KEGG   Ralstonia eutropha H16: H16_A0817Help
Entry
H16_A0817         CDS       T00416                                 

Gene name
dadA1
Definition
D-amino acid dehydrogenase small subunit (EC:1.4.99.1)
Orthology
K00285  
D-amino-acid dehydrogenase [EC:1.4.99.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Phenylalanine metabolism
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:reh00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(890926..892230)
Genome map
AA seq 434 aa AA seqDB search
MRVLVLGSGVIGVTSAWYLAKAGHEVTVVDREAGPALGTSFANAGQISPGYASPWAAPGV
PLKAIKWMFQQHAPLSIRPDGTLFQLQWMWQMLQNCSAERYAVNKERMVRLAEYSRDCIR
ALRAETGIAYEGRQQGTLQVFRTDEQLQGAAKDIAVLEEAGVPYQLLSREELAASEPALA
AVRHKLAGGLRLPNDETGDCALFTQRLAGMAELLGVKFLYNRSIDRLMTQGDAVTGAVVD
GQPMDADLVVVALGSWSTQLVKPFLRGMSNLPVYPLKGFSITVPLSDPSRSPVSTVLDET
YKVAITRFDDRIRVGGMAQIVGYDRSLDPAKRRTLEHVVTDLFPGAGDVSQAAFWTGLRP
MTPDGTPIVGPTQVRGLWLNTGHGTLGWTMACGSGKLLSDLVSGTSPAIRADDLSVGRYL
KPARHHLAPRPATA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttctcgtactaggcagcggcgttattggcgtcaccagtgcgtggtatctggcc
aaggccggtcacgaagtgaccgtcgtcgaccgcgaggccgggcccgcgctcggcaccagc
tttgccaacgcggggcagatctcgcccggctatgcgtcgccgtgggcggcgccgggcgta
ccgctgaaggcgatcaagtggatgttccagcaacatgccccgctcagcatccgtccggac
ggcacgctgttccagctgcaatggatgtggcagatgctgcagaactgcagcgccgaacgc
tacgccgtcaacaaggagcgcatggtacggctggccgaatacagccgcgactgcatccgc
gcgctgcgcgcggagacgggcatcgcttatgaaggccgccagcaaggcacgctgcaggtg
ttccgcaccgacgagcagctgcaaggcgcggccaaggacatcgccgtgctggaagaagcc
ggcgtgccttaccagttgctttcgcgcgaggaactcgccgcgagcgaaccggcgctggcc
gccgtccgccacaagctggccggcggcctgcgcctccccaacgatgaaaccggcgactgc
gcgctgtttacgcaacggctcgcgggcatggccgagctgctgggcgtgaaattcctgtac
aaccgctcgatcgacagactgatgacccagggcgatgccgtcaccggcgccgtggtcgac
ggccagccgatggatgccgacctggtggtggtggcgctgggcagctggtcgacgcagctg
gtcaagccgttcctgcgtggcatgtccaacctgcccgtgtatccgctcaagggcttctcg
atcacggtgccgctgagcgatccgtcgcgcagcccggtgtccaccgtgctggacgaaacc
tacaaggttgccatcacccgcttcgacgaccgcatccgggtgggcggcatggcgcagatc
gtcggctatgaccgcagcctggatccggccaagcgccgcacgctcgaacacgtggtcacc
gacctgttcccgggcgccggcgatgtcagccaggccgccttctggaccggcctgcgcccg
atgacgccggacggtacgccgatcgtcggcccgacccaggtgcgcggcctgtggctgaac
acgggccacggcacgctcggctggaccatggcctgcggctcgggcaagctgctctcggac
ctggtctctggcacgtcgccggcgatccgcgccgacgacctgtcggtgggccgctacctg
aagccggcgcgccatcacctggcgcccaggcctgccactgcctga

DBGET integrated database retrieval system