KEGG   Cupriavidus necator H16: H16_A2070Help
Entry
H16_A2070         CDS       T00416                                 

Gene name
dam
Definition
N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase
Orthology
K07320  
putative adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
reh  Cupriavidus necator H16
Brite
Enzymes [BR:reh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     H16_A2070 (dam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2251995..2252888
Genome map
AA seq 297 aa AA seqDB search
MATPSPLRTVRDLLRLAVSRFTAARLSFGHGSANAYDEAAYLVLHTLNLPLDTLDPFLDA
RLLPEEVDTVLKVIERRVNERVPAAYITHEAFMHGLRFYVDSRVIVPRSFIGELLQDGLE
PWVGETDSIGPVLELCTGSGCLPIVAAHVWPNAKIDAVDISPDALAVARRNVADYKMDDR
IRLYEGDLYAPLPHGATYDVILTNPPYVNEGSMQALPPEYLAEPRIALAGGDDGMDVVRR
IIAGAKAHLNPGGVLVVEIGNEHANVEAAFPELEIVWLPVSAGDEQVFLLTYDALPG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgccctctcccctgcgcaccgtgcgcgacctgctgcgtctcgcagtctcgcgc
tttaccgccgcgcgcctgtcctttggccacggcagcgccaatgcctatgacgaagccgcc
tacctggtgctgcatacgctgaacctgccgctcgacacgctcgatcccttcctggacgcg
cgcctgctgcccgaggaagtcgataccgtgctcaaggtcatcgagcgccgcgtcaatgag
cgcgtgccggccgcctacatcacgcacgaggcctttatgcacggcctgcgcttctacgtc
gattcacgcgtgatcgtgccgcgcagctttatcggcgaactgctgcaggacgggctggag
ccctgggtcggcgagaccgacagcatcggcccggtgctggagctgtgcaccggttccggc
tgcctgccgatcgtggccgcgcacgtgtggccgaacgcgaagatcgacgccgtcgacatc
tcgcccgacgcgctcgccgtggcgcgccgcaacgtggccgactacaagatggacgaccgc
atccggctgtatgaaggcgacctgtacgcgccgctgccgcacggcgccacctacgacgtg
atcctgaccaacccgccctacgtcaacgaaggctcgatgcaggcgctgccgccggaatac
ctggccgagccgcgcatcgccctggccggcggcgacgacggcatggacgtggtgcgccgg
atcatcgccggcgccaaggcgcacctgaatccgggcggcgtgctggtggtagagatcggc
aacgagcacgccaacgtggaagccgcgttccctgaactggaaatcgtctggctgccggtc
agtgcgggggatgagcaggtattcctgctgacctacgacgccctgccgggctga

DBGET integrated database retrieval system