KEGG   Ralstonia eutropha H16: H16_A2265Help
Entry
H16_A2265         CDS       T00416                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00260  Glycine, serine and threonine metabolism
reh00750  Vitamin B6 metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01230  Biosynthesis of amino acids
Module
reh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A2265 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    H16_A2265 (thrC)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     H16_A2265 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: CAJ93362
UniProt: Q0K9F9
Position
1:complement(2458640..2460085)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHEMPQSFSEILLGGLAPDGGLYLPTQYPQVTADELEAWRKLSYADLAYEILR
KFCDDIPAEDLRALTRKTYTPEVYCNAREGDNTADITPLRTLGEEGGTRLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALGRAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDANIFNLAVEGVFDDCQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATSGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLVVLFRDVEEKGGF
DLSGTPEFDRIREFGFVSGRSTHDDRVATIRDLSSRYGITIDTHTADGVKVAREHLSAGV
PMVVLETALPAKFADTIREALGHEPERPAKFEGIESLPQRFEVMPADAAQVKAYIAGHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccatgagatgccgcaatcgttttccgagatcctgctg
ggcggcctggcgccggacggcgggctgtacctgcctacgcagtacccgcaagtcaccgcc
gacgaactggaggcctggcgcaagctgtcgtatgccgacctggcctacgagatcctgcgc
aagttctgcgacgatattcctgccgaggacctgcgcgcgctgacgcgcaagacctatacg
cccgaggtgtactgcaacgcgcgcgagggcgacaacaccgccgacatcacgccgctgcgc
acgctcggcgaggaaggtggcaccaggctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctgggc
cgcgccgggcaggagctgaacatcctgggcgcgacttccggcgataccggcagcgcggca
gaatacgccatgcgcggcaagcgcggcatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggacgccaacatcttcaacctt
gccgtcgaaggcgtgttcgacgattgccaggacatcgtcaaggcggtctccaacgacctc
gactacaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcacgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggccaccagcggccccggccagaag
gtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtagtggccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggtgcctaccgcgtgcgcaagtcggccgagacgtaccacacctcg
agcccgagcatggatatttccaaggcctcgaacttcgagcgcttcgtgttcgacctgctc
ggccaggacgccggcaagctggtggtgctgttccgcgacgtggaagagaagggcggcttc
gacctgtcgggcacgccggaattcgaccgcatccgcgagttcggctttgtctcgggccgc
agcacgcacgacgaccgcgtagcgaccatccgcgacctgtcttcgcgctacggcatcacc
atcgatacccacaccgccgatggcgtcaaggtggcgcgcgagcatctcagcgccggcgtg
ccgatggtggtgctggaaaccgcgctgccggccaagtttgccgacactatccgcgaagcg
ctcggccacgagccggagcgccccgcaaagttcgagggcatcgagagcctgccgcagcgc
tttgaagtgatgccggccgacgccgcacaggtcaaggcctatatcgccggccacaccggc
ctgtaa

DBGET integrated database retrieval system