KEGG   Ralstonia eutropha H16: H16_A2612Help
Entry
H16_A2612         CDS       T00416                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00260  Glycine, serine and threonine metabolism
reh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01130  Biosynthesis of antibiotics
reh01230  Biosynthesis of amino acids
Module
reh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A2612 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H16_A2612 (trpA)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     H16_A2612 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: CAJ93694
UniProt: Q0K8H7
Position
1:complement(2819282..2820079)
Genome map
AA seq 265 aa AA seqDB search
MSRIQKTFAALAAQQKKGLIPFITAGDPEPGLTVALIHALVAGGADVIELGVPFSDPMAD
GPVIQRASERALAQGVSLTQVLQWVREFRQTNADTPVVLMGYANPIECMGEQVFAAAARE
AGVDGVLVVDYPPEECESFATLMRDNGMDPIFLLAPTSTDARIEAVARVASGYLYYVSLK
GVTGSAAIDLDSVAARLPLIKQHANLPVGVGFGIRDAPTARAIGSVADAVVIGSRLVQLL
EDTPREQAVATLQAFIAEIRQALDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatccagaagacgttcgcggcgctggccgcgcagcagaagaagggcctgatt
ccgtttatcaccgccggcgatcccgagcccggcctgaccgtggcgctgatacatgcgctg
gtggcgggcggcgctgacgtgatcgagctgggcgtgccgttctccgacccgatggccgac
ggcccggtgatccagcgcgcctccgagcgcgcgctggcgcagggcgtgtcgctgacccag
gtgctgcagtgggtgcgcgagttccgccagaccaatgccgataccccggtggtgctgatg
ggctacgccaatccgatcgagtgcatgggcgagcaggtctttgccgccgccgcgcgcgaa
gccggcgtcgacggcgtgctggtggtcgactatccgcccgaggagtgcgagtcgttcgcc
acgctgatgcgcgacaacggcatggacccgatcttcctgctggcgccgacttcgaccgat
gcccgcatcgaggccgtggcgcgcgtggccagcggctacctgtactacgtgtcgctcaag
ggcgtgaccggctcggccgcgatcgacctggacagcgtggcggcgcgcctgccgctgatc
aagcagcatgcaaacctgccggtgggcgtgggcttcggcatccgcgacgcgccgaccgcg
cgcgcgatcggcagcgtggccgatgccgtggtgatcggcagccgcctggtgcagctgctg
gaggacaccccgcgcgaacaggcggtggcgacgctgcaggcgtttatcgccgagatccgc
caggcgctggatagttga

DBGET integrated database retrieval system