KEGG   Ralstonia eutropha H16: H16_A0332Help
Entry
H16_A0332         CDS       T00416                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_A0332 (gpmA)
   01230 Biosynthesis of amino acids
    H16_A0332 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A0332 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    H16_A0332 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A0332 (gpmA)
Enzymes [BR:reh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H16_A0332 (gpmA)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H16_A0332 (gpmA)
  Exosomal proteins of melanoma cells
   H16_A0332 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(354045..354791)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWVDVDLTETGADQARQAGKLLKDAGLGFDVAYTSVLKR
AIRTLWHVQDEMDLMWIPVRNEWRLNERHYGALAGLNKAETAAKFGDEQVLVWRRSYDTP
PPALEPTDPRASYDDPRYANVPRNEIPLTECLKDTVARVMPLWNESIAPDIQSGKRVVIA
AHGNSIRALVKYLDQISDDDIVGLNIPNGTPLVYELDADLRPLRHYYLGDQDAIAASLAA
VASQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtcctcatccgccacggcgaatccacgtggaaccttgaaaaccgcttt
accggctgggtcgacgtcgacctgaccgaaaccggcgccgaccaggcgcgccaggccggc
aagctgctcaaggatgccggcctgggctttgacgtggcctatacctcggtgctcaagcgt
gccatccgcacgctgtggcatgtgcaggatgaaatggacctgatgtggatcccggtgcgc
aacgaatggcgcctgaacgagcgccactacggcgcgctggccggcctgaacaaggcagaa
acggccgccaagttcggcgacgagcaggtgctggtgtggcgccgcagctatgacacgccg
ccgcccgcgctggagcccaccgatccgcgtgcctcgtacgacgatccgcgctacgccaat
gtgccgcgcaatgagatcccgctgaccgaatgcctgaaggacaccgtggcccgcgtgatg
ccgctgtggaacgaatccattgcccccgacatccaatcgggcaaacgcgtggtcattgcc
gcccatggcaacagcatccgcgcgctggtgaaatacctggaccagatctcggatgacgat
atcgtcggactcaatatccccaacggcaccccgctcgtctatgagctggacgccgacctg
cgccccctgcgccactactacctgggtgaccaggacgccatcgccgcctcgctggcggcc
gtggccagccagggcaaggcacgctga

DBGET integrated database retrieval system