KEGG   Ralstonia eutropha H16: H16_A2265Help
Entry
H16_A2265         CDS       T00416                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H16_A2265 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A2265 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    H16_A2265 (thrC)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     H16_A2265 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2458640..2460085)
Genome map
AA seq 481 aa AA seqDB search
MKYQSTRGHEMPQSFSEILLGGLAPDGGLYLPTQYPQVTADELEAWRKLSYADLAYEILR
KFCDDIPAEDLRALTRKTYTPEVYCNAREGDNTADITPLRTLGEEGGTRLQLLGLSNGPT
LAFKDMAMQLLGNLFEYALGRAGQELNILGATSGDTGSAAEYAMRGKRGIRVFMLSPHRK
MSAFQTAQMFSLQDANIFNLAVEGVFDDCQDIVKAVSNDLDYKARQKIGTVNSINWARVV
AQVVYYFKGWLLATSGPGQKVSFCVPSGNFGNVCAGHIARMMGLPIDKLVVATNENDVLD
EFFRTGAYRVRKSAETYHTSSPSMDISKASNFERFVFDLLGQDAGKLVVLFRDVEEKGGF
DLSGTPEFDRIREFGFVSGRSTHDDRVATIRDLSSRYGITIDTHTADGVKVAREHLSAGV
PMVVLETALPAKFADTIREALGHEPERPAKFEGIESLPQRFEVMPADAAQVKAYIAGHTG
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccagtcgacccgcggccatgagatgccgcaatcgttttccgagatcctgctg
ggcggcctggcgccggacggcgggctgtacctgcctacgcagtacccgcaagtcaccgcc
gacgaactggaggcctggcgcaagctgtcgtatgccgacctggcctacgagatcctgcgc
aagttctgcgacgatattcctgccgaggacctgcgcgcgctgacgcgcaagacctatacg
cccgaggtgtactgcaacgcgcgcgagggcgacaacaccgccgacatcacgccgctgcgc
acgctcggcgaggaaggtggcaccaggctgcaactgctgggcctgtccaacggcccgacg
ctggccttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacgcgctgggc
cgcgccgggcaggagctgaacatcctgggcgcgacttccggcgataccggcagcgcggca
gaatacgccatgcgcggcaagcgcggcatccgcgtgttcatgctgagcccgcaccgcaag
atgagcgcgttccagaccgcgcagatgttcagcctgcaggacgccaacatcttcaacctt
gccgtcgaaggcgtgttcgacgattgccaggacatcgtcaaggcggtctccaacgacctc
gactacaaggcgcgccagaagatcggcacggtcaactcgatcaactgggcacgcgtggtg
gcccaggtggtgtactacttcaagggctggctgctggccaccagcggccccggccagaag
gtgtcgttctgcgtgccgtcgggcaacttcggcaacgtctgcgccggccatatcgcgcgc
atgatgggcctgccgatcgacaagctggtagtggccaccaacgagaacgacgtgctcgac
gagttcttccgcaccggtgcctaccgcgtgcgcaagtcggccgagacgtaccacacctcg
agcccgagcatggatatttccaaggcctcgaacttcgagcgcttcgtgttcgacctgctc
ggccaggacgccggcaagctggtggtgctgttccgcgacgtggaagagaagggcggcttc
gacctgtcgggcacgccggaattcgaccgcatccgcgagttcggctttgtctcgggccgc
agcacgcacgacgaccgcgtagcgaccatccgcgacctgtcttcgcgctacggcatcacc
atcgatacccacaccgccgatggcgtcaaggtggcgcgcgagcatctcagcgccggcgtg
ccgatggtggtgctggaaaccgcgctgccggccaagtttgccgacactatccgcgaagcg
ctcggccacgagccggagcgccccgcaaagttcgagggcatcgagagcctgccgcagcgc
tttgaagtgatgccggccgacgccgcacaggtcaaggcctatatcgccggccacaccggc
ctgtaa

DBGET integrated database retrieval system