KEGG   Cupriavidus necator H16: H16_A1047Help
Entry
H16_A1047         CDS       T00416                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_A1047 (tpiA)
   01230 Biosynthesis of amino acids
    H16_A1047 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A1047 (tpiA)
   00051 Fructose and mannose metabolism
    H16_A1047 (tpiA)
   00562 Inositol phosphate metabolism
    H16_A1047 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    H16_A1047 (tpiA)
Enzymes [BR:reh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     H16_A1047 (tpiA)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   H16_A1047 (tpiA)
  Exosomal proteins of bladder cancer cells
   H16_A1047 (tpiA)
  Exosomal proteins of melanoma cells
   H16_A1047 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1145822..1146559
Genome map
AA seq 245 aa AA seqDB search
MRQKLVIGNWKMHGSLAANAALLEGIKAGAAKATLAVCAPFPYLAQCQALLNGSQVAWGA
QDVSAEARGAFTGEVSASMVGEFGCTYVLVGHSERRTYHGETDQTVAAKALRALEFGIVP
VVCVGETLAQREAGETEAVVGRQLQAVLDALTVEQLSRVVLAYEPVWAIGTGKTATSEQA
QAVHAFLRGQVAARDAGVAERMAILYGGSVKPDNAAELFSMTDIDGGLIGGASLKSADFL
AIGNA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgagacaaaagctcgtcatcggcaattggaagatgcatggcagcctggctgcaaacgcg
gcgctgctggagggcatcaaggctggcgcggccaaggcgacgctggcggtctgcgcgccg
ttcccctatcttgcacaatgccaggcgttgctgaatggctcgcaagtggcctggggcgca
caagatgtgtcggcagaggcgcgcggcgccttcaccggtgaagtctcggcatcgatggtg
ggtgagtttggctgcacttatgtgctggtcggccactcggagcgccgcacctatcatggc
gaaaccgaccagaccgtcgcggccaaggcgctgcgcgcgctggaattcggcatcgtcccg
gtagtctgcgtgggtgaaacactggcccagcgcgaggcgggcgaaaccgaagcggtggtc
ggcaggcagctgcaggccgtgctggacgcgctgacggtggagcagctgagccgcgtggtg
ttggcctatgagccggtctgggcgatcggcaccggcaagaccgccaccagcgagcaggcg
caggcggtgcacgcgttcttgcgcggccaggttgccgcgcgcgacgcgggcgtggccgag
cgtatggccatcctgtacggcggcagcgtcaagccggacaatgcggccgaactgttttcc
atgaccgatatcgacgggggcctgattggcggcgcctcgctgaagtcggcagattttctc
gcgatcggcaacgcctga

DBGET integrated database retrieval system