KEGG   Cupriavidus necator H16: H16_A2446Help
Entry
H16_A2446         CDS       T00416                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
reh  Cupriavidus necator H16
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H16_A2446 (folP)
Enzymes [BR:reh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     H16_A2446 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2662218..2663147)
Genome map
AA seq 309 aa AA seqDB search
MHRLFLLRGICRARIESSIPTLQQTSQTRYFQCGRFRFALDQRPLVMGILNVTPDSFSDG
GQHASRDAALRHAGQMIAEGVDIIDIGGESSRPGSAALPLEDELARVIPVVEALRDCGKP
LSVDTYKPEVMRAALAAGADLINDIWGFRMPGAVEAVAAGQAGLCVMHMQRDPQTMQEDP
HYDDVVAEVAGFLAERIAVLRAAGIDDARISLDPGFGFGKTPDHNLRLLGQLPRLALEGL
PVLAGISRKSTLGAVLGGRPPQQRVAASIAAAVCALERGAFIVRVHDVEQTVDAVKTWWA
VRNESVGAA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccggcttttccttttgcgcggcatctgccgcgcccggattgaatcaagcattcct
accttgcagcagacttctcagaccaggtatttccagtgcggccgttttcgctttgccctg
gaccagcgcccgctggtgatgggtatcctcaacgtcacgcccgattccttctcggatggc
ggccagcatgccagccgggacgcggcgctgcgccatgccgggcagatgatcgccgagggc
gttgacatcatcgacatcggcggggaatccagccggcccggttcggcggcgctgccgctg
gaagacgaactggcgcgcgtgatcccggtggtggaagcactgcgcgactgcggcaagccg
ctctcggtcgatacctacaagcccgaggtcatgcgcgccgcgcttgcggccggagccgat
ctcatcaacgatatctggggtttccgcatgccgggcgcggtcgaggccgtggcggcgggg
caggcgggcctgtgcgtgatgcatatgcagcgcgatccgcagaccatgcaggaagacccg
cactacgatgacgtggtcgccgaggtggccgggttccttgccgagcgcattgccgtgctg
cgcgctgccggcatcgacgatgcgcgcatctccctcgatccggggtttggcttcggcaag
acacccgatcataatctgcgcctgctcggccaactgccgcggctggcgcttgagggcctg
ccggtgctggctggcatctcgcgcaagtccacgctgggcgcggtccttggtggccggccg
ccgcagcagcgtgttgccgccagcattgccgccgcggtgtgtgcgctggagcgcggagca
tttatcgtgcgcgtgcatgatgtggagcagacggtggacgccgtgaagacctggtgggcg
gtgcgcaacgagtccgttggcgcggcctga

DBGET integrated database retrieval system