KEGG   Cupriavidus necator H16: H16_A2422Help
Entry
H16_A2422         CDS       T00416                                 

Gene name
pcaB2
Definition
3-carboxy-cis,cis-muconate cycloisomerase (EC:5.5.1.2)
Orthology
K01857  
3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]
Organism
reh  Cupriavidus necator H16
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H16_A2422 (pcaB2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H16_A2422 (pcaB2)
Enzymes [BR:reh01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.2  3-carboxy-cis,cis-muconate cycloisomerase
     H16_A2422 (pcaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2638033..2639379)
Genome map
AA seq 448 aa AA seqDB search
MASTIIDSRIFGDMFSDARMREVWSDENRTAKYLDIERALAKVQGELGIIPQEAADEIVK
NCELSQIDWVRLKAKTEQIGYPIIAVVNQINANCRDGLGEFCHWGATTQDITDTAAVLQM
REGLALIESDLDDIADALATLAKQYRDTPVIGRSNLQQATPITFGYKMASILAGIERHRE
RLQQLKPRVLMGEFGGASGTLSSLQTGAMETQAALMKELGLAQPLISWHTVRDTIAEVGA
FLGLVGGSLGKIAMDVKLMMQTEVAEVFEPFAPGRGSSSTMPQKRNPISCLYIHANISVA
RQHAAALMDAMVADHERSTGPWEIEWVSLPEIFCLISGALKQAKFVLQGLEVDAARMRAN
IDMTNGLVMSEAVMMGLGPYIGREYAHDLVYDLCREAIANNRPLIDILAAHPEVSSHVSR
AQLEAMCDPRNNLGQAGVMVDRVLASRR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccatcattgattcccgcatttttggcgacatgtttagcgacgcgcgcatg
cgcgaagtgtggtccgatgaaaaccgcacggctaaatacctggacatcgagcgagcattg
gcaaaagtgcaaggtgagcttggcatcatcccgcaggaagcggccgacgagatcgtcaag
aattgcgaactttcccaaattgactgggttaggctcaaggcaaagactgaacagatcgga
tatccgattatcgcggtggtcaaccagatcaacgcgaactgccgggatgggcttggcgaa
ttctgccattggggtgccaccacccaggacattaccgacacagcggcggtgttgcagatg
cgcgagggcctggcactgatcgagtcggatctcgacgacatcgctgacgcgcttgcgacg
ctggcgaagcagtaccgcgacacgccggtgatcggtcggtccaacctgcagcaagccacc
cctattacgttcggctacaagatggccagcatccttgctggcatcgagcgccaccgcgag
cggctacagcagttgaagccgcgagtgctaatgggtgagttcggcggcgcatccggtacg
ctttcctcgttgcagacgggagccatggaaacacaggctgcgttgatgaaggaacttggg
ctggcgcagccactgatctcctggcacacggtgcgcgatacgattgccgaagtgggcgcg
tttctcggactcgtcggcggctcgctcggcaagatcgccatggacgtgaagctcatgatg
cagaccgaagttgccgaggtgttcgaaccctttgcgccggggcgcggctcttcatcgacc
atgccgcagaagcgcaacccgatttcgtgcctgtacatccacgccaacatctcggttgca
cggcagcacgcggcggccctgatggatgcgatggtggctgatcacgagcgttcaacaggc
ccgtgggagatcgaatgggtatccctaccggagattttttgcctgatttccggtgccctg
aagcaggcgaagttcgtgttgcagggcttggaagtggacgcggctcgcatgcgcgcgaat
atcgacatgacaaacgggctagttatgtctgaggcggtgatgatgggcctgggtccatat
attgggcgcgagtatgcgcacgatctggtctatgacctttgccgcgaggccattgccaac
aaccgacccttgatcgacatcctcgcggcacatccggaagtaagcagccacgtgtcacgc
gcacaactcgaggccatgtgcgatccacgcaacaatcttggccaagccggcgtaatggtc
gacagggtactggctagccggcgctaa

DBGET integrated database retrieval system