KEGG   Ralstonia eutropha H16: H16_A2375Help
Entry
H16_A2375         CDS       T00416                                 

Gene name
h16_A2375
Definition
protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
reh  Ralstonia eutropha H16
Brite
Enzymes [BR:reh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     H16_A2375 (h16_A2375)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2579583..2580503)
Genome map
AA seq 306 aa AA seqDB search
MSTTPPRNKFPLPLDAVVERKPAPARTAGLPAVGTPRPAAPTPAPAKPAKPRLPRTAAPA
PAPVPASAVEQRASAATAGGGGMASARARAALAARLRAAGIRDERVLSAIATVPRHLFVE
PGLASQAYEDAALPIGHQQTISKPSVVARMIELLREGLAADAPLERVLEIGTGCGYQAAV
LSQVAREVFSIERIRPLHEQAKANLRPLRVPNLRLHYGDGMLGLPQAAPFSAIILAAAGM
EVPEALLEQLAIGGRLIAPVAVMPPAGVPGQTVTQQLLLIERRNRHRFHRTALEAVFFVP
LKSGTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacgccccctcgcaacaagtttccgctgccgctcgatgcggtagtcgagcgc
aagcccgcaccggcccgcaccgccggcttgcctgccgtgggcacgccgcggccggccgcg
cccacaccggcgccagccaagccggccaagccgcgcctgccgcgcaccgccgcaccggcg
cccgcgccggtgcctgcaagcgcggtcgagcaacgcgcctcggcggccaccgcgggcggc
ggcggcatggcctcggcacgcgcgcgcgcggcgctggcggcgcggctgcgtgccgcgggc
atccgcgacgagcgcgtgctgtcggccattgccaccgtgccgcgccacctgttcgtcgag
ccgggactggcatcgcaggcgtatgaggacgccgcgctgccgatcggccaccagcagacc
atttccaagccgtcggtggtggcgcgcatgatcgagctgctgcgtgagggcctggccgcc
gacgcgccgctggagcgcgtgctcgagatcggcaccggctgcggctaccaggccgcggtg
ctgagccaggtcgcgcgcgaggtcttctcgatcgagcgcatccgcccgctgcacgagcag
gccaaggccaacctgcggccgctgcgcgtgcccaacctgcgcctgcactacggcgacggc
atgctggggctgccccaggcggcgccgttttcggccatcatcctggccgcggccggcatg
gaggtgcccgaggcgctgctggagcagctggccatcggtgggcgcctgatcgccccggtg
gcggtgatgccgccggcgggcgtgccaggccagaccgtcacgcagcagctgttgctgatc
gagcggcgcaaccgccatcgatttcacagaaccgcgcttgaagccgttttctttgtgccc
ttaaaatcgggcaccatctga

DBGET integrated database retrieval system