KEGG   Ralstonia eutropha H16: H16_A2877Help
Entry
H16_A2877         CDS       T00416                                 

Gene name
pcm
Definition
protein-L-isoaspartate carboxylmethyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
reh  Ralstonia eutropha H16
Brite
Enzymes [BR:reh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     H16_A2877 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3103846..3104499
Genome map
AA seq 217 aa AA seqDB search
MDLEKARFNMIEQQIRPWDVLDQEILDLLAVVKREQFVPAAYASLAFVDMEIPLPAGQNM
LAPRVEARILQDLAVRKHENVLEIGAGSGYMAALLANRARHVLTVDIVPELVELARTNLA
NAGVTNVDVAEGNAADGWSAAAPYDVICISGSLPAIPQSILSQVKVGGRIAAFIGELPVM
EARLVTRVSETEYQVVNLFETAVKPLQGAARPSQFQF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgaaaaagcccgattcaacatgatcgaacagcaaatccgcccgtgggacgtg
ctggaccaggaaatcctggacctgctggcggtagtcaagcgggagcagttcgtcccggcc
gcgtacgcctcgctggcgttcgtcgacatggagattccgctgcccgccgggcagaacatg
ctggcgccgcgcgtggaagcccgcatcctgcaggacctggccgtgcgcaagcatgagaac
gtgctggaaatcggcgccggctccggctacatggccgccctgctggccaaccgcgcgcgc
cacgtgctgaccgtggacatcgtgcccgagctggtcgagctggcccgcaccaacctggcc
aacgcgggcgtcaccaacgtcgacgtggccgaaggcaacgccgccgacggctggagcgcc
gccgcgccctacgacgtgatctgcatctcgggctcgctgccggcgattccgcagtcgatc
ctgtcgcaggtcaaggtgggcggccgcatcgccgccttcatcggcgaactgccggtaatg
gaagcgcgcctggtcacacgcgtgtccgagaccgaataccaggtcgtcaacctgttcgaa
accgcggtcaagcccctgcagggcgcggcccggccgtcgcaattccagttctga

DBGET integrated database retrieval system