KEGG   Ralstonia eutropha H16: H16_A2069Help
Entry
H16_A2069         CDS       T00416                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase (DapE peptidase)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00300  Lysine biosynthesis
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01230  Biosynthesis of amino acids
Module
reh_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    H16_A2069 (dapE)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     H16_A2069 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAJ93169
UniProt: Q0KA02
Position
1:2250818..2251969
Genome map
AA seq 383 aa AA seqDB search
MTATLALTEDLIRRRSVTPADEGCQAILETRLKALGFDCEALVSGPDDFRVTNLWAVRRG
TQGKDGKLLVFAGHTDVVPTGPLEQWHSDPFAPTHRDGKLYGRGAADMKTSIAGFVVAVE
EFVKAHPAHAGSIAFLITSDEEGPAHDGTIKVVEALSARGERLDYCVIGEPTSVDTLGDM
VKNGRRGSLSGKLTVKGIQCHIAYPHLGRNPIHEAAPALAELAAEVWDQGNEYFPPTSWQ
MSNIHGGTGATNVIPGHVTIDFNFRFSTASTPEGLKARVHAILDRHQLEYALDWTLGGEP
FLTPRGELSDALSSAIEAETGVKTELSTTGGTSDGRFIAKICPQVIEFGPPNASIHKIDE
HVEVRFIEPLKNVYRGVLERLVA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccctcgccctcaccgaagacctgatccgccgccgctccgtcacgcccgcc
gacgaaggctgccaggccatcctggaaacccgcctgaaggcgctcggcttcgactgcgaa
gcgctcgtcagcggccccgacgatttccgcgtgaccaacctgtgggcggtcaggcgcggc
acgcagggcaaggacggcaagctgctggtctttgccggccataccgacgtggtgccgacc
ggcccgctggagcagtggcattcggacccgttcgcgccgacgcaccgcgacggcaagctg
tacggccgcggcgccgccgacatgaagacctccatcgccggcttcgtggtggcggtggaa
gagttcgtcaaggcgcatcctgcgcatgccggctcgatcgccttcctgatcaccagcgac
gaggaaggcccggcgcacgacggcaccatcaaggtggtcgaggccctgtccgcacgcggc
gagcgcctggactactgcgtgatcggcgagccgacctcggtcgacacgctcggcgacatg
gtcaagaacggccgccgcggctcgctctcgggcaagctcacggtcaagggcattcagtgc
catatcgcctacccgcacctgggccgcaacccgatccatgaagccgcgccggcgctggcc
gagctggccgccgaggtctgggaccagggcaacgagtacttcccgccgaccagctggcag
atgtcgaacatccacggcggcaccggcgccaccaacgtgatcccgggccacgtcaccatc
gacttcaacttccgcttctcgaccgccagcacgcccgaaggcctgaaggcgcgcgtgcat
gcgatcctggaccgccaccagctcgaatacgcgctggactggaccctgggcggcgagccc
ttcctgaccccgcgcggcgagctgtccgacgcgctgtcgtcggcgatcgaggccgagacc
ggcgtcaagaccgagctgtcgaccaccggcggcacctcggacgggcgctttatcgccaag
atctgcccgcaggtgatcgagttcgggccgcccaacgccagcatccacaagatcgacgag
cacgttgaagtgcgcttcatcgagccgctgaagaacgtttaccgcggcgtgctggaacgt
ctcgtcgcctga

DBGET integrated database retrieval system