KEGG   Ralstonia eutropha H16: H16_A2614Help
Entry
H16_A2614         CDS       T00416                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H16_A2614 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H16_A2614 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H16_A2614 (trpB)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     H16_A2614 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(2821007..2822200)
Genome map
AA seq 397 aa AA seqDB search
MYDLPDSRGHFGPYGGTFVSETLVHALDELREAYAHYQKDPEFDAEYRRELKHFVGRPSP
IYHAQRWSETLGGAQIYFKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGAEDVKRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVENTFYIIGTVAGPHPYPMMVRDFQCVIGEEAKVQMPEMTGRQPDAVIACVGGGSNA
MGIFYPYIEHQDVQLIGVEAAGDGLDTGRHAASLTGGTPGVLHGNRTYLLQDANGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
ACKLAPTLPKDKLLLVNLSGRGDKDMHTVAERAGLKL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacttgcccgattcccgtggccatttcggcccctatggcggcaccttcgtgtcc
gaaacgctggtccacgcgctcgatgagctgcgcgaggcctatgcgcactaccagaaggat
ccggagttcgatgccgaataccgccgcgaactgaagcactttgtcggccgcccgtcgccg
atctaccacgcgcagcgctggagcgagacgctcggtggcgcgcagatctacttcaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctg
gccaagcgcatgggcaagccgcgcgtgatcgccgagaccggggcagggcagcacggcgtg
gccaccgccaccattgccgcgcgcttcggcatggagtgcgtggtctacatgggggccgag
gacgtcaagcgccaggccgccaacgtctaccgcatgaagctgctgggcgccaccgtggtg
ccggtggaaagcggctcgcgcacgctcaaggacgcgctcaatgaagccatgcgcgactgg
gtcaccaacgtcgagaacaccttctacatcatcggcaccgtggccggcccgcatccgtac
ccgatgatggtgcgcgacttccagtgcgtgatcggcgaggaagccaaggtgcagatgccg
gagatgacgggccgccagccggatgccgtgatcgcctgcgtcggcggcggctccaatgcc
atgggcatcttctacccgtatatcgagcaccaggacgtgcagctgatcggtgtggaagcc
gccggcgacggcctcgacaccggccgccacgcggcctcgctgaccggcggcacgccgggc
gtgctgcacggcaaccgcacctacctgctgcaggacgccaacggccagatcatcgagacc
cattcggtgtcggccggcctggactacccgggcgtgggccccgagcatgcgtggctcaag
gacagcggtcgcgcgcagtacgtgccgatcacggatgaagaagcgctcaaggccttccac
gactgctgccgcatcgagggcatcatcccggcgctggaatcgagccacgccatcgcctat
gcctgcaagctggcgccgacgctgcccaaggacaagctgctgctggtgaacctgtccggc
cgcggcgacaaggacatgcacaccgtggccgagcgcgcggggctcaagctctga

DBGET integrated database retrieval system