KEGG   Ralstonia eutropha H16: H16_A2388Help
Entry
H16_A2388         CDS       T00416                                 

Gene name
cR
Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
reh  Ralstonia eutropha H16
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:reh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2593497..2594453)
Genome map
AA seq 318 aa AA seqDB search
MMKGQLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSL
LAEGEDKDLLEDLVAAAFNDAVRKAEATSQEKMGSMTSGLPLPPGFKLRVLNATVKASSP
TSLQALVEALRVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQRCNTFT
EQEICETCLDDRRDASVLCVVETPADQVMIEQTLTYRGKYFVLMGRLSPLDGIGPREIHL
DRLLARATEPELGGPVGEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGVPVGGEL
EYVDAGTIARAVMDRRNL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggtcaactcgccgggctgatgaagcaagcccagcagatgcaggaaaacatg
aagaagatgcaggagcagctggcccagatcgaggtcgagggccagtccggcgccggtctc
gtcaaggtggtcatgacctgcaagaacgacgtcaagcgcgtcaccatcgaccccagcctg
ctggccgagggcgaagacaaggacctgctggaagacctggtcgccgccgccttcaatgac
gccgtgcgcaaggccgaagccacctcgcaggaaaagatgggctcgatgacctcgggcctg
ccgctgcccccgggcttcaagctgcgcgttctgaacgccactgtgaaggcatcgtccccg
acctcgctgcaagcactggtcgaagcgctgcgggtgctgcccggcgtcgggcccaagtcc
gcccagcgcatggcctaccacctgctgcagcacgaccgcgagggcgcgcgcaagctgggc
gatgcgctgcgcggcgcggcggaccatatccgccattgccagcgctgcaataccttcacc
gagcaggagatctgcgagacctgcctggacgaccgccgcgacgcctcggtgctgtgcgtg
gtggaaaccccggccgaccaggtcatgatcgagcagaccctgacctaccgcggcaagtac
ttcgtgctgatgggccggctctcgccgctggacggcatcggcccgcgcgagatccatctt
gaccggctgctcgcgcgcgccaccgagcccgagctgggcggcccggtcggcgaagtcatc
gtcgccaccaacttcaccagcgaaggcgaggccaccgcgcactacatcggcgaaatgctc
aaggcgcgcggcctcaaggtgtcgcgcctggcgcgcggcgtgccggtgggcggcgagctg
gagtacgtcgatgccggcaccatcgcgcgtgcggtgatggaccgccgcaacctctga

DBGET integrated database retrieval system