KEGG   Cupriavidus necator H16: H16_A1375Help
Entry
H16_A1375         CDS       T00416                                 

Gene name
pdhB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
reh  Cupriavidus necator H16
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_A1375 (pdhB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A1375 (pdhB)
   00020 Citrate cycle (TCA cycle)
    H16_A1375 (pdhB)
   00620 Pyruvate metabolism
    H16_A1375 (pdhB)
Enzymes [BR:reh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     H16_A1375 (pdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1492353..1494014
Genome map
AA seq 553 aa AA seqDB search
MSQAIEIKVPDIGDYDAVPVIEVHVKPGDSINAEDALVTLESDKATMDVPSPQAGVVKDV
RIKVGDNVSEGSVLVMLEAANEPAAAPAPAAAAPAPAAAAPAPAPAPAAAPAAAPAAGGG
GTIEVKVPDIGDYDAVPVIEVHVKAGDTINAEDAVVTLESDKATMDVPSPQGGVVKEVKV
KVGDNVAEGTLLLILEGAAASAAPAAAAAAPAPAASAPAPAPAPAAAAPAPAAAPAAAPA
AAGVTGKAAHASPSVRKFARELGVDVSRVPGTGPKGRITQEDVQGYVKGVMSGQAAAPAQ
AAAAGAGGGELGLLPWPKFDFTRFGEVESKALSRIKKISGANLHRNWVMIPHVTNHDEAD
ITELEAFRLQLNKENEKSGIKVTMLAFMIKATVAALKKFPNFNASLDGDNLVLKKYFNIG
FAADTPNGLVVPVIKDADKKGVLEISQEMSELAKLARDGKLKPDQMQGGCFSISSLGGLG
GTYFTPIINAPEVAIMGVCKSYQKPVWDGKQFAPRLTLPLSLSWDHRVIDGAEAARFNTY
FGQLLADFRRILL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgattgaaatcaaggtgccggatatcggcgactatgacgccgttcccgtc
atcgaagtgcatgtgaaacccggcgacagcatcaacgcggaagacgcgctggtgacgctg
gaatcggacaaggccaccatggacgtgccctcgccgcaggccggcgtggtcaaggacgtc
cgcatcaaggtgggcgacaacgtgtccgaaggctcggtgctggtgatgctggaggcggcc
aacgagcccgccgccgcacctgcccctgctgccgcagcaccggcgccggccgccgcagcc
cccgcaccggctcctgcccccgcagcagccccagccgcggccccggccgctggcggtggc
ggcaccatcgaagtcaaggtgcccgatatcggcgactacgacgccgtgccggtcatcgaa
gtccacgtcaaggcgggcgacaccatcaacgccgaagacgccgtggtgacgctggagtcc
gacaaggccaccatggacgtgccgtcgccgcaaggcggcgtggtcaaggaagtcaaggtc
aaggtcggtgacaacgtcgccgaaggcacgttgctgctgatcctggaaggcgccgccgca
tcagccgccccggcagctgccgccgcggcaccggctccggctgccagcgcgcccgcaccg
gcaccggcccccgcagccgccgccccggcaccggccgcagcacctgctgccgcgccggcc
gccgctggcgtaaccggcaaggccgcccacgccagcccctcggtgcgcaagttcgcacgc
gagctgggcgtggacgtgtcgcgcgtgccgggcaccggccccaagggccgtatcacccag
gaagacgtgcagggctacgtcaagggcgtgatgagcggccaggccgccgcgcccgcacag
gccgccgcggctggcgccggtggtggcgagctcggcctgctgccgtggccgaagttcgat
ttcacccgcttcggcgaggtcgaaagcaaggccctgtcgcgcatcaagaagatctcgggt
gccaacctgcaccgcaactgggtcatgatcccgcacgtcaccaaccatgacgaagcggac
atcaccgagctggaagccttccgcctgcagctgaacaaggaaaacgagaagtccggcatc
aaggtgacgatgctggcgttcatgatcaaggccacggtggcggcgctgaagaagttcccg
aacttcaacgcgtcgctcgatggtgacaacctcgtgctgaagaagtacttcaacatcggt
tttgccgccgacaccccgaacggcctggtcgtgccggtgatcaaggacgccgacaagaag
ggcgtgctggagatcagccaggaaatgagcgagctcgccaagctggcccgcgacggcaag
ctcaagccggaccagatgcagggcggctgcttctcgatctcttcgctgggcggcctcggc
ggcacatacttcacgccgatcatcaacgcgccggaagtggccatcatgggcgtgtgcaag
tcgtaccagaagccggtgtgggacggcaagcagttcgccccgcgcctgacgctgccgctg
tcgctgtcgtgggaccaccgcgtcatcgacggtgccgaagcggcgcgcttcaacacgtac
ttcgggcaactgctggcggatttccgccgcatcctgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system