KEGG   Ralstonia eutropha H16: H16_A1806Help
Entry
H16_A1806         CDS       T00416                                 

Gene name
h16_A1806
Definition
acetaldehyde dehydrogenase (acetylating) (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
reh  Ralstonia eutropha H16
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:reh00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:reh00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:reh00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:reh00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:reh00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1969028..1969678
Genome map
AA seq 216 aa AA seqDB search
MRVIDLTPAAIGPYVIPVVNLDAHLDAPNINMVTCGGQATIPMVRAVSRVAPVHYAEIVA
SIASKSAGPGTRANIDEFTETTSRAIVEVGGARHGKAIIVLNPAEPPLIMRDTVYCLAEL
DADQDAIRDSVRDMAASVAEYVPGYRLKQAVQFERYEVERALNLPGIGRQAGLKVSIFLE
VEGAAHYLPAYAGNLDIMTSAALAAADRLAAARLGL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgatcgacctgacaccagcggccatcggtccctatgtcatcccagtcgtcaac
cttgacgcgcatctggatgccccgaacatcaacatggtcacctgcggcgggcaggcgacc
atcccgatggtgcgcgctgtctcccgcgtcgccccggtccattacgcggagattgttgcg
tccattgccagcaagtcggccggtcccggtacgcgcgccaacatcgacgagttcaccgag
acgacttcccgggccatcgtcgaagtcggcggagcgcgccacggcaaggccatcatcgtg
ctgaacccggccgagccgccgctcatcatgcgcgacacggtctactgcctggccgagctc
gacgccgaccaggacgcgatccgtgactcggtgcgcgacatggcggccagcgtagccgag
tacgtgccgggctaccgcctgaagcaggccgtacagttcgagcgctatgaggtggagcgg
gcgctgaacctgccgggcatcggtcggcaggccggcctgaaggtgtcgatcttcctggag
gtcgaaggcgcggcgcactacctcccggcctatgccggcaatctcgacatcatgaccagc
gcggcgctggcggccgcggaccggctggccgccgcgaggctcggcctgtga

DBGET integrated database retrieval system