KEGG   Ralstonia eutropha H16: H16_A2752Help
Entry
H16_A2752         CDS       T00416                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
reh  Ralstonia eutropha H16
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    H16_A2752 (galU)
   00052 Galactose metabolism
    H16_A2752 (galU)
   00500 Starch and sucrose metabolism
    H16_A2752 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    H16_A2752 (galU)
Enzymes [BR:reh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     H16_A2752 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2978370..2979260
Genome map
AA seq 296 aa AA seqDB search
MENRVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITEMIFVTGR
SKRAIEDHFDKAFELEVELEAKNKQALLDVVRSIKPANVECFYVRQPEALGLGHAVLCAA
KLVGDTPFAVMLADDLIDGNPPVMKQMVDTFNHYNCSVLGVEEITPEQSRSYGVIDGREW
DADVIKVSGIIEKPAPEDAPSNLGVVGRYILTPRIFEHLRDLKPGAGGELQLTDAIQSLL
GQEQVLAYRYQGRRYDCGSKLGYLKATVEFALKHPEVGTEFSAYLESREHLTGIGS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcgcgtcaccaaggctgtgttcccggttgcgggcctgggcactcgcttcctg
ccggccaccaaggccagccccaaggaaatgcttccggtggtggacaagccgctgatccag
tacgccgtggaagaagccatggccgccggcattaccgagatgatctttgtcaccggccgc
tccaagcgcgccatcgaggaccatttcgacaaggccttcgagctggaagtggagcttgag
gccaagaacaagcaggcgctgctggacgtggtgcgctcgatcaagcccgccaacgtggaa
tgcttctacgtgcgccagcccgaagcgctgggcctggggcatgcggtgctgtgcgcggcc
aagctggtcggcgacacgccgttcgcagtgatgctggccgatgacctgatcgacggcaac
ccgccggtgatgaagcagatggtggataccttcaaccactacaactgctcggtgctgggg
gtcgaggagatcacgccggagcaaagccgctcctacggcgtgatcgacggccgcgaatgg
gatgcggacgtgatcaaggtctccggcatcatcgagaagccggcgccggaagacgcgccg
tccaacctgggcgtggtcggccgctacatcctgaccccgcgcatcttcgaacacctgcgt
gacctgaagccgggcgccggcggcgagctgcagctgaccgacgcgatccagtcgctgctg
ggccaggagcaggtgctggcctaccgctaccagggccgccgctatgactgcggcagcaag
ctgggctacctgaaggcaaccgttgaatttgccttgaagcacccggaagtcgggactgaa
ttcagcgcctacctggaatcgcgcgagcacctgaccggcatcggcagctga

DBGET integrated database retrieval system