KEGG   Ralstonia eutropha H16: H16_A1814Help
Entry
H16_A1814         CDS       T00416                                 

Gene name
h16_A1814
Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
reh  Ralstonia eutropha H16
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:reh00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:reh00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1976699..1977481)
Genome map
AA seq 260 aa AA seqDB search
MLEGKSAIVTGSSSGIGLGIARAFAAHGADVLLNGFGDAEQIEATRAGLEGEYGVRVRYS
PADMSQPCQVREMAEFAASEFGKVDVIVNNAGIQHVAPTEEMPDDKWDAIVAINLSSAFH
LIKAVLPGMKARRWGRIINIASAHGLVASPFKAPYVAAKHGLIGLSKAVALETAEFGITS
NTICPGYVKTPLVEQQIADQARAHRISPADVVRDVLLVHQARKEFVRIDELAVLALFLAS
DNSASMTATALAMDGGWTQH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaggaaaatcagccatcgttaccggctccagcagcggtatcgggcttggcatt
gcgcgcgcctttgccgcccatggcgccgatgtactgctgaacggcttcggcgatgccgag
caaattgaagccacgcgtgcagggctggagggcgagtatggcgtgcgcgtgcgctattcg
ccggcggatatgagccaaccttgccaggttcgcgaaatggccgaatttgctgcatccgag
ttcggcaaggttgacgtcatcgtgaataacgcgggcatccagcatgttgccccgaccgaa
gagatgccggacgacaagtgggacgccatcgttgccatcaacctgtcctcggcgttccac
ctgatcaaggccgtcctgcccggcatgaaggccaggcgctggggccgcatcatcaatatc
gcctccgcccatggcctggtggcttcgccgttcaaggcgccctatgtcgccgccaagcac
gggctgatcggcctgtccaaggctgtggcgctggagacggccgagtttggcattaccagc
aatacgatctgccccggctatgtcaagacgccgctggtggaacagcagatcgccgaccag
gcgcgcgcgcaccggatctcgcccgccgacgtcgtgcgcgatgtcctgctggtgcaccag
gcgcgcaaggagttcgtgcggattgacgaacttgctgtcctggccctgttcttggcctcg
gacaattcagcctcgatgaccgccactgcgctcgcaatggatggtggctggacccagcac
tga

DBGET integrated database retrieval system