KEGG   Cupriavidus necator H16: H16_A0588Help
Entry
H16_A0588         CDS       T00416                                 

Gene name
h16_A0588
Definition
glycerol-3-phosphate acyltransferase PlsY
Orthology
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
reh  Cupriavidus necator H16
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    H16_A0588 (h16_A0588)
   00564 Glycerophospholipid metabolism
    H16_A0588 (h16_A0588)
Enzymes [BR:reh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     H16_A0588 (h16_A0588)
Lipid biosynthesis proteins [BR:reh01004]
 Phospholipid acyltransferase
  GPAT
   H16_A0588 (h16_A0588)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(622616..623224)
Genome map
AA seq 202 aa AA seqDB search
MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVLRTGNKKAAILTLIGD
ALKGWLAVWLAARFGPAYGLNETGLAMVALAVFLGHLFPVYHRFAGGKGVATAAGILLAI
DPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVDVMTGAIFVISVLLIAR
HRQNIAKLLAGKESRIGEKKKV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctgctattcgccctcgccgcctacctgatcggctccgtttccttcgctgtg
gtcgtcagcaagctgatgggcctgccggacccgcactcctatggctccggcaatcccggc
gccaccaacgtgctgcgcaccggcaacaagaaggccgccatcctgacgctgatcggcgat
gccctgaagggttggctggcggtatggctggccgcgcgcttcgggccggcctacgggctg
aacgaaaccggcctggccatggtggcgctggcggtcttcctggggcacctgttcccggtg
taccaccgcttcgccggcggcaagggcgtggccaccgcggccggcatcctgctcgccatc
gacccgatcctcggcctgggcacgctggccacgtggctgatcatcgcgttcttcttccgc
tactcgtcgctggcggcactggtggcggcgatcttcgcgccgttcttccatgtgctgatg
aacggcgtggatgtgatgacgggggcgatcttcgtgatcagcgtgctgctgattgctcgg
caccggcagaatattgccaagctgctggccgggaaggaaagccggatcggggagaaaaag
aaggtctga

DBGET integrated database retrieval system