KEGG   Cupriavidus necator H16: H16_A1655Help
Entry
H16_A1655         CDS       T00416                                 

Gene name
betA3
Definition
choline dehydrogenase (EC:1.1.99.1)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
reh  Cupriavidus necator H16
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    H16_A1655 (betA3)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     H16_A1655 (betA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1801147..1802748
Genome map
AA seq 533 aa AA seqDB search
MSNALAYDVVVIGSGFGGAVSACRLAQAGRKVLVLERGRRWSPATYPRDESDPWLWNQER
ANRFNGWADIRTFSDVWVIAGAGVGGGSLIYANVSVEAKPEAFQQGWPKEVTYAGLQAHY
EEVGRMLAVSEVPDNQLSERTRLLREGAEACGWGGRFRKLPLAVTFSEHWDPTRQDARDD
RHSQTFMNQHGRLQGTCVHCGNCDVGCQVSARNTLDLNYLAVAEDNGAEILPLHLVDRLE
PLQQGWRVCFRKIDPENETTSPGTVTAARVILAAGSIGSTELLLRCRDEHRTLPGLSPRL
GYGWAHNGDFVTPAYYDHRTISPSHGVTISAAIDLLDHSGPNGQALFVEDGGIPNLAGNF
IRRHMKRTRSRKLRAVWKEVGGLFDDGDPVEQMMPWFGQGVDPGDGQLRLGRTWYAPWRR
VLRLDWSYQASVAVIEAMIAAHTQLSAATGGDPWVPLTWRRWHNLITPHPLGGCNMGTSA
ADGVVDARGRVFGYKGLYVMDGAIVPRPLGLNPSRTIAALAERNVAMLLREQD
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcgcttgcctacgatgtcgtcgtcatcggcagcggcttcggtggtgcagtc
tcggcgtgccggctcgcgcaggccggccgcaaggtgctggtgctggagcgcggccggcgc
tggagccccgcgacttacccgcgcgacgagagcgacccctggctgtggaaccaggagcgc
gccaatcgcttcaatggctgggccgatatccggaccttctctgacgtatgggtcatcgcc
ggggccggggtcggtggcggctcgctgatctacgccaacgtttccgtggaagccaagccg
gaagccttccagcagggctggccgaaagaggttacctatgccggcctgcaggcccactat
gaggaggtcgggcgcatgctcgcggtgagcgaagtgccggataaccagttgagcgagcga
acccggctgttgcgcgagggggcggaagcctgcggttggggcgggcgcttccgtaaattg
ccgctggcggtgacattttccgagcattgggaccccacacggcaagacgcccgcgatgac
cgtcattcacagacattcatgaaccagcacggcaggttgcagggcacttgtgttcactgc
ggcaactgtgacgtggggtgccaggtatcggccaggaatacgctggacctgaattacctg
gcagtggctgaggacaatggcgccgagattcttccgctgcacctggtagaccggctcgag
ccgctgcagcagggctggcgcgtatgcttcaggaagatcgacccggaaaacgaaacgacg
agccctggcacagtcacggccgccagggtgatactggccgccggctccatcggcagcacc
gagcttctgctgcgctgtcgggatgagcatcgcacacttccggggctttcgccacggttg
ggatatgggtgggcgcacaatggcgacttcgtgacgccagcctactatgaccacaggacg
atctctccttcccatggcgtaaccatctccgcagcgatcgacctgttggaccacagcggc
ccgaacggacaggcgctcttcgtggaggacggtggaatcccgaacctcgcaggcaacttc
attcggcgccatatgaagcgaacgcgttcccgcaagctgcgtgccgtgtggaaggaggtc
ggaggactgtttgacgacggcgatccggtcgagcagatgatgccctggttcgggcagggc
gtggaccctggcgatggccagctgagactgggccgcacgtggtacgcaccgtggcgtcgt
gtgctgcggctcgactggtcctatcaggcatcggtggccgtcatcgaggccatgattgca
gcgcatacgcagctctcggcagcgactggcggggatccgtgggtaccgctcacctggcga
cggtggcacaacctgatcacaccgcacccgctgggaggctgcaacatgggaacctccgct
gcagacggagtcgtcgatgcaaggggccgggtatttggctacaagggactgtatgtcatg
gacggagcgatcgtcccgcgtccgctcggcctgaatccttcgcgaaccatcgcggcgctc
gcggagcgcaacgtggcgatgctcttgcgcgagcaggactga

DBGET integrated database retrieval system