KEGG   Ralstonia eutropha H16: H16_A0588Help
Entry
H16_A0588         CDS       T00416                                 

Gene name
h16_A0588
Definition
glycerol-3-phosphate acyltransferase PlsY
Orthology
K08591  
glycerol-3-phosphate acyltransferase PlsY [EC:2.3.1.15]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:reh00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:reh00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(622616..623224)
Genome map
AA seq 202 aa AA seqDB search
MANLLFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGATNVLRTGNKKAAILTLIGD
ALKGWLAVWLAARFGPAYGLNETGLAMVALAVFLGHLFPVYHRFAGGKGVATAAGILLAI
DPILGLGTLATWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVDVMTGAIFVISVLLIAR
HRQNIAKLLAGKESRIGEKKKV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctgctattcgccctcgccgcctacctgatcggctccgtttccttcgctgtg
gtcgtcagcaagctgatgggcctgccggacccgcactcctatggctccggcaatcccggc
gccaccaacgtgctgcgcaccggcaacaagaaggccgccatcctgacgctgatcggcgat
gccctgaagggttggctggcggtatggctggccgcgcgcttcgggccggcctacgggctg
aacgaaaccggcctggccatggtggcgctggcggtcttcctggggcacctgttcccggtg
taccaccgcttcgccggcggcaagggcgtggccaccgcggccggcatcctgctcgccatc
gacccgatcctcggcctgggcacgctggccacgtggctgatcatcgcgttcttcttccgc
tactcgtcgctggcggcactggtggcggcgatcttcgcgccgttcttccatgtgctgatg
aacggcgtggatgtgatgacgggggcgatcttcgtgatcagcgtgctgctgattgctcgg
caccggcagaatattgccaagctgctggccgggaaggaaagccggatcggggagaaaaag
aaggtctga

DBGET integrated database retrieval system