KEGG   Cupriavidus necator H16: H16_A0065Help
Entry
H16_A0065         CDS       T00416                                 

Gene name
h16_A0065
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
reh  Cupriavidus necator H16
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    H16_A0065 (h16_A0065)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    H16_A0065 (h16_A0065)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     H16_A0065 (h16_A0065)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:79927..80535
Genome map
AA seq 202 aa AA seqDB search
MIRRPLLSSLAAALTLAAASTALLPAPVRAADKPAAAPAAGACPASLNFTFPRLQDDVPQ
NLCQYAGKVVLVVNTASYCGFTPQYEGLEALYAKYGARGLVVLGFPSNDFSQEPGSQKEI
ADFCYNTYGVKFPMLGKSHVRGSDANPMYALLAKQTGTTPKWNFYKYLIGRDGQVVASYG
SRTRPDDKELVAKIESLLGAQR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcgtcccctgctttccagcctggctgccgccctgaccctggcggcggccagc
accgccctgctgccggcgccggtgcgcgccgccgacaagcccgccgcggcgcctgccgcg
ggcgcctgccccgcctcgctcaacttcaccttcccgcgcctgcaggacgatgtgccgcag
aacctgtgccagtacgccggcaaggtggtgctggtggtcaataccgccagctattgcggc
ttcacgccgcagtacgagggcctggaggcgctgtacgccaagtacggcgcgcgcgggctg
gtggtgctgggcttcccgtccaatgacttttcgcaggagcccggctcgcagaaagagatc
gcggacttctgctacaacacctacggcgtcaagttcccgatgctcggcaagtcgcatgtg
cgcggcagcgatgccaacccgatgtacgcgctgctggcaaagcaaaccggcaccacgccc
aagtggaatttctacaagtacctgatcggccgcgatggccaggtggtggccagctatggc
agccgcaccaggccggacgacaaggaactggtggcgaagatcgaatcgctgctcggcgcg
cagcgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system