KEGG   Ralstonia eutropha H16: H16_A2217Help
Entry
H16_A2217         CDS       T00416                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
reh  Ralstonia eutropha H16
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:reh01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:reh00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:reh00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2408177..2409763)
Genome map
AA seq 528 aa AA seqDB search
MAITLPAGMKITGEILPAYEDILTPEALALVDKLHRAFEPRRQELLAARVERAKRLDAGE
IPDFLPETKSIREGDWKVAPIPQALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSN
TPNWHNQLQGQVNLKAAVRRTLTLESKGKQYKLNDKIATLQVRPRGWHLDEKHVTIDGKR
ISGGIFDFALFLFHNAREQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVTM
TAPFMRAYALLLLKTCHHRGAPAMGGMSALIPIKNDPEKNAIAMEGIISDKRRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFGKQRPDVQVKGADLLDFKPETPITEHGLRMNI
NVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKALVGGDTKTYDRAAEIFEQMSTSEDFAEFLTLPLYEEV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacgctgcccgcgggcatgaagattaccggcgagatcctgccggcctacgaa
gatatcctcacgccggaagccctggccctggtagacaagctgcaccgcgcctttgagccg
cgccgtcaggaactgctggccgcgcgcgtggaacgcgccaagcgcctggacgccggtgag
atccccgacttcctgccggaaaccaagagcatccgcgaaggcgactggaaggttgccccg
atcccccaggccctggaatgccgccgcgtggaaatcaccggcccggtcgaggccaagatg
gtcatcaacgccttcaactcgggcgctgacagctacatgaccgacttcgaggattccaac
acccccaactggcacaaccagctgcagggccaggtcaacctgaaggccgccgtgcgccgc
acgctgaccctggaatccaagggcaagcaatacaagctgaacgacaagatcgccaccctg
caagtgcgtccgcgcggctggcacctggacgagaagcacgtcaccatcgacggcaagcgc
atctcgggcggcatcttcgacttcgcgctgttcctgttccacaacgcccgcgagcagatc
gcccgcggcgccggcccgttcttctacctgcccaagatggaaagccatctggaagcgcgc
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggcctgccgcaaggcaccatc
aaggccaccgtgctgatcgaaacgatcctggcggcgttcgagatggacgaaatcctgtat
gaactgcgcgagcacagcgctggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagaacgacaaggacttctgcctggccgaccgcgccaaggtcacgatg
accgcgccgttcatgcgtgcctacgcgctgctgctgctcaagacctgccaccaccgcggc
gctcccgccatgggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggaaggcatcatcagcgacaagcgccgcgatgccaccgacggctacgac
ggcggctgggttgcccacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgacaagcccaaccagttcggcaagcaacgccccgacgtgcaagtgaagggcgcc
gacctgctcgacttcaagccggaaacgccgatcaccgagcatggcctgcgcatgaacatc
aacgtcggcatccactacctgggcgcctggctggatggcaacggctgcgtgccgatccac
aacctgatggaagatgctgctactgccgagatctcgcgctcgcaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtgacggccgagctggtgcgcaag
ctgattccggaagagctggcgaaggtgaaggcactggtgggtggcgataccaagacctat
gaccgggctgccgagatttttgagcagatgtctacgtcggaggattttgctgagtttctg
acgctgccgctgtatgaggaagtttaa

DBGET integrated database retrieval system