KEGG   Ralstonia eutropha H16: H16_A2507Help
Entry
H16_A2507         CDS       T00416                                 

Gene name
h16_A2507
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    H16_A2507 (h16_A2507)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     H16_A2507 (h16_A2507)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H16_A2507 (h16_A2507)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2721944..2723515
Genome map
AA seq 523 aa AA seqDB search
MNQPAAQAQRPASSQLPTEPQYVLALDQGTSSSRAILFDHAGNVVRLAQREFRQYYPHPG
HVEHDPYEIWQSQLAVAHAVLSDAGISAAQVRAIGITNQRETTVLWDRKTGEPVGRALVW
QDRRTAPMCEALQAAGHGELFRDKTGLIIDAYFSGTKLRWMLDNIEGARERAQRGELAFG
TVDSWLIWQLTDGARHVTDVSNASRTMLFNIHNFEWDDALLALLDIPHALLPEVVASSGE
VARTSARLFGMQIPIAGIAGDQQAATFGQACLSPGMAKNTYGTGCFLLMNTGSQPVTSHN
RLLTTIGWQIRGQTQYCLEGGVFMGGATIQWLRDGLKIINSAPEVEPLARQCDDTGGVVL
VPAFAGLGAPHWDPFARGTLVGMTRGTGRPQIARAALESIALQSVDVLEAMRKDAGISLA
ELRVDGGASRSDLLMQMQADLLGTPVVRPRVTETTALGAAYLAGLATGYWSDPAEIAQQW
QVERRFEPNLSADARGHRLARWHRAVDRARDWAREDEASGSHA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccagccgcgcaggcccagcgccctgcatcgtcccagcttcccaccgagccg
caatatgtgctggcgctcgaccagggcaccagcagctcgcgggccatcctgttcgaccat
gccggcaatgtggtgcggctcgcgcagcgcgagttccgccaatattacccacatcccggc
catgtcgagcacgacccctacgagatctggcaatcgcagctggcggtggcgcacgcggtg
ctgtccgatgccggcatctcggccgcgcaggtgcgcgccatcggcatcaccaaccagcgc
gagaccactgtgctgtgggaccgcaagaccggcgagccggtcgggcgcgcgctggtctgg
caggaccgccgcaccgcgcccatgtgcgaggcgctgcaggccgccggccacggcgagctg
ttccgcgacaagaccggcctgatcatcgatgcctacttctccggcaccaagctgcgctgg
atgctcgacaacatcgaaggcgcgcgcgaacgcgcccagcgcggcgagctggccttcggc
accgtcgacagctggctgatctggcagttgaccgacggcgcgcgccatgtcaccgatgtg
tcaaatgcctcgcgcaccatgctgttcaatatccacaacttcgagtgggacgatgcgctg
ctggcgctgctggacatcccgcacgcgctgctgcccgaggtggtggcgtccagcggcgag
gtggcgcgcacctcggcgcggctgttcggcatgcagatccccattgccggcatcgccggc
gaccagcaggccgccaccttcggccaggcctgcctgtcgccgggcatggccaagaacacc
tacggcaccggctgcttcctgctgatgaataccggctcgcagccggtcacgtcgcacaac
cggctgctgaccacgatcggctggcagatccgcggccagacgcaatattgcctggaaggc
ggcgtgttcatgggcggcgccaccatccagtggctgcgcgacggcctcaagatcatcaat
agcgctcccgaggtcgagccgctggcgcgccagtgcgacgacaccggcggcgtggtgctg
gtgcccgcctttgccggcctgggcgcgccgcactgggacccgtttgcacgcggcacgctg
gttggcatgacgcgcggcaccggccggccgcagatcgcgcgcgcggcgctggaatcgatc
gcgctgcagagcgtcgacgtgctggaagccatgcggaaggatgccggcatctcgctggcc
gaactgcgcgtggacggtggcgcctcgcgcagcgacctgctgatgcagatgcaggccgac
ctgctcggcaccccggtggtccgcccgcgcgtgaccgaaaccaccgcgctgggcgccgcc
tacctggcgggactggccaccggttactggagcgatccggcggagatcgcgcagcaatgg
caggtggagcggcgctttgagccgaacctgtcggctgacgcgcgcggccaccggctggcg
cgctggcatcgcgcagtcgaccgcgcgcgcgactgggcgcgcgaggacgaagccagcggc
agccacgcctga

DBGET integrated database retrieval system