GenomeNet

Database: RefSeq
Entry: NM_001024845
LinkDB: NM_001024845
Original site: NM_001024845 
LOCUS       NM_001024845            3236 bp    mRNA    linear   PRI 16-MAR-2014
DEFINITION  Homo sapiens solute carrier family 6 (neurotransmitter transporter,
            glycine), member 9 (SLC6A9), transcript variant 3, mRNA.
ACCESSION   NM_001024845
VERSION     NM_001024845.2  GI:386869223
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3236)
  AUTHORS   Martin-Facklam M, Pizzagalli F, Zhou Y, Ostrowitzki S, Raymont V,
            Brasic JR, Parkar N, Umbricht D, Dannals RF, Goldwater R and Wong
            DF.
  TITLE     Glycine transporter type 1 occupancy by bitopertin: a positron
            emission tomography study in healthy volunteers
  JOURNAL   Neuropsychopharmacology 38 (3), 504-512 (2013)
   PUBMED   23132267
  REMARK    GeneRIF: Following biopterin administration, glycine transporter
            type I occupancy correlates with biopterin plasma concentration.
REFERENCE   2  (bases 1 to 3236)
  AUTHORS   Jursky F, Baliova M and Mihalikova A.
  TITLE     Molecular basis for differential glycine transporters sensitivity
            to sanguinarine
  JOURNAL   Toxicol. Lett. 212 (3), 262-267 (2012)
   PUBMED   22705056
  REMARK    GeneRIF: The increased sensitivity of human GlyT1c to sanguinarine
            is abolished by the mutation of only cysteine 475.
REFERENCE   3  (bases 1 to 3236)
  AUTHORS   Harsing LG, Zsilla G, Matyus P, Nagy KM, Marko B, Gyarmati Z and
            Timar J.
  TITLE     Interactions between glycine transporter type 1 (GlyT-1) and some
            inhibitor molecules - glycine transporter type 1 and its inhibitors
            (review)
  JOURNAL   Acta Physiol Hung 99 (1), 1-17 (2012)
   PUBMED   22425803
  REMARK    GeneRIF: Synaptic and extrasynaptic concentrations of glycine are
            regulated by its type-1 glycine transporter, which is primarily
            expressed in astroglial and glutamatergic cell membranes.
            Review article
REFERENCE   4  (bases 1 to 3236)
  AUTHORS   Gunn RN, Murthy V, Catafau AM, Searle G, Bullich S, Slifstein M,
            Ouellet D, Zamuner S, Herance R, Salinas C, Pardo-Lozano R, Rabiner
            EA, Farre M and Laruelle M.
  TITLE     Translational characterization of [11C]GSK931145, a PET ligand for
            the glycine transporter type 1
  JOURNAL   Synapse 65 (12), 1319-1332 (2011)
   PUBMED   21688322
  REMARK    GeneRIF: Human positron-emission tomography studies determine the
            test-retest reproducibility of [11C]GSK931145, a ligand which
            readily enters the brain, displaying a heterogeneous uptake which
            corresponds well with the known distribution of GlyT-1.
REFERENCE   5  (bases 1 to 3236)
  AUTHORS   Howard A and Hirst BH.
  TITLE     The glycine transporter GLYT1 in human intestine: expression and
            function
  JOURNAL   Biol. Pharm. Bull. 34 (6), 784-788 (2011)
   PUBMED   21628872
  REMARK    GeneRIF: metabolic functions of GLYT1 in intestine:
            metabolism/regulation of glycine/glutathione; role in response to
            physiological stress (e.g., oxidative stress); possible role in
            pathophysiology/therapy of inflammatory bowel diseases [REVIEW]
            Review article
REFERENCE   6  (bases 1 to 3236)
  AUTHORS   Evans J, Herdon H, Cairns W, O'Brien E, Chapman C, Terrett J and
            Gloger I.
  TITLE     Cloning, functional characterisation and population analysis of a
            variant form of the human glycine type 2 transporter
  JOURNAL   FEBS Lett. 463 (3), 301-306 (1999)
   PUBMED   10606742
REFERENCE   7  (bases 1 to 3236)
  AUTHORS   Olivares L, Aragon C, Gimenez C and Zafra F.
  TITLE     The role of N-glycosylation in the targeting and activity of the
            GLYT1 glycine transporter
  JOURNAL   J. Biol. Chem. 270 (16), 9437-9442 (1995)
   PUBMED   7721869
REFERENCE   8  (bases 1 to 3236)
  AUTHORS   Jones EM, Fernald A, Bell GI and Le Beau MM.
  TITLE     Assignment of SLC6A9 to human chromosome band 1p33 by in situ
            hybridization
  JOURNAL   Cytogenet. Cell Genet. 71 (3), 211 (1995)
   PUBMED   7587377
REFERENCE   9  (bases 1 to 3236)
  AUTHORS   Kim KM, Kingsmore SF, Han H, Yang-Feng TL, Godinot N, Seldin MF,
            Caron MG and Giros B.
  TITLE     Cloning of the human glycine transporter type 1: molecular and
            pharmacological characterization of novel isoform variants and
            chromosomal localization of the gene in the human and mouse genomes
  JOURNAL   Mol. Pharmacol. 45 (4), 608-617 (1994)
   PUBMED   8183239
REFERENCE   10 (bases 1 to 3236)
  AUTHORS   Borowsky B, Mezey E and Hoffman BJ.
  TITLE     Two glycine transporter variants with distinct localization in the
            CNS and peripheral tissues are encoded by a common gene
  JOURNAL   Neuron 10 (5), 851-863 (1993)
   PUBMED   8494645
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL139220.13, CN354684.1, S70609.1 and AI884725.1.
            On May 10, 2012 this sequence version replaced gi:67782316.
            
            Transcript Variant: This variant (3) differs in the 5' UTR and
            coding region compared to variant 2. The resulting isoform (3) is
            shorter and has a distinct N-terminus compared to isoform 2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed/partial sample support ERS025081, ERS025082
                              [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-30                AL139220.13        46754-46783         c
            31-390              CN354684.1         141-500
            391-1170            S70609.1           529-1308
            1171-1518           AI884725.1         14-361              c
            1519-2096           S70609.1           1657-2234
            2097-3236           AL139220.13        11774-12913         c
FEATURES             Location/Qualifiers
     source          1..3236
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p33"
     gene            1..3236
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="solute carrier family 6 (neurotransmitter
                     transporter, glycine), member 9"
                     /db_xref="GeneID:6536"
                     /db_xref="HGNC:HGNC:11056"
                     /db_xref="MIM:601019"
     exon            1..187
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(4)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186707610"
     variation       complement(22)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:548879375"
     variation       complement(32)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:528741278"
     variation       complement(49)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200352065"
     variation       complement(72)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202212360"
     variation       complement(100)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201166642"
     variation       complement(115)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200601437"
     variation       complement(153)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201715134"
     variation       complement(159)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200879498"
     variation       complement(163)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:114939139"
     variation       complement(173)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201573814"
     variation       complement(177)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201090813"
     variation       complement(185)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199859936"
     exon            188..302
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(204)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201550983"
     variation       complement(212)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:559796405"
     variation       complement(214)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200607789"
     variation       complement(215..222)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace=""
                     /replace="ctggaagc"
                     /db_xref="dbSNP:202064950"
     variation       complement(217)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111605558"
     misc_feature    231..233
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="upstream in-frame stop codon"
     variation       complement(241)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199542510"
     variation       complement(244)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201571028"
     variation       complement(245)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200488126"
     variation       complement(254)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201873520"
     variation       complement(261)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200742181"
     variation       complement(264)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200262405"
     variation       complement(266)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145104753"
     variation       complement(269)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201127652"
     variation       complement(270)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200215028"
     CDS             273..2174
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="isoform 3 is encoded by transcript variant 3;
                     sodium- and chloride-dependent glycine transporter 1;
                     glyT-1; solute carrier family 6 member 9"
                     /codon_start=1
                     /product="sodium- and chloride-dependent glycine
                     transporter 1 isoform 3"
                     /protein_id="NP_001020016.1"
                     /db_xref="GI:67782317"
                     /db_xref="CCDS:CCDS30695.1"
                     /db_xref="GeneID:6536"
                     /db_xref="HGNC:HGNC:11056"
                     /db_xref="MIM:601019"
                     /translation="MVGKGAKGMLNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYA
                     VGLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRIS
                     PMFKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVL
                     DASNLTNGSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLL
                     GCLGVSWLVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLT
                     PQWDKILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATS
                     VYAGFVIFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFML
                     ILLGLGTQFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYW
                     LLLMDNYAASFSLVVISCIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSP
                     AIIFFILVFTVIQYQPITYNHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDT
                     LLQRLKNATKPSRDWGPALLEHRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNG
                     SSRLQDSRI"
     misc_feature    303..2054
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="Na(+)- and Cl(-)-dependent glycine transporter
                     GlyT1; solute-binding domain; Region: SLC6sbd_GlyT1;
                     cd11498"
                     /db_xref="CDD:212067"
     misc_feature    327..329
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    order(396..398,405..407,1455..1457,1464..1469)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="Na2 binding site [ion binding]; other site"
                     /db_xref="CDD:212067"
     misc_feature    order(399..404,408..419,639..641,1161..1166,1179..1181,
                     1185..1187,1467..1469,1476..1481)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative substrate binding site 1 [chemical
                     binding]; other site"
                     /db_xref="CDD:212067"
     misc_feature    order(402..404,417..419,1164..1166,1260..1262)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="Na binding site 1 [ion binding]; other site"
                     /db_xref="CDD:212067"
     misc_feature    order(423..428,636..638,648..650,657..659,1362..1364,
                     1374..1376)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative substrate binding site 2 [chemical
                     binding]; other site"
                     /db_xref="CDD:212067"
     misc_feature    762..764
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
                     /citation=[7]
     misc_feature    762..764
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative glycosylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:212067"
     misc_feature    771..773
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
                     /citation=[7]
     misc_feature    771..773
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative glycosylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:212067"
     misc_feature    801..803
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
                     /citation=[7]
     misc_feature    801..803
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative glycosylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:212067"
     misc_feature    819..821
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="glycosylation site"
                     /citation=[7]
     misc_feature    819..821
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /note="putative glycosylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:212067"
     misc_feature    987..989
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    1098..1100
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    2040..2042
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    2145..2147
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     variation       complement(273)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201644230"
     variation       complement(284)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201148088"
     variation       complement(293)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199963076"
     exon            303..459
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(320)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201241514"
     variation       complement(321)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145508338"
     variation       complement(364)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200404992"
     variation       complement(371)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143373456"
     variation       complement(374)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201449252"
     variation       complement(379)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202075645"
     variation       complement(384)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201288081"
     variation       complement(388)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200545935"
     variation       complement(392)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571004944"
     variation       complement(404)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368275687"
     variation       complement(445)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201697918"
     variation       complement(447)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200831315"
     variation       complement(448)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200036856"
     variation       complement(452)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201594396"
     variation       complement(455)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200759115"
     exon            460..591
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(464)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568272459"
     variation       complement(479)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199543202"
     variation       complement(500)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201434446"
     variation       complement(501)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200456440"
     variation       complement(510)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201864670"
     variation       complement(533)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140834307"
     variation       complement(534)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200256204"
     variation       complement(560)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201789512"
     variation       complement(562)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201267211"
     variation       complement(564)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61733178"
     variation       complement(569)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71652102"
     exon            592..862
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(613)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201707730"
     variation       complement(629)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201434525"
     variation       657
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3180325"
     variation       complement(663)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200461444"
     variation       complement(670)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:192630770"
     variation       complement(673)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202113654"
     variation       complement(679)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201065535"
     variation       complement(680)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201088849"
     variation       complement(688)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369079873"
     variation       complement(689)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144161106"
     variation       complement(693)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202065080"
     variation       complement(698)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111341121"
     variation       complement(714)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201110873"
     variation       complement(721)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200138928"
     variation       complement(733)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201812410"
     variation       complement(743)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200658319"
     variation       complement(744)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61741712"
     variation       complement(747)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201859476"
     variation       complement(756)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200984575"
     variation       complement(762)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199558856"
     variation       complement(764)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201151302"
     variation       complement(773)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148755700"
     variation       complement(776)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373309661"
     variation       complement(781)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146896289"
     variation       complement(788)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149578481"
     variation       complement(789)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142642003"
     variation       complement(800)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139332952"
     variation       complement(803)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537059366"
     variation       complement(807)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201636712"
     variation       complement(839)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201503761"
     variation       849
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193921002"
     variation       complement(851)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369945530"
     exon            863..995
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(869)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201076177"
     variation       complement(888)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199857788"
     variation       complement(913)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201950352"
     variation       complement(917)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200958790"
     variation       complement(918)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200161864"
     variation       complement(926)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140091591"
     variation       complement(935)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200526829"
     variation       complement(936)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143087050"
     variation       complement(946)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199702343"
     variation       complement(954)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146494090"
     variation       complement(962)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201865688"
     variation       complement(973)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140444555"
     variation       complement(977)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:72890664"
     variation       complement(992)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150606508"
     exon            996..1130
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1001)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189624767"
     variation       complement(1016)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113051677"
     variation       complement(1022)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200038641"
     variation       complement(1025)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201597633"
     variation       complement(1026)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200759556"
     variation       complement(1046)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199861598"
     variation       complement(1052)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201953737"
     variation       complement(1056)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200817470"
     variation       complement(1065)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199830284"
     variation       complement(1071)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148528601"
     variation       complement(1072)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201595292"
     variation       complement(1079)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2248829"
     variation       complement(1085)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147328144"
     variation       complement(1103)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199698561"
     variation       complement(1104)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201437896"
     exon            1131..1234
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1143)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201789795"
     variation       complement(1175)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200926104"
     variation       complement(1177)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200628650"
     variation       complement(1187)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201467484"
     variation       complement(1190)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138394765"
     variation       complement(1196)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147301597"
     variation       complement(1202)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141699039"
     variation       complement(1232)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61733181"
     variation       complement(1233)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148166342"
     variation       complement(1234)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201870833"
     exon            1235..1472
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1241)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200382619"
     variation       complement(1248)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201714942"
     variation       complement(1274)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146714632"
     variation       complement(1275)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149105213"
     variation       complement(1279)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369503630"
     variation       complement(1280)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202228487"
     variation       complement(1289)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200941888"
     variation       complement(1293)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199909193"
     variation       complement(1307)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:571108267"
     variation       complement(1308)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202049747"
     variation       complement(1310)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574665295"
     variation       complement(1314)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557841875"
     variation       complement(1319)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201128096"
     variation       complement(1331)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200125427"
     variation       complement(1332)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201591202"
     variation       complement(1336)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200761693"
     variation       complement(1345)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200484133"
     variation       complement(1376)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149979593"
     variation       complement(1393)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61736759"
     variation       complement(1415)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201010276"
     variation       complement(1417)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147902950"
     variation       complement(1418)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76354303"
     variation       complement(1437)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373147280"
     variation       complement(1454)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202048531"
     exon            1473..1607
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1486)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:202150611"
     variation       complement(1499)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200949863"
     variation       complement(1516)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143899045"
     variation       complement(1527)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201696830"
     variation       complement(1535)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201304448"
     variation       complement(1562)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137855830"
     variation       complement(1563)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201324692"
     variation       complement(1576)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200526873"
     variation       complement(1595)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199748043"
     exon            1608..1707
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1611)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201598031"
     variation       complement(1625)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201015834"
     variation       complement(1634)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549176835"
     variation       complement(1646)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199966777"
     variation       complement(1648)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199917588"
     variation       complement(1652)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532230193"
     variation       complement(1661)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201730213"
     variation       complement(1675)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:560460657"
     variation       complement(1696)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141601886"
     variation       complement(1706)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200915117"
     exon            1708..1808
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1709)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200257372"
     variation       complement(1714)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201783916"
     variation       complement(1731)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200955735"
     variation       complement(1744)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200179352"
     variation       complement(1753)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202100791"
     variation       complement(1754)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61748846"
     variation       complement(1756)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201011459"
     variation       complement(1778)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200069798"
     variation       complement(1783)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150135550"
     variation       complement(1787)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151007652"
     variation       complement(1788)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:533372781"
     variation       complement(1796)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369279085"
     variation       complement(1805)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199880680"
     exon            1809..1979
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     STS             1828..1996
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /standard_name="RH70220"
                     /db_xref="UniSTS:70770"
     variation       complement(1849)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200037433"
     variation       complement(1880)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575510500"
     variation       complement(1881)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562409620"
     variation       complement(1888)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141547886"
     variation       complement(1892)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201079660"
     variation       complement(1913)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144741950"
     variation       complement(1916)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573141764"
     variation       complement(1925)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202054416"
     variation       complement(1934)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145370858"
     variation       complement(1944)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139433292"
     variation       complement(1953)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200127899"
     variation       complement(1956)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200502398"
     variation       complement(1961)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201593344"
     variation       complement(1962)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:533671227"
     variation       complement(1963)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200660265"
     variation       complement(1966)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:577342572"
     variation       complement(1967)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:557535717"
     variation       complement(1978)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200072704"
     exon            1980..3236
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /inference="alignment:Splign:1.39.8"
     variation       complement(1981)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141553063"
     variation       complement(1993)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146175246"
     variation       complement(2028)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201048979"
     variation       complement(2038)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200340553"
     variation       complement(2045)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61733176"
     variation       complement(2047)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376189793"
     variation       complement(2052)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2286247"
     variation       complement(2060)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574166803"
     variation       complement(2067)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201488251"
     variation       complement(2081)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200635682"
     variation       complement(2082)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61733177"
     variation       complement(2083)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200955940"
     variation       complement(2094)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200328906"
     variation       complement(2107)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373799403"
     variation       complement(2116)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202156666"
     variation       complement(2117)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201082592"
     variation       complement(2126)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369947347"
     variation       complement(2137)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202174245"
     variation       complement(2138)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150379192"
     variation       complement(2141)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377626386"
     variation       complement(2147)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201953594"
     variation       complement(2151)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531939948"
     variation       complement(2152)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201167747"
     variation       complement(2157)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564615607"
     variation       complement(2164)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372648989"
     variation       complement(2166)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2286246"
     variation       complement(2187)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2286245"
     variation       complement(2190)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201173193"
     variation       complement(2193)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201807166"
     variation       complement(2196)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200555200"
     variation       complement(2203)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185364345"
     variation       complement(2206)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:573181848"
     variation       complement(2211)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368525682"
     variation       complement(2213)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201549864"
     variation       complement(2221)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2248253"
     variation       complement(2222)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139378717"
     variation       complement(2227..2228)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:565166708"
     variation       complement(2250)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201555057"
     variation       complement(2285)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200440159"
     variation       complement(2286)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199762570"
     variation       complement(2287)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201264443"
     variation       complement(2294)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200267278"
     variation       complement(2320)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202065176"
     variation       complement(2353)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201134884"
     variation       complement(2378)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200614289"
     variation       complement(2383)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557878745"
     variation       complement(2385)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201934576"
     variation       complement(2394)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79776471"
     variation       complement(2399)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200050448"
     variation       complement(2404)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201588526"
     variation       complement(2406)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201016250"
     variation       complement(2412)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182905740"
     variation       complement(2416)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367786403"
     variation       complement(2424)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201972548"
     variation       complement(2429)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200804702"
     variation       complement(2436)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199773796"
     variation       complement(2463)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201629009"
     variation       complement(2473)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535413379"
     variation       complement(2475)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556282397"
     variation       complement(2478)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200608179"
     variation       complement(2479)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35181336"
     variation       complement(2485)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201443634"
     variation       complement(2511)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:191572789"
     variation       complement(2526)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572024535"
     variation       complement(2537)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141576621"
     variation       complement(2539)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199585629"
     variation       complement(2547)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201502617"
     variation       complement(2562)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200426608"
     variation       complement(2572)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371888678"
     variation       complement(2584)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375653519"
     variation       complement(2617)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115695479"
     variation       complement(2628)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201320885"
     variation       complement(2635)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530894540"
     variation       complement(2640)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:568472803"
     variation       complement(2666)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200219272"
     variation       complement(2676)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201786872"
     variation       complement(2691)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200958732"
     variation       complement(2695)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200163494"
     variation       complement(2730)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201938940"
     variation       complement(2731)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201145530"
     variation       complement(2740)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200024354"
     variation       complement(2757)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:528435861"
     variation       complement(2767)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202049978"
     variation       complement(2774)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111725520"
     variation       complement(2777)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575219944"
     variation       complement(2779)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200820950"
     variation       complement(2784)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199881623"
     variation       complement(2803)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201758001"
     variation       complement(2810)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200700648"
     variation       complement(2828)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199759202"
     variation       complement(2830)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546084039"
     variation       complement(2834)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201326701"
     variation       complement(2848)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200787900"
     variation       complement(2849)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:532778960"
     variation       complement(2866)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12738252"
     variation       complement(2870)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199623406"
     variation       complement(2872)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201664620"
     variation       complement(2876)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200399371"
     variation       complement(2893)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186727188"
     variation       complement(2901)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201699691"
     variation       complement(2908)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201088040"
     variation       complement(2935)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200283885"
     variation       complement(2936)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:575265859"
     variation       complement(2961)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202236132"
     variation       complement(2997)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200950011"
     variation       complement(3005)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199914259"
     variation       complement(3006)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202022816"
     variation       complement(3030)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541854214"
     variation       complement(3048)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201135321"
     variation       complement(3085)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200129476"
     variation       complement(3093)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201565880"
     variation       complement(3094)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200603451"
     variation       complement(3095)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200015168"
     variation       complement(3104)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202016841"
     variation       complement(3106)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200870397"
     variation       complement(3117)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199568575"
     variation       complement(3118)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201482572"
     variation       complement(3151)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200602987"
     variation       complement(3152)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199798966"
     variation       complement(3159)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182168410"
     variation       complement(3160)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201049898"
     variation       complement(3160)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:113791919"
     variation       complement(3166)
                     /gene="SLC6A9"
                     /gene_synonym="GLYT1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200394119"
ORIGIN      
        1 tcttagcccc cgcctccccg aaaccaaaac acaacaggct gtggaagagc tgcgagcggc
       61 gcggcggggc gggcgaactc ggcgcggcac agagcctcgg gaggctgatg caactttccc
      121 tttaagaaag ccacctgggc gcaccgcggt gcggacccag cacgcctggg ccgggggctg
      181 cagcatgctc ttgagatctg tggcctgaaa ggcgctggaa gcagagcctg tgagtgtggt
      241 ccccgtcacc agagccccaa cccaccgccg ccatggtagg aaaaggtgcc aaagggatgc
      301 tgaatggtgc tgtgcccagc gaggccacca agagggacca gaacctcaaa cggggcaact
      361 ggggcaacca gatcgagttt gtactgacga gcgtgggcta tgccgtgggc ctgggcaatg
      421 tctggcgctt cccatacctc tgctatcgca acgggggagg cgccttcatg ttcccctact
      481 tcatcatgct catcttctgc gggatccccc tcttcttcat ggagctctcc ttcggccagt
      541 ttgcaagcca ggggtgcctg ggggtctgga ggatcagccc catgttcaaa ggagtgggct
      601 atggtatgat ggtggtgtcc acctacatcg gcatctacta caatgtggtc atctgcatcg
      661 ccttctacta cttcttctcg tccatgacgc acgtgctgcc ctgggcctac tgcaataacc
      721 cctggaacac gcatgactgc gccggtgtac tggacgcctc caacctcacc aatggctctc
      781 ggccagccgc cttgcccagc aacctctccc acctgctcaa ccacagcctc cagaggacca
      841 gccccagcga ggagtactgg aggctgtacg tgctgaagct gtcagatgac attgggaact
      901 ttggggaggt gcggctgccc ctccttggct gcctcggtgt ctcctggttg gtcgtcttcc
      961 tctgcctcat ccgaggggtc aagtcttcag ggaaagtggt gtacttcacg gccacgttcc
     1021 cctacgtggt gctgaccatt ctgtttgtcc gcggagtgac cctggaggga gcctttgacg
     1081 gcatcatgta ctacctaacc ccgcagtggg acaagatcct ggaggccaag gtgtggggtg
     1141 atgctgcctc ccagatcttc tactcactgg gctgcgcgtg gggaggcctc atcaccatgg
     1201 cttcctacaa caagttccac aataactgtt accgggacag tgtcatcatc agcatcacca
     1261 actgtgccac cagcgtctat gctggcttcg tcatcttctc catcctcggc ttcatggcca
     1321 atcacctggg cgtggatgtg tcccgtgtgg cagaccacgg ccctggcctg gccttcgtgg
     1381 cttaccccga ggccctcaca ctacttccca tctccccgct gtggtctctg ctcttcttct
     1441 tcatgcttat cctgctgggg ctgggcactc agttctgcct cctggagacg ctggtcacag
     1501 ccattgtgga tgaggtgggg aatgagtgga tcctgcagaa aaagacctat gtgaccttgg
     1561 gcgtggctgt ggctggcttc ctgctgggca tccccctcac cagccaggca ggcatctatt
     1621 ggctgctgct gatggacaac tatgcggcca gcttctcctt ggtggtcatc tcctgcatca
     1681 tgtgtgtggc catcatgtac atctacgggc accggaacta cttccaggac atccagatga
     1741 tgctgggatt cccaccaccc ctcttctttc agatctgctg gcgcttcgtc tctcccgcca
     1801 tcatcttctt tattctagtt ttcactgtga tccagtacca gccgatcacc tacaaccact
     1861 accagtaccc aggctgggcc gtggccattg gcttcctcat ggctctgtcc tccgtcctct
     1921 gcatccccct ctacgccatg ttccggctct gccgcacaga cggggacacc ctcctccagc
     1981 gtttgaaaaa tgccacaaag ccaagcagag actggggccc tgccctcctg gagcaccgga
     2041 cagggcgcta cgcccccacc atagccccct ctcctgagga cggcttcgag gtccagccac
     2101 tgcacccgga caaggcgcag atccccattg tgggcagtaa tggctccagc cgcctccagg
     2161 actcccggat atgagcacag ctgccagggg agtggcccca cccccacccc gtgctcccac
     2221 cgcagagact ggtgaggcag aggccaggtg tctctgcctg ccccctgcca cgccctggcc
     2281 aggacggctg ctgtcacctt ggtcaccact gctagtgcag tcattcatgc tcatgtcccc
     2341 agtgtttaca tgtcctttgg atgccaagat agcagctggg gggaggggtg ggagtggagg
     2401 gttgctggga ggtccaaagc actttggagg ggtctcgggc caggtcccca gcagcctgga
     2461 tggctttacg tggcctccga tacccttata ccctgccctg agctgaggtt ctgggtgggc
     2521 ctccagcccc atgactagtg ctcctgccct cagagccgac cccagcctct gccaggcaca
     2581 tttggctatt cctccctagg ggcaggatga agggctgggg gactgcccag tgttacttgt
     2641 caggctgtgc tgcccagccc tgtttatctg tgtaattatt tttgtaaaca ttgtattctc
     2701 tgtggtcgcc acctcctcgc ccccagcctc gggttcagtc tgtcttccag gcctgcttgc
     2761 acctcactgg gctgctccgg ggtctctgcc cctcattcca ggcctggctg tcaggcccag
     2821 ccagcagggg cccgtgaccc agcagcctgc ccaaagcatt tgtttctggg ggatggggtg
     2881 ggggctgctc cacaggaggt ttgagcccag caccctgggg aaggggaccc tgcacgacac
     2941 ccccttgccc tccctccatg aggctaaagg cccagtcttc ccaaatgtgc tgccctcgtt
     3001 catgtgccaa atggccccag cccacatgcc cctcccctct ctggagtggg agccccttct
     3061 gaagtgtctg aatccctgaa gtgttcattt gtccgtcctc tgtgcagtga cagccccggc
     3121 caagccacct ctaatcctct gtagcaataa cggtgcgccg cccatccctg cccattgtgc
     3181 accactagga ttttaaagtc catagatttt aatgaaattt ctattcctgt ctctga
//
DBGET integrated database retrieval system