KEGG   Ralstonia eutropha H16: H16_A0374Help
Entry
H16_A0374         CDS       T00416                                 

Gene name
h16_A0374
Definition
(GenBank) 4-Diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00900  Terpenoid backbone biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H16_A0374 (h16_A0374)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     H16_A0374 (h16_A0374)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CAJ91524
UniProt: Q0KEP7
Position
1:complement(391528..392406)
Genome map
AA seq 292 aa AA seqDB search
MHRSQPLPPPELRDCPAPAKLNLFLHVTGRRADGYHTLQTVFQLVDWCDTLHFRRRDDGV
VARVTDVPGVPAETDLVVRAARALQAATGATFGADIAIDKVLPMGGGIGGGSSDAATTLL
ALNHLWGLGLARAELMRIGLALGADVPVFVLGQNAFAQGIGEDLTPVELPESWFVVIHPK
QHVPTAEIFSDECLTRDTPLSIIAVFAARTNKFDFGRNDLEPIATAKFGEVARALAWLKQ
HNQHARMTGSGACVFARFPDAATAQQVLERLPPEWDGRCVRSLARHPLAALA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcagccagcccctgcccccgcccgaactgcgcgactgccccgcgccggccaag
ctcaacctgttcctgcacgtgaccggccgccgcgccgacggctaccacacgctgcagacc
gtgttccagctggtcgactggtgcgacacgctgcatttccgccggcgcgacgacggcgtg
gtcgcacgcgtcaccgacgtgcccggcgtgccggccgagaccgacctggtggtgcgcgcc
gcgcgcgcgttacaggcggccaccggtgccacgttcggggccgacatagccatcgacaag
gtgctgccgatgggcggcggcatcggtggcggctcgtccgatgccgccaccacgctgctg
gcgctgaatcacctgtggggactgggccttgcgcgtgccgaactgatgcgcatcgggctg
gcgctgggcgccgacgtgccagtattcgtgttgggccagaacgcctttgcacagggcatc
ggcgaggacctgacgccagtcgagctgcccgagagctggttcgtggtcatccacccgaaa
cagcatgtccccaccgctgaaattttttcggacgagtgcttgacaagggatacgccgctc
tccataattgcggtcttcgctgctcgcacaaacaaattcgatttcggtcgcaacgacctg
gaaccgatagcaacagcgaagttcggcgaagtcgcccgagccctggcatggctgaagcaa
cacaatcagcatgccaggatgaccggttccggagcctgcgtgtttgcgcgttttcccgac
gcagcaacagcgcagcaggttttggaaaggttgcctcccgaatgggacggcaggtgtgtg
cgcagtctggcacgtcatccgctcgcagcgctcgcgtag

DBGET integrated database retrieval system