KEGG   Ralstonia eutropha H16: H16_A2446Help
Entry
H16_A2446         CDS       T00416                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00790  Folate biosynthesis
reh01100  Metabolic pathways
Module
reh_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_A2446 (folP)
Enzymes [BR:reh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     H16_A2446 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF1685
Motif
Other DBs
NCBI-ProteinID: CAJ93535
UniProt: Q0K8Y6
Position
1:complement(2662218..2663147)
Genome map
AA seq 309 aa AA seqDB search
MHRLFLLRGICRARIESSIPTLQQTSQTRYFQCGRFRFALDQRPLVMGILNVTPDSFSDG
GQHASRDAALRHAGQMIAEGVDIIDIGGESSRPGSAALPLEDELARVIPVVEALRDCGKP
LSVDTYKPEVMRAALAAGADLINDIWGFRMPGAVEAVAAGQAGLCVMHMQRDPQTMQEDP
HYDDVVAEVAGFLAERIAVLRAAGIDDARISLDPGFGFGKTPDHNLRLLGQLPRLALEGL
PVLAGISRKSTLGAVLGGRPPQQRVAASIAAAVCALERGAFIVRVHDVEQTVDAVKTWWA
VRNESVGAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccggcttttccttttgcgcggcatctgccgcgcccggattgaatcaagcattcct
accttgcagcagacttctcagaccaggtatttccagtgcggccgttttcgctttgccctg
gaccagcgcccgctggtgatgggtatcctcaacgtcacgcccgattccttctcggatggc
ggccagcatgccagccgggacgcggcgctgcgccatgccgggcagatgatcgccgagggc
gttgacatcatcgacatcggcggggaatccagccggcccggttcggcggcgctgccgctg
gaagacgaactggcgcgcgtgatcccggtggtggaagcactgcgcgactgcggcaagccg
ctctcggtcgatacctacaagcccgaggtcatgcgcgccgcgcttgcggccggagccgat
ctcatcaacgatatctggggtttccgcatgccgggcgcggtcgaggccgtggcggcgggg
caggcgggcctgtgcgtgatgcatatgcagcgcgatccgcagaccatgcaggaagacccg
cactacgatgacgtggtcgccgaggtggccgggttccttgccgagcgcattgccgtgctg
cgcgctgccggcatcgacgatgcgcgcatctccctcgatccggggtttggcttcggcaag
acacccgatcataatctgcgcctgctcggccaactgccgcggctggcgcttgagggcctg
ccggtgctggctggcatctcgcgcaagtccacgctgggcgcggtccttggtggccggccg
ccgcagcagcgtgttgccgccagcattgccgccgcggtgtgtgcgctggagcgcggagca
tttatcgtgcgcgtgcatgatgtggagcagacggtggacgccgtgaagacctggtgggcg
gtgcgcaacgagtccgttggcgcggcctga

DBGET integrated database retrieval system