GenomeNet

Database: RefSeq
Entry: NC_022129
LinkDB: NC_022129
Original site: NC_022129 
LOCUS       NC_022129               2224 bp    RNA     linear   VRL 20-OCT-2015
DEFINITION  Ageratum latent virus isolate 1998 segment RNA 3, complete
            sequence.
ACCESSION   NC_022129
VERSION     NC_022129.1
DBLINK      BioProject: PRJNA216153
KEYWORDS    RefSeq.
SOURCE      Ageratum latent virus
  ORGANISM  Ageratum latent virus
            Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
            stage; Bromoviridae; Ilarvirus; unclassified Ilarvirus.
REFERENCE   1  (bases 1 to 2224)
  AUTHORS   Sharman,M. and Thomas,J.E.
  TITLE     Genetic diversity of subgroup 1 ilarviruses from eastern Australia
  JOURNAL   Arch. Virol. 158 (8), 1637-1647 (2013)
   PUBMED   23474983
REFERENCE   2  (bases 1 to 2224)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-AUG-2013) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2224)
  AUTHORS   Sharman,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2012) Queensland Department of Agriculture,
            Fisheries and Forestry, Queensland Government, Ecosciences
            Precinct, GPO Box 267, Brisbane, Queensland 4001, Australia
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to JX463342.
            GenBank Accession Numbers JX463340-JX463342 represent sequences
            from the 3 segments of Ageratum latent virus isolate 1998.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2224
                     /organism="Ageratum latent virus"
                     /mol_type="genomic RNA"
                     /isolate="1998"
                     /host="Ageratum houstonianum"
                     /db_xref="taxon:1386090"
                     /segment="RNA 3"
                     /country="Australia"
                     /lat_lon="27.3318 S 152.7673 E"
                     /collection_date="11-Dec-2006"
                     /collected_by="M. Sharman"
     gene            214..1098
                     /locus_tag="O218_s3gp1"
                     /db_xref="GeneID:16691417"
     CDS             214..1098
                     /locus_tag="O218_s3gp1"
                     /codon_start=1
                     /product="movement protein"
                     /protein_id="YP_008470972.1"
                     /db_xref="GeneID:16691417"
                     /translation="MALAPTMKALTFSADDEDSLQKAVLEALSGSVELNMGVRRCAAF
                     PAQNNGAFLCELTTKETKSFIGKFTDKIKGRLFIDHAVIHLMYIPVILNTTHAVANLK
                     IKNLATGDELYGGTKVNLNEAFVLTLTWPRSLFADAVDKHRGLYLGGSIECSSSIPRD
                     AKIGMWYPLWSEKVSNKQLYQNTTDIVNTKALETFTRTMIHTDREMRSLLRSRASIDM
                     AAKHKESPVLCSNSIGLLDSQTTGIDFTVKTLEESEPGSDGNVSILGPKMVPIDSTGS
                     GTGNSVHVDRASRNLLGA"
     misc_feature    229..1032
                     /locus_tag="O218_s3gp1"
                     /note="Bromovirus movement protein; Region: Bromo_MP;
                     pfam01573"
                     /db_xref="CDD:279858"
     gene            1225..1932
                     /locus_tag="O218_s3gp2"
                     /db_xref="GeneID:16691416"
     CDS             1225..1932
                     /locus_tag="O218_s3gp2"
                     /codon_start=1
                     /product="coat protein"
                     /protein_id="YP_008470973.1"
                     /db_xref="GeneID:16691416"
                     /translation="MNTLNKSPDLPSNAMSTSRSFNNRNCQVCFDELDALANNCPRHG
                     KVNQPSNRQRRNARRAANYRNQTAMVRPVPVVPVSRPKTTASLKLPGNQVWVTRKASE
                     WAAKTVDTNDAIPLKTIMDGIPEITEESKIYRLLIGFVAVSTGTFGIVDGVTGDVIPD
                     PPVVGRLGFQKNTYRCRDINLEGKTPSQLDGKAIVWCLDSNKRDAKRVMLANYWLAIS
                     KPAPLMPPEDFLVESSD"
     misc_feature    <1468..1917
                     /locus_tag="O218_s3gp2"
                     /note="Ilarvirus coat protein; Region: Ilar_coat;
                     pfam01787"
                     /db_xref="CDD:250865"
ORIGIN      
        1 gtattctttg agcttaatac cacttgtaca atttgattcc gaatcggacg atttccagtt
       61 gttgaattcc ttaactgaga cttaacgtcg atcaaattgt cttgtcttta ggatactatc
      121 tgctcgattt ggttcttcct ataagaggtt tctcacgacc taggttgctg tgtgagaatc
      181 gagtcagaga ccccattttc gaatttggtg aaaatggctt tagctccaac catgaaagca
      241 cttacctttt ctgctgatga tgaagattcc cttcagaaag ctgtgcttga ggctctttcc
      301 ggttctgttg aacttaacat gggtgttagg cgatgtgccg ctttccctgc tcaaaataac
      361 ggagcgttcc tttgtgaatt gacaacaaag gagaccaaat ctttcatagg taaatttacc
      421 gataagatta aaggtcgtct atttatagat cacgcagtga tacatttgat gtatattccc
      481 gttattttaa ataccaccca cgctgttgcg aatttaaaga ttaaaaatct tgcaacgggt
      541 gatgagttgt atggaggaac caaagtcaat ttgaacgaag ctttcgtttt gactttgaca
      601 tggccacgtt ctttgttcgc tgatgcagtt gacaaacatc gtggattgta tctcggagga
      661 tccattgagt gttcatcctc aattcctcgt gatgcaaaaa ttggtatgtg gtacccgctt
      721 tggtcggaaa aagtgtccaa caaacagttg tatcaaaata caactgatat tgttaatacc
      781 aaagctttgg aaacatttac cagaaccatg atccatacag atagggaaat gcgaagttta
      841 ttgagaagtc gtgcctcaat cgatatggcc gccaaacaca aagaatcacc agtgttatgt
      901 agtaactcta ttgggttact agattcacaa accaccggga ttgacttcac agtcaagact
      961 ttagaggagt ctgaaccggg atcagacggt aatgtatcaa tcttaggacc taaaatggta
     1021 ccgatcgatt ctaccggtag tggaacaggt aattccgttc atgttgaccg agcaagtagg
     1081 aacttgctcg gtgcgtgagg ttgttaacat ttagacatgg ggggttcttg caaaaggggc
     1141 tagtccctca gagacgtttg agtaatttac agtaatgaat tcttgaaata tagataagtt
     1201 gctgcttgaa cttacctggg atgtatgaat actttgaaca agagtccaga cctaccatcc
     1261 aacgccatgt ctacttctag gagctttaac aaccgaaatt gccaagtttg ctttgacgaa
     1321 cttgatgcct tggccaataa ttgtccgaga catgggaagg ttaatcaacc ttccaaccgc
     1381 caacgacgca acgcacgtcg ggctgcgaat taccgcaatc aaactgcgat ggttcgtccg
     1441 gtacctgttg tacctgtatc ccgccccaaa acaactgctt cactcaaact acctggaaat
     1501 caagtttggg tgactcgtaa agcgagtgaa tgggctgcga agaccgttga taccaacgat
     1561 gctataccgt tgaagaccat catggacggt attcccgaaa ttactgagga gtcgaagatt
     1621 taccgactac tcataggttt cgtcgccgtg tctaccggca cttttgggat tgttgatggg
     1681 gtaactggag atgttattcc tgatccacca gtcgttggtc gactggggtt tcagaagaat
     1741 acttatcgat gccgagatat aaatctcgag ggtaagaccc catcccagct ggatggtaag
     1801 gctattgttt ggtgtctcga ttctaataaa cgagacgcta aacgtgttat gctggccaat
     1861 tattggttgg ctatttccaa gcctgccccg ctgatgccac cagaagattt cctggtggaa
     1921 agcagtgatt gactcactgc tgattcttca tcaactgttg ttgatgaatt gcctcacatg
     1981 gatggtaatt cctgtgtgag atgcggattt acaccgaaac gtattgtaga tcaatacgta
     2041 tggcgatgtt acctttgtga ttatccacaa atggcttagt tttcccgctc tcgatataaa
     2101 tctaagagtc cgcagtaaac ttccgaatcg gacgattcca cgtgcaacgt gagacctttg
     2161 ggtcgagttt acaagggttt tccaatggtg tataaacacc attgatgcct ctattaagag
     2221 aagc
//
DBGET integrated database retrieval system