KEGG   Ralstonia eutropha H16: H16_A2388Help
Entry
H16_A2388         CDS       T00416                                 

Gene name
cR
Definition
(RefSeq) recombinational DNA repair protein (RecF pathway)
  KO
K06187  
recombination protein RecR
Organism
reh  Ralstonia eutropha H16
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:reh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    H16_A2388 (cR)
DNA repair and recombination proteins [BR:reh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      H16_A2388 (cR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2593497..2594453)
Genome map
AA seq 318 aa AA seqDB search
MMKGQLAGLMKQAQQMQENMKKMQEQLAQIEVEGQSGAGLVKVVMTCKNDVKRVTIDPSL
LAEGEDKDLLEDLVAAAFNDAVRKAEATSQEKMGSMTSGLPLPPGFKLRVLNATVKASSP
TSLQALVEALRVLPGVGPKSAQRMAYHLLQHDREGARKLGDALRGAADHIRHCQRCNTFT
EQEICETCLDDRRDASVLCVVETPADQVMIEQTLTYRGKYFVLMGRLSPLDGIGPREIHL
DRLLARATEPELGGPVGEVIVATNFTSEGEATAHYIGEMLKARGLKVSRLARGVPVGGEL
EYVDAGTIARAVMDRRNL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaggtcaactcgccgggctgatgaagcaagcccagcagatgcaggaaaacatg
aagaagatgcaggagcagctggcccagatcgaggtcgagggccagtccggcgccggtctc
gtcaaggtggtcatgacctgcaagaacgacgtcaagcgcgtcaccatcgaccccagcctg
ctggccgagggcgaagacaaggacctgctggaagacctggtcgccgccgccttcaatgac
gccgtgcgcaaggccgaagccacctcgcaggaaaagatgggctcgatgacctcgggcctg
ccgctgcccccgggcttcaagctgcgcgttctgaacgccactgtgaaggcatcgtccccg
acctcgctgcaagcactggtcgaagcgctgcgggtgctgcccggcgtcgggcccaagtcc
gcccagcgcatggcctaccacctgctgcagcacgaccgcgagggcgcgcgcaagctgggc
gatgcgctgcgcggcgcggcggaccatatccgccattgccagcgctgcaataccttcacc
gagcaggagatctgcgagacctgcctggacgaccgccgcgacgcctcggtgctgtgcgtg
gtggaaaccccggccgaccaggtcatgatcgagcagaccctgacctaccgcggcaagtac
ttcgtgctgatgggccggctctcgccgctggacggcatcggcccgcgcgagatccatctt
gaccggctgctcgcgcgcgccaccgagcccgagctgggcggcccggtcggcgaagtcatc
gtcgccaccaacttcaccagcgaaggcgaggccaccgcgcactacatcggcgaaatgctc
aaggcgcgcggcctcaaggtgtcgcgcctggcgcgcggcgtgccggtgggcggcgagctg
gagtacgtcgatgccggcaccatcgcgcgtgcggtgatggaccgccgcaacctctga

DBGET integrated database retrieval system