KEGG   Ralstonia eutropha H16: H16_A2631Help
Entry
H16_A2631         CDS       T00416                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase (hydrophobic anchor subunit)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
reh  Ralstonia eutropha H16
Pathway
reh00020  Citrate cycle (TCA cycle)
reh00190  Oxidative phosphorylation
reh00650  Butanoate metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
Module
reh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
reh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
reh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H16_A2631 (sdhD)
   00650 Butanoate metabolism
    H16_A2631 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    H16_A2631 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C Fumarate_red_D CybS
Motif
Other DBs
NCBI-ProteinID: CAJ93713
UniProt: Q0K8F8
Position
1:complement(2841784..2842149)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVIMVVFTVVLAIAFLLSNGASYEAWAGLFSN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVRPMAVRLVLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacaataatatcggtcccaagcgtcttgtcgtcggtgcgcactacggcctgaaa
gactggctggcgcagcgcgtcacggccgtgatcatggtggtcttcaccgtggtcctggcc
attgccttcctgctgtcgaacggcgcttcgtatgaagcgtgggcagggctcttctccaac
cagtggatgaagatcatcacgttcctgaccatcctgtcgctgctgtatcacgcctggatc
ggcgtgcgcgacatctggatggactatgtgcgtccgatggcggttcgcctcgtgctgcaa
gttcttacgattctgtggctcgtcggttgcgcgggctacgctgctcagattctctggagg
gtgtaa

DBGET integrated database retrieval system