KEGG   Ralstonia eutropha H16: H16_A2422Help
Entry
H16_A2422         CDS       T00416                                 

Gene name
pcaB2
Definition
3-carboxy-cis,cis-muconate cycloisomerase (EC:5.5.1.2)
Orthology
K01857  
3-carboxy-cis,cis-muconate cycloisomerase [EC:5.5.1.2]
Organism
reh  Ralstonia eutropha H16
Pathway
Benzoate degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:reh01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:reh00362]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2638033..2639379)
Genome map
AA seq 448 aa AA seqDB search
MASTIIDSRIFGDMFSDARMREVWSDENRTAKYLDIERALAKVQGELGIIPQEAADEIVK
NCELSQIDWVRLKAKTEQIGYPIIAVVNQINANCRDGLGEFCHWGATTQDITDTAAVLQM
REGLALIESDLDDIADALATLAKQYRDTPVIGRSNLQQATPITFGYKMASILAGIERHRE
RLQQLKPRVLMGEFGGASGTLSSLQTGAMETQAALMKELGLAQPLISWHTVRDTIAEVGA
FLGLVGGSLGKIAMDVKLMMQTEVAEVFEPFAPGRGSSSTMPQKRNPISCLYIHANISVA
RQHAAALMDAMVADHERSTGPWEIEWVSLPEIFCLISGALKQAKFVLQGLEVDAARMRAN
IDMTNGLVMSEAVMMGLGPYIGREYAHDLVYDLCREAIANNRPLIDILAAHPEVSSHVSR
AQLEAMCDPRNNLGQAGVMVDRVLASRR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccatcattgattcccgcatttttggcgacatgtttagcgacgcgcgcatg
cgcgaagtgtggtccgatgaaaaccgcacggctaaatacctggacatcgagcgagcattg
gcaaaagtgcaaggtgagcttggcatcatcccgcaggaagcggccgacgagatcgtcaag
aattgcgaactttcccaaattgactgggttaggctcaaggcaaagactgaacagatcgga
tatccgattatcgcggtggtcaaccagatcaacgcgaactgccgggatgggcttggcgaa
ttctgccattggggtgccaccacccaggacattaccgacacagcggcggtgttgcagatg
cgcgagggcctggcactgatcgagtcggatctcgacgacatcgctgacgcgcttgcgacg
ctggcgaagcagtaccgcgacacgccggtgatcggtcggtccaacctgcagcaagccacc
cctattacgttcggctacaagatggccagcatccttgctggcatcgagcgccaccgcgag
cggctacagcagttgaagccgcgagtgctaatgggtgagttcggcggcgcatccggtacg
ctttcctcgttgcagacgggagccatggaaacacaggctgcgttgatgaaggaacttggg
ctggcgcagccactgatctcctggcacacggtgcgcgatacgattgccgaagtgggcgcg
tttctcggactcgtcggcggctcgctcggcaagatcgccatggacgtgaagctcatgatg
cagaccgaagttgccgaggtgttcgaaccctttgcgccggggcgcggctcttcatcgacc
atgccgcagaagcgcaacccgatttcgtgcctgtacatccacgccaacatctcggttgca
cggcagcacgcggcggccctgatggatgcgatggtggctgatcacgagcgttcaacaggc
ccgtgggagatcgaatgggtatccctaccggagattttttgcctgatttccggtgccctg
aagcaggcgaagttcgtgttgcagggcttggaagtggacgcggctcgcatgcgcgcgaat
atcgacatgacaaacgggctagttatgtctgaggcggtgatgatgggcctgggtccatat
attgggcgcgagtatgcgcacgatctggtctatgacctttgccgcgaggccattgccaac
aaccgacccttgatcgacatcctcgcggcacatccggaagtaagcagccacgtgtcacgc
gcacaactcgaggccatgtgcgatccacgcaacaatcttggccaagccggcgtaatggtc
gacagggtactggctagccggcgctaa

DBGET integrated database retrieval system