KEGG   Cupriavidus necator H16: H16_A0498Help
Entry
H16_A0498         CDS       T00416                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.1.4.43)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
reh  Cupriavidus necator H16
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:reh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    H16_A0498 (ruvA)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     H16_A0498 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(522772..523353)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLIEKNPPHLLVDCHGVGYEVDVPMSTFYNLPAVGQPVTLLTQLIVREDAHLL
YGFGTASERNTFRELIKITGIGARMALAVLSGMSVPELAQAITLQEAGRLTRIPGIGKKT
AERLLLELKGKLGAELGHVPGTPAVPDSAVDVLNALLALGYSEKEAAAAIKQVPAGTGVS
DGIKLALKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcatcgccggcacccttatcgagaagaatcccccgcacctgctggtcgac
tgccacggcgtcggctacgaggtggacgtgccgatgagcaccttctacaacctgcccgcg
gtgggccagccggtgacactgctgacgcagctgatcgtgcgcgaggacgcgcacctgctg
tacggcttcggcaccgcatcggagcgcaacaccttccgcgagctgatcaagatcaccggc
atcggcgcgcgcatggcgctggcggtgctgtcgggcatgtcggtgcccgagctggcgcag
gccatcacgctgcaggaagccggccgcctcacgcgcattcccggcatcggcaagaagacc
gcggagcggctgctgctggagctcaagggcaagctgggcgcggagctgggccacgtgccg
ggcacgccggcggtgccggacagcgccgtcgacgtgctcaatgcgctgctggcgctgggc
tactcggaaaaggaagccgccgccgcgatcaagcaggtgccggcggggaccggcgtgtcg
gacggcatcaagctggcgctcaaggcattgtccaaggcttga

DBGET integrated database retrieval system