KEGG   Ralstonia eutropha H16: H16_A1500Help
Entry
H16_A1500         CDS       T00416                                 

Gene name
h16_A1500
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
reh  Ralstonia eutropha H16
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    H16_A1500 (h16_A1500)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     H16_A1500 (h16_A1500)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     H16_A1500 (h16_A1500)
Lipid biosynthesis proteins [BR:reh01004]
 Fatty acid synthase
  Component type
   H16_A1500 (h16_A1500)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1627923..1628579)
Genome map
AA seq 218 aa AA seqDB search
MDIGIRGKWRRLLLATGMALTISAGASAQAAAPALLVLGDSLSAEYGIARGAGWVTLLQD
RLRQERFDYSVVNASISGETTIGGKTRLPELLSRHRPAIVVVELGANDALRGLPLQTTEA
NLRNIVSMAQKAGAGVLLIGMRIPPNYGQDYTEKFVSLYPKLAGEYKVRLVPFFLDNVIA
RQDWFQPDRIHPTAAAQPVLLDTVWPQLKPMLRRSGAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatattgggatccgaggcaaatggcgccggctgctgctggcaaccggcatggcactg
acgatatcggccggggcctcagcccaggctgcggcgccggcactgctggtgcttggcgac
agcctctccgccgagtacggcatcgcgcgcggcgcgggctgggtcacgctgctgcaggac
cgcctgcggcaggagcgcttcgattatagcgttgtcaatgccagcatcagcggcgagacc
accatcggcggcaagacgcggctgccggagctgctgtcgcggcaccgcccggccatcgtg
gtggtggagcttggcgccaacgacgcgctgcgcggattgccgctgcagaccactgaggcc
aacctgcgcaacatcgtcagcatggcacagaaggccggcgcgggcgtgctgctgatcggc
atgcgcatcccgcccaactacgggcaggactacaccgagaagttcgtctcgctgtatccg
aagctggccggcgagtacaaggtgcggctggtgccgttcttcctcgacaatgtcatcgcg
cggcaggactggttccagcccgaccgcatccacccgaccgccgcggcacagccagtgctg
ctcgatacggtgtggccgcagctcaagccgatgctcaggcgcagcggcgcgaagtaa

DBGET integrated database retrieval system