KEGG   Ralstonia eutropha H16: H16_A0142Help
Entry
H16_A0142         CDS       T00416                                 

Gene name
h16_A0142
Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00071  Fatty acid degradation
reh00280  Valine, leucine and isoleucine degradation
reh00281  Geraniol degradation
reh00310  Lysine degradation
reh00360  Phenylalanine metabolism
reh00362  Benzoate degradation
reh00380  Tryptophan metabolism
reh00410  beta-Alanine metabolism
reh00627  Aminobenzoate degradation
reh00640  Propanoate metabolism
reh00650  Butanoate metabolism
reh00903  Limonene and pinene degradation
reh00930  Caprolactam degradation
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01212  Fatty acid metabolism
Module
reh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    H16_A0142 (h16_A0142)
   00650 Butanoate metabolism
    H16_A0142 (h16_A0142)
  Lipid metabolism
   00071 Fatty acid degradation
    H16_A0142 (h16_A0142)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H16_A0142 (h16_A0142)
   00310 Lysine degradation
    H16_A0142 (h16_A0142)
   00360 Phenylalanine metabolism
    H16_A0142 (h16_A0142)
   00380 Tryptophan metabolism
    H16_A0142 (h16_A0142)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H16_A0142 (h16_A0142)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H16_A0142 (h16_A0142)
   00281 Geraniol degradation
    H16_A0142 (h16_A0142)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H16_A0142 (h16_A0142)
   00627 Aminobenzoate degradation
    H16_A0142 (h16_A0142)
   00930 Caprolactam degradation
    H16_A0142 (h16_A0142)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     H16_A0142 (h16_A0142)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CAJ91294
UniProt: Q0KFC7
Position
1:complement(155597..156430)
Genome map
AA seq 277 aa AA seqDB search
MTTPTADPTPLSPRYERYRALTLRRHGPILEIIMGAAQSANQKLATADANMHRELAEIWR
DVSADPEVRVALIRGEGKGFSAGGDLALVEDMANDFETRTRVWHEARDLVYNVINCDKPV
VSAMHGPAVGAGLVAGLLADISIAARSARIVDGHTRLGVAAGDHAAIVWPLLCGMAKAKY
YLMLCESVSGEEAERIGLVSLAVEEDELVARAFEVANRLAAGSQTAIRWTKYALNNWLRM
AGPAFDTSLALEFMGFAGPDVHEGVASLRQKRPPQFR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgactacccccaccgctgaccccacccccctctccccccgctacgagcgctatcgcgca
ctgacgctgcgccgccacggccccatcctcgaaatcatcatgggcgcggcccagtcggcc
aaccagaagctggccacggcggacgccaacatgcaccgcgagctggccgagatctggcgc
gacgtatccgccgaccccgaggtgcgcgtggcgctgatccgcggcgagggcaagggcttc
tccgccggcggcgacctggcgctggtggaagacatggccaacgacttcgagacccgcacc
cgcgtctggcacgaggcgcgcgacctggtctacaacgtcatcaactgcgacaagccggtg
gtctcagccatgcacggtcccgccgtcggcgccgggctggtggcgggcctgctggcagat
atctcgatcgcggccaggagcgcgcgcatcgtcgacggccatacccggctgggcgtggcc
gccggcgaccatgccgcgatcgtgtggccgctgctgtgcggaatggccaaggccaagtac
tatctgatgctgtgcgagtcggtcagcggcgaggaagccgagcggatcggcctggtctcg
ctggcggtggaagaggacgaactggtggcgcgcgccttcgaggtggccaaccggctggcg
gccgggtcgcagaccgcgatccgctggaccaagtacgccctcaataactggctgcgcatg
gccggccccgccttcgacacctcgctggcgcttgaattcatgggctttgccggccccgac
gtgcacgaaggcgtggcgagcctgcgccagaagcggccgccacagttcaggtaa

DBGET integrated database retrieval system