KEGG   Ralstonia eutropha H16: H16_A2885Help
Entry
H16_A2885         CDS       T00416                                 

Gene name
manB2
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A2885 (manB2)
   00030 Pentose phosphate pathway
    H16_A2885 (manB2)
   00051 Fructose and mannose metabolism
    H16_A2885 (manB2)
   00052 Galactose metabolism
    H16_A2885 (manB2)
   00500 Starch and sucrose metabolism
    H16_A2885 (manB2)
   00520 Amino sugar and nucleotide sugar metabolism
    H16_A2885 (manB2)
  Nucleotide metabolism
   00230 Purine metabolism
    H16_A2885 (manB2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    H16_A2885 (manB2)
Enzymes [BR:reh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     H16_A2885 (manB2)
    5.4.2.8  phosphomannomutase
     H16_A2885 (manB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3112440..3113825)
Genome map
AA seq 461 aa AA seqDB search
MAIDPTMFKAYDIRGIVGKTLTREVARDIGWSFGTAAAAEGEKTVVVGRDGRLSGPDLIS
GLVEGLRAAGLDVIDIGLVATPMVYFATNIEIDGVRPTSGIMVTGSHNPPDYNGFKMVLA
GKAIYGEQIQALRQRIEAGQFSSGAGTYKQVDVRQKYLDRIISDVKLARPMKVALDAGNG
VAGAFVGDLFRGLGCEVTELFCDVDGNFPNHHPDPAHIENLQDLMKALRETDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILSRNPGAQVIYDVKCTGKLAPWIREHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHADPSAV
LNALPNANNTPELQLKCAEGEPFTLLDQIKANAKFEGAREVITIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAQLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaccccaccatgttcaaggcttatgacatccgcggaatcgtaggcaagacc
ctgacgcgcgaagtggctcgggatataggctggtcctttggcacggccgccgccgccgag
ggcgaaaaaaccgtcgtagtcggccgcgacggccgcctctccggccccgacctaatctcc
ggcctggtagaaggcctgcgcgccgccggcctggacgtgatcgacatcggcctggtcgcc
accccgatggtctacttcgccaccaacatcgagatcgacggcgtccgcccgacctccggc
atcatggtcaccggcagccacaacccgccggactacaacggtttcaagatggtgctggcc
ggcaaggcgatctatggcgagcagatccaggcgctgcgccagcggatcgaagccggccag
ttcagcagcggtgccggcacctacaagcaagtcgatgtgcgccaaaagtacctcgaccgc
atcatcagcgacgtcaagctggcccgtccgatgaaggttgccctggatgccggcaacggc
gtggccggtgccttcgtgggtgacctgttccgtggcctgggctgtgaggtgactgaactg
ttctgcgacgtggacggcaacttcccgaaccatcaccctgatcccgcacatatcgagaat
ctgcaggatctgatgaaggccctgcgcgagacggactgcgagcttggcctggccttcgac
ggtgacggcgaccgccttggcgtggtgaccaaggacggtcaggtgattttcccggacagg
caactgatgctgttcgctgaagagatcctgtcgcgcaacccgggcgcccaggttatttac
gacgtgaaatgcaccggcaaactggccccctggatccgcgagcacggcggtgagccgctg
atgtggaagaccggccattcgctggtcaaggccaagctgaaggaaacgggcgcgccgatc
gcgggcgagatgagcggccacgtgttcttcaaggaccgctggtatggctttgacgatggc
ctgtacaccggggcgcgcctgttggagatcctgtcgcgccacgcggatccgagcgcggtg
ctgaacgcgctgccgaatgccaacaacacgccggaactgcagctcaagtgtgccgagggt
gagccgttcacgctgctggaccagatcaaggcgaacgcgaagttcgaaggggcgcgtgag
gtgatcaccatcgatggcgtgcgcgtggagtatgccgatggcttcggcctggcacgcccg
tccaacaccaccccggtggtggtgatgcgtttcgaggcggataacgacgccgcgctggcg
cgtatccaggcggagttcaagcgcgtgatcctggcagagaagccggatgctcagctcccg
ttctga

DBGET integrated database retrieval system