVKQIGYPEARIILSQCVIYLACSPKSNTAYRAINQALDCVQKGS
                     LYPIPKHLLPNAKDYLYPHDYNGYVKQDYLEKPLDLVSSQGIGFEKTLLEWLDKIRN"
     misc_feature    complement(478278..479450)
                     /locus_tag="HPSH112_02380"
                     /note="ATPase related to the helicase subunit of the
                     Holliday junction resolvase [DNA replication,
                     recombination, and repair]; Region: MGS1; COG2256"
                     /db_xref="CDD:225165"
     misc_feature    complement(479031..479402)
                     /locus_tag="HPSH112_02380"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(479298..479321)
                     /locus_tag="HPSH112_02380"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(479073..479075,479160..479162,
                     479295..479318))
                     /locus_tag="HPSH112_02380"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(479157..479174)
                     /locus_tag="HPSH112_02380"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(479031..479033)
                     /locus_tag="HPSH112_02380"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(478278..478739)
                     /locus_tag="HPSH112_02380"
                     /note="MgsA AAA+ ATPase C terminal; Region: MgsA_C;
                     pfam12002"
                     /db_xref="CDD:256790"
     gene            complement(479447..479818)
                     /locus_tag="HPSH112_02385"
                     /db_xref="GeneID:12771640"
     CDS             complement(479447..479818)
                     /locus_tag="HPSH112_02385"
                     /note="COG0789 Predicted transcriptional regulators"
                     /codon_start=1
                     /transl_table=11
                     /product="putative heat shock protein HspR"
                     /protein_id="YP_006227189.1"
                     /db_xref="GI:386753971"
                     /db_xref="GeneID:12771640"
                     /translation="MCDYDEPLYLISVVAKILGVHPQTLRQYEKEGLIEPSRTDGKMR
                     LYSQRDMDKIKTILRLTRDMGVNLAGVDIILRLKEKLDELDSLNKELQDALHKHSKNN
                     KTPTKNLNTPTNFYELILFKK"
     misc_feature    complement(479525..479797)
                     /locus_tag="HPSH112_02385"
                     /note="Helix-Turn-Helix DNA binding domain of the HspR
                     transcription regulator; Region: HTH_HspR; cd04766"
                     /db_xref="CDD:133394"
     misc_feature    complement(<479570..479794)
                     /locus_tag="HPSH112_02385"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: SoxR; COG0789"
                     /db_xref="CDD:223860"
     misc_feature    complement(order(479687..479695,479741..479743,
                     479783..479791))
                     /locus_tag="HPSH112_02385"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133394"
     misc_feature    complement(order(479534..479539,479546..479548,
                     479558..479560,479576..479578,479588..479590,
                     479597..479599,479624..479629,479642..479644,
                     479651..479653))
                     /locus_tag="HPSH112_02385"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:133394"
     gene            complement(479828..480694)
                     /locus_tag="HPSH112_02390"
                     /db_xref="GeneID:12771641"
     CDS             complement(479828..480694)
                     /locus_tag="HPSH112_02390"
                     /note="COG2214 DnaJ-class molecular chaperone"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone-curved DNA binding protein A"
                     /protein_id="YP_006227190.1"
                     /db_xref="GI:386753972"
                     /db_xref="GeneID:12771641"
                     /translation="MSKSLYQTLNVSENANQDEIKKSYRRLARQYHPDLNKTKEAEEK
                     FKEINAAYEILSDEEKRRQYDQFGDNMFGGQNFSDFARSRSTSEDLDDILSSIFGRGG
                     FSQRFSQNSQGFSGFNFSNFAHEDLDMTTTLNVSVLDTLLGNKKQVSINNETFSLKIP
                     IGVEEGEKIRVRNKGKMGRTGRGDLLLQIHIEEDEIYKREKDDIIQIFDLPLKTALFG
                     GKIEIATWHKTLTLTIPPNTKAMQKFRIKDKGIKNRKTSHVGDLYLQARLILPKTETL
                     SSELKALLEKEL"
     misc_feature    complement(479837..480679)
                     /locus_tag="HPSH112_02390"
                     /note="chaperone protein DnaJ; Region: DnaJ_bact;
                     TIGR02349"
                     /db_xref="CDD:233829"
     misc_feature    complement(480524..480679)
                     /locus_tag="HPSH112_02390"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    complement(order(480545..480550,480557..480562,
                     480569..480571,480593..480601))
                     /locus_tag="HPSH112_02390"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    complement(479879..480313)
                     /locus_tag="HPSH112_02390"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(480167..480169,480239..480241,
                     480242..480259,480302..480304))
                     /locus_tag="HPSH112_02390"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    complement(order(479879..479887,479975..479986,
                     480044..480049,480056..480061))
                     /locus_tag="HPSH112_02390"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            480862..482112
                     /locus_tag="HPSH112_02395"
                     /db_xref="GeneID:12771642"
     CDS             480862..482112
                     /locus_tag="HPSH112_02395"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227191.1"
                     /db_xref="GI:386753973"
                     /db_xref="GeneID:12771642"
                     /translation="MQYKKNKKRYYYLALWILFLNGLSLKALEIAVKPFGYLGLLYNQ
                     GAQKNPHSYVGALARLGVDFSYSNGWSFGIGAIGAWNIYNKQRLANLYISLGNFFGSS
                     KNVKPYLSAGDVSDAYIQYTNQRFKIALGRFNTDFVDFDWIGGNIQGVSVAFKQNSMR
                     YFGIFMDSMLYNGHQINKEQGNRIATSLNALASYDPVSKRLYVGGEVFVLGAEYRHEN
                     LKVLPFILTDTRLPLPTQNVLVQVGGKLEYDASLAKGFTSRTLVHGMYQYGNTDATTN
                     AKNAGLFLIDQTFKYKIFNFGTGFYIVPARNNKGYLWTFNDRTKFYGRGINAPGVPAI
                     YFANSSISGYVFLGLKTKRVRLDAMVAFGDYQEYSLMSSFKVWTYRSLSFDMGGGYVY
                     AYNSKATRKSLGNSSFVFFGKFLF"
     gene            complement(482177..482953)
                     /locus_tag="HPSH112_02400"
                     /db_xref="GeneID:12771643"
     CDS             complement(482177..482953)
                     /locus_tag="HPSH112_02400"
                     /note="COG0258 5'-3' exonuclease (including N-terminal
                     domain of PolI)"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-3' exonuclease"
                     /protein_id="YP_006227192.1"
                     /db_xref="GI:386753974"
                     /db_xref="GeneID:12771643"
                     /translation="MLSNKTLPKRFAACSLQEVGIIFLTTQILSIMRKARCSKTLFFI
                     TRGRESFRYQLCDHYKQKRHQFDEDFRSLLKALKIALVEKYPLKKGARIQGEHCFEYE
                     ADDIISFYKKKDPKNYVIASMDKDILYSNRGSHFNLKTNAFFNVSQKEAHFFAYYQCV
                     VGDKGDNIKGVKGIGGFNYKDFLNKDAKEHELWEQIIQAFKIKEDLSDSEAKEKALLN
                     MRLVNMHQMTHHGVIKLWEPEFKKTFFPKKPQRPDFKRIS"
     misc_feature    complement(482204..482941)
                     /locus_tag="HPSH112_02400"
                     /note="5'-3' exonuclease; Provisional; Region: PRK14976"
                     /db_xref="CDD:237877"
     misc_feature    complement(<482570..482887)
                     /locus_tag="HPSH112_02400"
                     /note="PIN (PilT N terminus) domain: Superfamily; Region:
                     PIN_SF; cl14812"
                     /db_xref="CDD:265458"
     misc_feature    complement(order(482582..482584,482642..482644))
                     /locus_tag="HPSH112_02400"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     misc_feature    complement(482399..482503)
                     /locus_tag="HPSH112_02400"
                     /note="Helix-hairpin-helix class 2 (Pol1 family) motifs;
                     Region: HhH2; smart00279"
                     /db_xref="CDD:197623"
     misc_feature    complement(order(482390..482392,482429..482437,
                     482465..482473))
                     /locus_tag="HPSH112_02400"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:188616"
     misc_feature    complement(482465..482467)
                     /locus_tag="HPSH112_02400"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:188616"
     gene            complement(483279..484175)
                     /locus_tag="HPSH112_02405"
                     /db_xref="GeneID:12771644"
     CDS             complement(483279..484175)
                     /locus_tag="HPSH112_02405"
                     /note="COG0784 FOG: CheY-like receiver"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator"
                     /protein_id="YP_006227193.1"
                     /db_xref="GI:386753975"
                     /db_xref="GeneID:12771644"
                     /translation="MKILIIEDDLALARSISHNLHDLGHFCEIISSISEENKEPYDVI
                     LVSSKVCTQGRCEHFVRYNSKQIIIMMASHVNEDGVNKPIQAGARDYILKPFKMDELL
                     RKIQYHKAYQEMTARLGFYENYLDFIHAELPLPKDFSYRPPFIIHTPSQELANAYLLQ
                     YAKERQMDFSFFSLKDTTWKELYKNKDKLERPFYIMHLEELKKDEQLKLLELARSCPI
                     VLSYTHKEPLEFPKIVSIECGDKPLFLFSNHTTFLSIQEYEREAIRHFSSTCTDTELA
                     NKLGISRKSLWEKRRKYNLPRK"
     misc_feature    complement(<483852..484175)
                     /locus_tag="HPSH112_02405"
                     /note="Response regulators consisting of a CheY-like
                     receiver domain and a winged-helix DNA-binding domain
                     [Signal transduction mechanisms / Transcription]; Region:
                     OmpR; COG0745"
                     /db_xref="CDD:223816"
     misc_feature    complement(483858..484166)
                     /locus_tag="HPSH112_02405"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(483891..483896,483903..483905,
                     483960..483962,484152..484157))
                     /locus_tag="HPSH112_02405"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(483888..483896)
                     /locus_tag="HPSH112_02405"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(484207..485427)
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /db_xref="GeneID:12771645"
     CDS             complement(484207..485427)
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /EC_number="4.6.1.12"
                     /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional 2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase/2-C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase"
                     /protein_id="YP_006227194.1"
                     /db_xref="GI:386753976"
                     /db_xref="GeneID:12771645"
                     /translation="MSLIRVNGEAFKLSLESLEEDPFETKETLETLVKQTSVVLLAAG
                     ESRRFSQTIKKQWLRSNHTPLWLSVYESFKEALDFKEILLVVSELDYIYIKRHHPEIK
                     LVKGGASRQESVRNALKIIDSAYTLTSDVARGLANIETLKSLFLTLQQTNHYCIAPYL
                     PCYDTAIYYNEVLDREAIKLIQTPQLSHTKTLQSALNQGDFKDESSAILQAFPDLVSY
                     IEGSKDLHKLTTSSDLKHFSFFFNPAKDTFIGMGFDTHAFIKDKPMVLGGVVLDCEFG
                     LKAHSDGDALLHAVIDAILGAIKGGDIGEWFPDNDPQYKNASSKELLKIVLDFSQSIG
                     FELLEMGATIFSEIPKITPYKPAILENLSQLLGLEKSQISLKATTMEKMGFIGKQEGL
                     LVQAHVSMRYKQKL"
     misc_feature    complement(484210..485337)
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="bifunctional 2-C-methyl-D-erythritol 4-phosphate
                     cytidylyltransferase/2-C-methyl-D-erythritol
                     2,4-cyclodiphosphate synthase protein; Provisional;
                     Region: ispDF; PRK09382"
                     /db_xref="CDD:236492"
     misc_feature    complement(484717..485322)
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="CDP-ME synthetase is involved in
                     mevalonate-independent isoprenoid production; Region:
                     CDP-ME_synthetase; cd02516"
                     /db_xref="CDD:133009"
     misc_feature    complement(order(484747..484749,485032..485040,
                     485089..485091,485098..485109,485263..485265,
                     485284..485301,485305..485307))
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="substrate binding site; other site"
                     /db_xref="CDD:133009"
     misc_feature    complement(order(484759..484764,484774..484782,
                     484786..484788,484801..484803,484810..484815,
                     484819..484824,484885..484902,484936..484938,
                     484942..484944,484966..484968,485029..485031))
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="dimer interface; other site"
                     /db_xref="CDD:133009"
     misc_feature    complement(484228..484686)
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="MECDP_synthase
                     (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase),
                     encoded by the ispF gene, catalyzes the formation of
                     2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the
                     non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid
                     biosynthesis; Region: MECDP_synthase; cd00554"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(484231..484233,484237..484239,
                     484243..484245,484282..484290,484297..484302,
                     484306..484308,484372..484374,484378..484380,
                     484399..484401,484405..484407,484411..484413,
                     484522..484527,484531..484536,484540..484542,
                     484645..484647,484657..484665,484669..484671,
                     484675..484677,484681..484686))
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(484564..484566,484660..484662,
                     484666..484668))
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:100025"
     misc_feature    complement(order(484291..484299,484372..484383,
                     484387..484392,484516..484518,484522..484524))
                     /gene="ispDF"
                     /locus_tag="HPSH112_02410"
                     /note="CDP-binding sites; other site"
                     /db_xref="CDD:100025"
     gene            complement(485449..486879)
                     /locus_tag="HPSH112_02415"
                     /db_xref="GeneID:12771646"
     CDS             complement(485449..486879)
                     /locus_tag="HPSH112_02415"
                     /note="COG0265 Trypsin-like serine proteases, typically
                     periplasmic, contain C-terminal PDZ domain"
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease, peptidase S1C HrtA/DegP2/Q/S
                     family protein"
                     /protein_id="YP_006227195.1"
                     /db_xref="GI:386753977"
                     /db_xref="GeneID:12771646"
                     /translation="MMKKTLFISLALALSLNAGNIQIQSMPKVKERVSVPSKDDTIYS
                     YHDSIKDSIKAVVNISTEKKIKNNFMGSGMFNDPFFQQFFGDLGGMIPKERMERALGS
                     GVIISKDGYIVTNNHVIDGADKIKVTIPGSNKEYSATLVGTDSESDLAVIRITKDNLP
                     TIKFSDSNDILVGDLVFAIGNPFGVGESVTQGIVSALNKSGIGINSYENFIQTDASIN
                     PGNSGGALIDSRGGLVGINTAIISKTGGNHGIGFAIPSNMVKDIVTQLIKTGKIERGY
                     LGVGLQDLSSDLQNSYDNKEGAVVISVEKDSPAKKAGILVWDLITEVNGKKIKNTNEL
                     RNLIGSMLPNQRVTLKVIRDKKERTFTLTLAERKNPNKKETISAQNGAQGQLNGLQVE
                     DLTQKTKRSMRLSDDVQGVLVSQVNENSPAEQAGFRQGNIITKIEEVEVKSVADFNHA
                     LEKYKGKPKRFLVLDLNQGYRIILVK"
     misc_feature    complement(485455..486750)
                     /locus_tag="HPSH112_02415"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:233695"
     misc_feature    complement(486172..486579)
                     /locus_tag="HPSH112_02415"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(485794..486057)
                     /locus_tag="HPSH112_02415"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(485875..485880,485887..485892,
                     486037..486039,486043..486054))
                     /locus_tag="HPSH112_02415"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    complement(485488..485718)
                     /locus_tag="HPSH112_02415"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(485536..485541,485548..485553,
                     485707..485709,485713..485718))
                     /locus_tag="HPSH112_02415"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            complement(486924..488366)
                     /locus_tag="HPSH112_02420"
                     /db_xref="GeneID:12771647"
     CDS             complement(486924..488366)
                     /locus_tag="HPSH112_02420"
                     /note="COG0833 Amino acid transporters"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid permease"
                     /protein_id="YP_006227196.1"
                     /db_xref="GI:386753978"
                     /db_xref="GeneID:12771647"
                     /translation="MDNQEIAHQNITQKQGELKRDMKMRHLLMIAFGGAIGTGLFVGT
                     GGNIASAGPLGTLIAYCFGGLVVYCIMLSLGELASVYPTTGSFGDYAAKFIGPGTGYM
                     VFWMYWLGWVITVALEYIAIGMLMQRWFVGIPIHYWVILCIALVFLLNFFSVKIFAEG
                     EFFFSLIKVLAVIAFIGIGAIGIIYQIYLHGFSSIFDNFHFGDKGFFPNGSAAVFSAM
                     LAVIFAFTGTEVIGVAVGETKNASEVMPKAIKATLWRIVFFFLGSVFVISVFLPMSNS
                     SITQSPFVSVLERINLPFIGMGIPYVSDIMNAVIITAMFSTANSGLYGASRMIYGLSK
                     QKMFFKVFSKLNRQGTPTYAMFFSLSFSLIGLLVQIYAKENVVEALINVISFTVIIVW
                     VSVSVSQYSFRKQYLKAGHSLEDLPYKAPFLPFLQLIGITGCVIGVIGSAMDKDQRIG
                     MILTIVFAVICYIGYYFTQKANENNKKDLI"
     misc_feature    complement(486933..488342)
                     /locus_tag="HPSH112_02420"
                     /note="S-methylmethionine transporter; Provisional;
                     Region: PRK11387"
                     /db_xref="CDD:236904"
     misc_feature    complement(<487269..488318)
                     /locus_tag="HPSH112_02420"
                     /note="Transmembrane amino acid transporter protein;
                     Region: Aa_trans; cl17468"
                     /db_xref="CDD:266708"
     gene            complement(488560..489099)
                     /locus_tag="HPSH112_02425"
                     /db_xref="GeneID:12771648"
     CDS             complement(488560..489099)
                     /locus_tag="HPSH112_02425"
                     /note="COG0558 Phosphatidylglycerophosphate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylglycerophosphate synthase"
                     /protein_id="YP_006227197.1"
                     /db_xref="GI:386753979"
                     /db_xref="GeneID:12771648"
                     /translation="MKVLKLLPNFLTILRIVLSLFLLFLLLNTHTYFSFLTPFHINMI
                     SSLVFLFAALTDLLDGYIARNYKAKSRFGEIFDPLADKILILSAFLGLVHLDRVNAWI
                     PFVILGREFFISGLRVLAANEKKDIPVNALGKYKTVSQVVAISALLADVTYSYTLVAI
                     AIFLTLYSGIDYTIKYYKS"
     misc_feature    complement(488563..489087)
                     /locus_tag="HPSH112_02425"
                     /note="CDP-alcohol phosphatidyltransferase; Region:
                     CDP-OH_P_transf; cl00453"
                     /db_xref="CDD:260431"
     gene            complement(489096..489704)
                     /locus_tag="HPSH112_02430"
                     /db_xref="GeneID:12771649"
     CDS             complement(489096..489704)
                     /locus_tag="HPSH112_02430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_006227198.1"
                     /db_xref="GI:386753980"
                     /db_xref="GeneID:12771649"
                     /translation="MQNIIHIHQNKELQFIKKCLLCYFFAPLCGAILLALFLVSSGAK
                     SFEVSNLFSNQLAYIVLLSLFLCALGFIAGAIGFYRLSKITRHLSFFENFAFSFLAVI
                     LCALLSYLIPNASNALSLIGNGVSIFYLHKLYRELSLYTQERFFLSGFRLLLFSFMLA
                     LLGILVQALVILFLTIAVILMCVALGFLGRAFLNFSQVFLKA"
     gene            complement(489714..490502)
                     /locus_tag="HPSH112_02435"
                     /db_xref="GeneID:12771650"
     CDS             complement(489714..490502)
                     /locus_tag="HPSH112_02435"
                     /EC_number="1.1.1.159"
                     /note="COG1028 Dehydrogenases with different specificities
                     (related to short-chain alcohol dehydrogenases)"
                     /codon_start=1
                     /transl_table=11
                     /product="7-alpha-hydroxysteroid dehydrogenase"
                     /protein_id="YP_006227199.1"
                     /db_xref="GI:386753981"
                     /db_xref="GeneID:12771650"
                     /translation="MNNSNHMKNKTLVISGATRGIGKAILYRFAQSGVNIAFTYNKNV
                     EEANKIIEDVEQKYSIKAKAYPLNVLEPEQYTELFKQIDADFDRVDFFISNAIIYGRS
                     VVGGFAPFMRLKPKGLNNIYTATVLAFVVGAQEAAKRMQKIGGGAIVSLSSTGNLVYM
                     PNYAGHGNSKNAVETMVKYAAVDLGEFNIRVNAVSGGPIDTDALKAFPDYVEIKEKVE
                     EQSPLKRMGNPNDLAGAAYFLCDETQSGWLTGQTIVVDGGTTFK"
     misc_feature    complement(489717..490499)
                     /locus_tag="HPSH112_02435"
                     /note="7-alpha-hydroxysteroid dehydrogenase; Provisional;
                     Region: PRK08416"
                     /db_xref="CDD:181417"
     misc_feature    complement(489723..490484)
                     /locus_tag="HPSH112_02435"
                     /note="enoyl-(acyl carrier protein) reductase;
                     Provisional; Region: PRK08063"
                     /db_xref="CDD:236145"
     misc_feature    complement(order(489906..489917,489993..489995,
                     490005..490007,490044..490052,490212..490220,
                     490377..490385,490440..490442,490446..490451,
                     490455..490457))
                     /locus_tag="HPSH112_02435"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(489993..489995,490005..490007,
                     490044..490046,490128..490130))
                     /locus_tag="HPSH112_02435"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(490499..491401)
                     /locus_tag="HPSH112_02440"
                     /db_xref="GeneID:12771651"
     CDS             complement(490499..491401)
                     /locus_tag="HPSH112_02440"
                     /EC_number="4.2.1.52"
                     /note="COG0329 Dihydrodipicolinate
                     synthase/N-acetylneuraminate lyase"