KEGG   Ralstonia eutropha H16: H16_A2550Help
Entry
H16_A2550         CDS       T00416                                 

Gene name
h16_A2550
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
reh  Ralstonia eutropha H16
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:reh00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:reh00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2758799..2759848)
Genome map
AA seq 349 aa AA seqDB search
MSKKNSGKRPGPVVLDVVGKQLDAEDLRRIAHPLTGGVILFARNFESRAQLQALTRAIRA
VRDDVLICIDHEGGRVQRCKTDGFTHLPAMHCLGELWERDVLAATKAAVACGYVLAAELR
ACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCGKHFPGH
GYVEADSHVAIPVDERSLDEILEQDARPYEWLGLSLSSVMPAHVIYPKVDPNPAGFSRYW
LQDVLRAQLGFEGVIFSDDLSMEGASVVGNVTEAARAALTAGCDMVLICNHPERADQLLT
ELDVGIDKTSQRRIRKLFARRKPLDWNKLHQEGEYRAALRTLKEHDLIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagaactctggcaagcggccgggcccggtggtcctcgacgtcgtcggcaag
cagctcgacgcggaggacttgcgccgcatcgcgcatccgctgaccggcggcgtgatcctg
ttcgcgcgcaatttcgagtcgcgcgcgcaactgcaggcgctgacgcgcgccattcgcgcg
gtgcgagacgacgtgctgatctgcatcgaccatgagggcgggcgcgtgcagcgctgcaag
accgacggcttcacccacctgccggcgatgcactgcctgggcgagctgtgggagcgcgac
gtgctggccgcgaccaaggccgccgtggcctgcggctatgtgctggccgccgaactgcgc
gcctgcgacatcgacctgagcttcaccccggtgctggacctggactacggccgcagcgcc
gtgatcggcgaccgcgctttccacgccgatccgcgcgtggtgtcgatgctggccggccac
ctgaaccatggcctgctgctggccggcatgagcaactgcggcaagcacttccctggccac
ggctatgtcgaggccgattcgcacgtggcgatcccggtcgacgagcgctcgctggacgag
atcctggagcaggatgcgcgcccgtacgagtggctgggcctgtcgctgtcgtcggtgatg
ccggcgcacgtgatctaccccaaggtcgacccgaacccggccggcttctcgcgctactgg
ctgcaggacgtgctgcgcgcccagctgggcttcgagggcgtgatcttcagcgacgacctc
agcatggaaggcgccagcgtcgtcggcaatgtcaccgaggccgcgcgcgccgcgctgacc
gcgggctgtgacatggtgctgatctgcaaccacccggagcgcgccgaccagttgctgacc
gagctggacgtgggcatcgacaagacctcgcagcgccgcatccgcaagctgttcgcgcgc
aggaagccgctggactggaacaagctgcaccaggagggcgagtaccgcgccgcgctgcgc
acgctgaaagagcacgacctgatcgcctga

DBGET integrated database retrieval system