KEGG   Cupriavidus necator H16: H16_A1806Help
Entry
H16_A1806         CDS       T00416                                 

Gene name
h16_A1806
Definition
acetaldehyde dehydrogenase (acetylating) (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
reh  Cupriavidus necator H16
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H16_A1806 (h16_A1806)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_A1806 (h16_A1806)
   00650 Butanoate metabolism
    H16_A1806 (h16_A1806)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    H16_A1806 (h16_A1806)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H16_A1806 (h16_A1806)
   00622 Xylene degradation
    H16_A1806 (h16_A1806)
   00621 Dioxin degradation
    H16_A1806 (h16_A1806)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     H16_A1806 (h16_A1806)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1969028..1969678
Genome map
AA seq 216 aa AA seqDB search
MRVIDLTPAAIGPYVIPVVNLDAHLDAPNINMVTCGGQATIPMVRAVSRVAPVHYAEIVA
SIASKSAGPGTRANIDEFTETTSRAIVEVGGARHGKAIIVLNPAEPPLIMRDTVYCLAEL
DADQDAIRDSVRDMAASVAEYVPGYRLKQAVQFERYEVERALNLPGIGRQAGLKVSIFLE
VEGAAHYLPAYAGNLDIMTSAALAAADRLAAARLGL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgatcgacctgacaccagcggccatcggtccctatgtcatcccagtcgtcaac
cttgacgcgcatctggatgccccgaacatcaacatggtcacctgcggcgggcaggcgacc
atcccgatggtgcgcgctgtctcccgcgtcgccccggtccattacgcggagattgttgcg
tccattgccagcaagtcggccggtcccggtacgcgcgccaacatcgacgagttcaccgag
acgacttcccgggccatcgtcgaagtcggcggagcgcgccacggcaaggccatcatcgtg
ctgaacccggccgagccgccgctcatcatgcgcgacacggtctactgcctggccgagctc
gacgccgaccaggacgcgatccgtgactcggtgcgcgacatggcggccagcgtagccgag
tacgtgccgggctaccgcctgaagcaggccgtacagttcgagcgctatgaggtggagcgg
gcgctgaacctgccgggcatcggtcggcaggccggcctgaaggtgtcgatcttcctggag
gtcgaaggcgcggcgcactacctcccggcctatgccggcaatctcgacatcatgaccagc
gcggcgctggcggccgcggaccggctggccgccgcgaggctcggcctgtga

DBGET integrated database retrieval system