KEGG   Ralstonia eutropha H16: H16_A2217Help
Entry
H16_A2217         CDS       T00416                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
reh  Ralstonia eutropha H16
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H16_A2217 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_A2217 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    H16_A2217 (aceB)
Enzymes [BR:reh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     H16_A2217 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2408177..2409763)
Genome map
AA seq 528 aa AA seqDB search
MAITLPAGMKITGEILPAYEDILTPEALALVDKLHRAFEPRRQELLAARVERAKRLDAGE
IPDFLPETKSIREGDWKVAPIPQALECRRVEITGPVEAKMVINAFNSGADSYMTDFEDSN
TPNWHNQLQGQVNLKAAVRRTLTLESKGKQYKLNDKIATLQVRPRGWHLDEKHVTIDGKR
ISGGIFDFALFLFHNAREQIARGAGPFFYLPKMESHLEARLWNDIFVMAQNEIGLPQGTI
KATVLIETILAAFEMDEILYELREHSAGLNAGRWDYIFSCIKKFKNDKDFCLADRAKVTM
TAPFMRAYALLLLKTCHHRGAPAMGGMSALIPIKNDPEKNAIAMEGIISDKRRDATDGYD
GGWVAHPGLVEPAMKEFVAVLGDKPNQFGKQRPDVQVKGADLLDFKPETPITEHGLRMNI
NVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGTKVTAELVRK
LIPEELAKVKALVGGDTKTYDRAAEIFEQMSTSEDFAEFLTLPLYEEV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggctatcacgctgcccgcgggcatgaagattaccggcgagatcctgccggcctacgaa
gatatcctcacgccggaagccctggccctggtagacaagctgcaccgcgcctttgagccg
cgccgtcaggaactgctggccgcgcgcgtggaacgcgccaagcgcctggacgccggtgag
atccccgacttcctgccggaaaccaagagcatccgcgaaggcgactggaaggttgccccg
atcccccaggccctggaatgccgccgcgtggaaatcaccggcccggtcgaggccaagatg
gtcatcaacgccttcaactcgggcgctgacagctacatgaccgacttcgaggattccaac
acccccaactggcacaaccagctgcagggccaggtcaacctgaaggccgccgtgcgccgc
acgctgaccctggaatccaagggcaagcaatacaagctgaacgacaagatcgccaccctg
caagtgcgtccgcgcggctggcacctggacgagaagcacgtcaccatcgacggcaagcgc
atctcgggcggcatcttcgacttcgcgctgttcctgttccacaacgcccgcgagcagatc
gcccgcggcgccggcccgttcttctacctgcccaagatggaaagccatctggaagcgcgc
ctgtggaacgacatcttcgtgatggcgcagaacgagatcggcctgccgcaaggcaccatc
aaggccaccgtgctgatcgaaacgatcctggcggcgttcgagatggacgaaatcctgtat
gaactgcgcgagcacagcgctggcctgaacgccggccgctgggactacatcttctcgtgc
atcaagaagttcaagaacgacaaggacttctgcctggccgaccgcgccaaggtcacgatg
accgcgccgttcatgcgtgcctacgcgctgctgctgctcaagacctgccaccaccgcggc
gctcccgccatgggcggcatgagcgcgctgatcccgatcaagaacgatccggagaagaac
gccatcgccatggaaggcatcatcagcgacaagcgccgcgatgccaccgacggctacgac
ggcggctgggttgcccacccgggcctggtcgagccggccatgaaggaattcgtggcagtg
ctgggcgacaagcccaaccagttcggcaagcaacgccccgacgtgcaagtgaagggcgcc
gacctgctcgacttcaagccggaaacgccgatcaccgagcatggcctgcgcatgaacatc
aacgtcggcatccactacctgggcgcctggctggatggcaacggctgcgtgccgatccac
aacctgatggaagatgctgctactgccgagatctcgcgctcgcaggtgtggcagtggatc
cgctcgccgaagggcaagctggaagacggcaccaaggtgacggccgagctggtgcgcaag
ctgattccggaagagctggcgaaggtgaaggcactggtgggtggcgataccaagacctat
gaccgggctgccgagatttttgagcagatgtctacgtcggaggattttgctgagtttctg
acgctgccgctgtatgaggaagtttaa

DBGET integrated database retrieval system