KEGG   Cupriavidus necator H16: H16_A2550Help
Entry
H16_A2550         CDS       T00416                                 

Gene name
h16_A2550
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
reh  Cupriavidus necator H16
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    H16_A2550 (h16_A2550)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    H16_A2550 (h16_A2550)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     H16_A2550 (h16_A2550)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2758799..2759848)
Genome map
AA seq 349 aa AA seqDB search
MSKKNSGKRPGPVVLDVVGKQLDAEDLRRIAHPLTGGVILFARNFESRAQLQALTRAIRA
VRDDVLICIDHEGGRVQRCKTDGFTHLPAMHCLGELWERDVLAATKAAVACGYVLAAELR
ACDIDLSFTPVLDLDYGRSAVIGDRAFHADPRVVSMLAGHLNHGLLLAGMSNCGKHFPGH
GYVEADSHVAIPVDERSLDEILEQDARPYEWLGLSLSSVMPAHVIYPKVDPNPAGFSRYW
LQDVLRAQLGFEGVIFSDDLSMEGASVVGNVTEAARAALTAGCDMVLICNHPERADQLLT
ELDVGIDKTSQRRIRKLFARRKPLDWNKLHQEGEYRAALRTLKEHDLIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagaagaactctggcaagcggccgggcccggtggtcctcgacgtcgtcggcaag
cagctcgacgcggaggacttgcgccgcatcgcgcatccgctgaccggcggcgtgatcctg
ttcgcgcgcaatttcgagtcgcgcgcgcaactgcaggcgctgacgcgcgccattcgcgcg
gtgcgagacgacgtgctgatctgcatcgaccatgagggcgggcgcgtgcagcgctgcaag
accgacggcttcacccacctgccggcgatgcactgcctgggcgagctgtgggagcgcgac
gtgctggccgcgaccaaggccgccgtggcctgcggctatgtgctggccgccgaactgcgc
gcctgcgacatcgacctgagcttcaccccggtgctggacctggactacggccgcagcgcc
gtgatcggcgaccgcgctttccacgccgatccgcgcgtggtgtcgatgctggccggccac
ctgaaccatggcctgctgctggccggcatgagcaactgcggcaagcacttccctggccac
ggctatgtcgaggccgattcgcacgtggcgatcccggtcgacgagcgctcgctggacgag
atcctggagcaggatgcgcgcccgtacgagtggctgggcctgtcgctgtcgtcggtgatg
ccggcgcacgtgatctaccccaaggtcgacccgaacccggccggcttctcgcgctactgg
ctgcaggacgtgctgcgcgcccagctgggcttcgagggcgtgatcttcagcgacgacctc
agcatggaaggcgccagcgtcgtcggcaatgtcaccgaggccgcgcgcgccgcgctgacc
gcgggctgtgacatggtgctgatctgcaaccacccggagcgcgccgaccagttgctgacc
gagctggacgtgggcatcgacaagacctcgcagcgccgcatccgcaagctgttcgcgcgc
aggaagccgctggactggaacaagctgcaccaggagggcgagtaccgcgccgcgctgcgc
acgctgaaagagcacgacctgatcgcctga

DBGET integrated database retrieval system