KEGG   Cupriavidus necator H16: H16_A2388Help
Entry
H16_A2388         CDS       T00416                                 

Gene name
cR
Definition
recombinational DNA repair protein (RecF pathway)
Orthology
K06187  
recombination protein RecR
Organism
reh  Cupriavidus necator H16
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:reh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    H16_A2388 (cR)
DNA repair and recombination proteins [BR:reh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      H16_A2388 (cR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2593497..2594453)
Genome map
AA seq 318 aa AA seqDB search
MMKGQLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSL
LAEGEDKDLLEDLVAAAFNDAVRKAEATSQEKMGSMTSGLPLPPGFKLRVLNATVKASSP
TSLQALVEALRVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQRCNTFT
EQEICETCLDDRRDASVLCVVETPADQVMIEQTLTYRGKYFVLMGRLSPLDGIGPREIHL
DRLLARATEPELGGPVGEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGVPVGGEL
EYVDAGTIARAVMDRRNL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggtcaactcgccgggctgatgaagcaagcccagcagatgcaggaaaacatg
aagaagatgcaggagcagctggcccagatcgaggtcgagggccagtccggcgccggtctc
gtcaaggtggtcatgacctgcaagaacgacgtcaagcgcgtcaccatcgaccccagcctg
ctggccgagggcgaagacaaggacctgctggaagacctggtcgccgccgccttcaatgac
gccgtgcgcaaggccgaagccacctcgcaggaaaagatgggctcgatgacctcgggcctg
ccgctgcccccgggcttcaagctgcgcgttctgaacgccactgtgaaggcatcgtccccg
acctcgctgcaagcactggtcgaagcgctgcgggtgctgcccggcgtcgggcccaagtcc
gcccagcgcatggcctaccacctgctgcagcacgaccgcgagggcgcgcgcaagctgggc
gatgcgctgcgcggcgcggcggaccatatccgccattgccagcgctgcaataccttcacc
gagcaggagatctgcgagacctgcctggacgaccgccgcgacgcctcggtgctgtgcgtg
gtggaaaccccggccgaccaggtcatgatcgagcagaccctgacctaccgcggcaagtac
ttcgtgctgatgggccggctctcgccgctggacggcatcggcccgcgcgagatccatctt
gaccggctgctcgcgcgcgccaccgagcccgagctgggcggcccggtcggcgaagtcatc
gtcgccaccaacttcaccagcgaaggcgaggccaccgcgcactacatcggcgaaatgctc
aaggcgcgcggcctcaaggtgtcgcgcctggcgcgcggcgtgccggtgggcggcgagctg
gagtacgtcgatgccggcaccatcgcgcgtgcggtgatggaccgccgcaacctctga

DBGET integrated database retrieval system