KEGG   Ralstonia eutropha H16: H16_A2183Help
Entry
H16_A2183         CDS       T00416                                 

Gene name
h16_A2183
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
reh  Cupriavidus necator H16
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_A2183 (h16_A2183)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H16_A2183 (h16_A2183)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H16_A2183 (h16_A2183)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     H16_A2183 (h16_A2183)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H16_A2183 (h16_A2183)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2375787..2377238)
Genome map
AA seq 483 aa AA seqDB search
MRRLSILAAPLLALAVASCGSDDDNNAPVTQPPAAGSTAPAKNVVFFLGDGMGMTTMTAA
RIYKVGEDGDLTMDTLPESGFIRTYSNNAQVTDSAPSMAAYMTGVKMNNEVISMTPETNA
FDASGKDYLSGADSTCPASGNGQSVPTLLEQMKAAGYGTGVVTTTRITHATPATTYAHVC
HRDAENTIAAQLVPHGAGYNSALGDGVDVIFGGGRKHFQNKAAGGARTDGRDLVGELTKA
GYAYVSSKAEFDKIDAASAKKVAGLFTSSHMAYDLDRVPGDEPSLAEMTGKAIDVLAAKR
KGFFLMVEGGRIDHALHETTARKALQDTVAFDTAIKTAIDKLNVIDPGLKNTLIVVTADH
DHTLVLNGYAKRTGPTSDSNPGVLGLLKNYVTGALSTDSGGNPFTIIGFGTGENRPATRT
ALTDAQVYDKSYHQEAAIPTAAGGETHGGTDVFIGALGNGAESFAGVMDNTDVFGLIKTA
IGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtctttcaatactggcagccccgctgctggcgctggccgtagcgtcgtgcggc
agcgatgatgacaacaatgcgccggtcacgcagccgccggctgccggcagcaccgcgccg
gcgaagaacgtcgtgttcttccttggcgacggcatgggcatgacgaccatgaccgcggcg
cggatctacaaggtcggcgaggatggggacctgaccatggatacgctccccgagagcggg
tttatccggacctattcgaacaacgcgcaggtgaccgacagtgcgccgtcgatggcggcc
tacatgactggcgtcaagatgaacaacgaagtcatctcgatgacgccggagaccaatgcc
ttcgacgccagcggcaaggactacctgtccggcgcggacagcacctgcccggcttccggc
aacggccagagcgtgccgacgctgctcgagcagatgaaggcggcaggctacggcaccggc
gtggtcaccaccacccgcatcacgcacgcaacccccgccacgacctacgcgcacgtgtgc
caccgcgacgccgagaacaccatcgccgcgcaactggtgccgcacggcgctggctacaac
agcgcgcttggtgatggcgtcgatgtgatcttcggcggcggccgcaagcacttccagaac
aaggccgcgggcggcgcccgcaccgacggccgcgacctggtcggcgagctgaccaaggcc
ggctatgcctacgtttccagcaaggccgagttcgacaagatcgacgccgccagcgcgaag
aaggtggcagggttgttcacgtccagccatatggcctacgacctggaccgcgtgcccggc
gatgaaccgagcctggcggagatgaccggcaaggccatcgacgtgcttgccgcgaagagg
aagggcttcttcctgatggtggaaggcggccgcatcgaccacgcattgcatgaaaccacc
gcgcgcaaggcgctgcaggacaccgtggccttcgacaccgcgatcaagaccgcgatcgac
aagctcaacgtgatcgacccgggcctgaagaacacgctgatcgtcgtcaccgccgaccat
gaccacacgctggtgctgaacggctacgccaagcgcaccggccccaccagcgacagcaac
cccggcgtgctgggcctgctgaagaactacgtgaccggcgccctgtccacggactccggc
ggcaatcctttcaccattatcggcttcggcaccggcgagaaccgcccggccacgcgcacc
gcgctgaccgatgcacaggtctacgacaagagctatcaccaggaagccgcgatcccgacg
gcggcgggtggcgagacccatggcggcaccgatgtctttatcggcgcactgggcaacggt
gccgaatccttcgccggtgtgatggacaacaccgacgtgttcggcctgatcaagacggcc
atcggcctctaa

DBGET integrated database retrieval system