KEGG   Cupriavidus necator H16: H16_A2012Help
Entry
H16_A2012         CDS       T00416                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
reh  Cupriavidus necator H16
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H16_A2012 (deoA)
Enzymes [BR:reh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     H16_A2012 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2183788..2185350)
Genome map
AA seq 520 aa AA seqDB search
MNDASSDPGIPGRPGDVVAAAAPREVGALVFRPLEIDTWQEHVIYMHPDCPVCRAEGFSA
QARVRVQIGDRSLIATLTLLGAPLLNTGEASLSLSAARTLSARAGDVVHVTHAPALESVR
ALRAKIYGCHLDSVQLDGIIGDISAGRYADVHIAAFLTACADGRMSLRETVDLTRAMVRS
GQRLNWDREVVADKHCVGGLPGNRTTPVVVAIAAAAGLLLPKTSSRAITSPAGTADTMEA
LTRVTLDSTELRRVVEQVGAALVWGGALSLSPADDVLIRVERALDIDSDAQLVASILSKK
IAAGSTHVLIDVPVGPTAKIREDSDLARLDLAMTKVADAFGLKLRILRTDGSQPVGRGVG
PALEALDVLAVLQCQPTAPADLRERSLLLAGELLEFCGAIPPGQGRLLAGSLLDSGAAWA
RFQAICEAQGGLRTPGQAVFRRDVVAARSGIVTSVDNRHVARTAKLAGAPRRQVAGLELH
VRAGDEVVAGAPLCTLHAQASGELEYAFSYALAHDPFRIE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatgccagttctgatcccggaattcccggccgtcccggcgatgtcgtggccgcc
gccgcgccccgcgaagtgggggcgctggtgttccggccgctcgagatcgatacgtggcag
gagcatgtcatctatatgcatccggattgccccgtctgccgcgccgagggcttttccgcg
caggcgcgcgtgcgcgtgcagatcggcgacaggtcgttgatcgccacgctgacgctgctg
ggcgcgccgctattgaacacgggcgaagcgagcctgtcgttgagcgcagcacggacgctt
tcggcacgcgccggcgatgtcgtgcatgtcacccatgcgcccgcgctggagtcggtgcgc
gcactgcgtgccaagatctatggctgccacctggacagcgtccagctcgacggcatcatc
ggcgacatcagtgcagggcggtacgccgacgtgcatattgcggcattcctcaccgcctgc
gcggacggtcgcatgagcctgcgcgagactgtcgacctgacccgggccatggtccggtcc
ggccagcgcttgaactgggaccgcgaggtggttgccgacaagcattgcgtcggtgggctg
ccgggcaatcgcaccacgccggtcgtcgtggctatcgcggcagcggccgggctgctgctg
cccaagacctcatcgcgcgcgatcacctcacccgccggcaccgccgatacgatggaagcc
ctgacccgcgtgacgctggattcgacggaactgcggcgcgtggtagaacaggtcggggct
gcattggtgtggggcggcgcgctgagcctgagtcccgcggacgacgtgttgatccgcgtg
gaacgcgcgctggatatcgacagcgatgcgcagctggtggcctcaatcctgtcgaagaag
attgccgccggctccacccacgtgctgatcgacgtgccggtggggccgacggccaagatc
cgcgaagacagcgatctggcgcgcctggatctcgccatgaccaaggtcgcggacgcgttc
gggctgaagctccggattctgcgcaccgacggctcgcagccggtgggccggggcgtcggc
cctgcgctcgaggcgctcgacgtgctggccgtgctgcagtgccagccgacggcgcccgcc
gacctgcgcgaacgctcgctgctgctggcgggcgagctgctggagttctgcggtgcgata
ccgcccgggcagggacggctgctggccggcagcctgctcgacagtggtgccgcctgggcc
cggttccaggcgatctgtgaagcgcaaggggggctgcgcaccccggggcaggcggtgttc
cggcgcgacgtggtcgcagcccgcagcggcatcgtgacgtccgtcgacaaccggcacgtc
gcgcgcacggcgaagctggccggggcgccgcgccggcaggtggccgggctggaactgcat
gtgcgcgccggcgacgaggtcgtagccggcgcaccgctctgtacgctgcatgcccaggcg
tccggcgaactggaatatgcgttcagctacgccctggcgcatgaccccttccgcatcgaa
tag

DBGET integrated database retrieval system