KEGG   Ralstonia eutropha H16: H16_A0953Help
Entry
H16_A0953         CDS       T00416                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00230  Purine metabolism
reh01100  Metabolic pathways
Module
reh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    H16_A0953 (gmk)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     H16_A0953 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 AAA_16 ABC_tran Viral_helicase1 Septin AAA_25 cobW Dynamin_N DUF5053 AAA_18 AAA_29
Motif
Other DBs
NCBI-ProteinID: CAJ92098
UniProt: Q0KD23
Position
1:1047404..1048066
Genome map
AA seq 220 aa AA seqDB search
MSPTPQSAPHTAIDTVYPGNLFMVVAPSGAGKSTLVNKLLSQDPAIRLSISHTTRAPRPG
EQDGREYHFVTVDAFRAARDRGDFLEWAEVHGNYYATSRVWIEQQMAQGNDVLLEIDWQG
AQQVHQRFSNAVEIFILPPSLTALEERLKKRGQDEPNVIVRRLLAAGSEMAHASESDYVI
INEVFDDALEQLRNVISATRLRFSSQKARHTELFIELGIH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcccaacgcctcaatccgcgccacacactgccatcgataccgtctaccccggcaac
ctcttcatggtggtggcgccgtcaggagccggcaagtcgacgctggtcaacaagttgctg
tcgcaggacccggccatccgcctgtcgatctcgcacaccacgcgcgccccgcgcccgggc
gagcaggacgggcgcgagtaccacttcgtcacggtcgacgcgttccgcgccgcgcgcgac
cgcggcgacttcctggaatgggccgaggtccacggcaactactatgcgacctcgcgcgtg
tggatcgagcagcagatggcgcagggcaacgacgtgctgctggaaatcgactggcagggc
gcgcagcaggtgcaccagcgcttttccaacgcggtcgagatcttcatcctgccgccgtcg
ctgacggcgctggaagagcgcctgaaaaaacgcggccaggacgagcccaatgtgatcgtg
cgccggctgctggcggcgggcagtgaaatggcccacgcctcggagtcggactacgtcatc
atcaatgaggtcttcgacgatgctctggagcagttgcgcaacgtgatcagcgccacgcgg
ctgcggttttcctcgcagaaagcacggcatacggagctgtttatcgagctgggcatccac
tga

DBGET integrated database retrieval system