KEGG   Ralstonia eutropha H16: H16_A2885Help
Entry
H16_A2885         CDS       T00416                                 

Gene name
manB2
Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00030  Pentose phosphate pathway
reh00051  Fructose and mannose metabolism
reh00052  Galactose metabolism
reh00230  Purine metabolism
reh00500  Starch and sucrose metabolism
reh00520  Amino sugar and nucleotide sugar metabolism
reh00521  Streptomycin biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A2885 (manB2)
   00030 Pentose phosphate pathway
    H16_A2885 (manB2)
   00051 Fructose and mannose metabolism
    H16_A2885 (manB2)
   00052 Galactose metabolism
    H16_A2885 (manB2)
   00500 Starch and sucrose metabolism
    H16_A2885 (manB2)
   00520 Amino sugar and nucleotide sugar metabolism
    H16_A2885 (manB2)
  Nucleotide metabolism
   00230 Purine metabolism
    H16_A2885 (manB2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    H16_A2885 (manB2)
Enzymes [BR:reh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     H16_A2885 (manB2)
    5.4.2.8  phosphomannomutase
     H16_A2885 (manB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAJ93961
UniProt: Q0K7R0
Position
1:complement(3112440..3113825)
Genome map
AA seq 461 aa AA seqDB search
MAIDPTMFKAYDIRGIVGKTLTREVARDIGWSFGTAAAAEGEKTVVVGRDGRLSGPDLIS
GLVEGLRAAGLDVIDIGLVATPMVYFATNIEIDGVRPTSGIMVTGSHNPPDYNGFKMVLA
GKAIYGEQIQALRQRIEAGQFSSGAGTYKQVDVRQKYLDRIISDVKLARPMKVALDAGNG
VAGAFVGDLFRGLGCEVTELFCDVDGNFPNHHPDPAHIENLQDLMKALRETDCELGLAFD
GDGDRLGVVTKDGQVIFPDRQLMLFAEEILSRNPGAQVIYDVKCTGKLAPWIREHGGEPL
MWKTGHSLVKAKLKETGAPIAGEMSGHVFFKDRWYGFDDGLYTGARLLEILSRHADPSAV
LNALPNANNTPELQLKCAEGEPFTLLDQIKANAKFEGAREVITIDGVRVEYADGFGLARP
SNTTPVVVMRFEADNDAALARIQAEFKRVILAEKPDAQLPF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgaccccaccatgttcaaggcttatgacatccgcggaatcgtaggcaagacc
ctgacgcgcgaagtggctcgggatataggctggtcctttggcacggccgccgccgccgag
ggcgaaaaaaccgtcgtagtcggccgcgacggccgcctctccggccccgacctaatctcc
ggcctggtagaaggcctgcgcgccgccggcctggacgtgatcgacatcggcctggtcgcc
accccgatggtctacttcgccaccaacatcgagatcgacggcgtccgcccgacctccggc
atcatggtcaccggcagccacaacccgccggactacaacggtttcaagatggtgctggcc
ggcaaggcgatctatggcgagcagatccaggcgctgcgccagcggatcgaagccggccag
ttcagcagcggtgccggcacctacaagcaagtcgatgtgcgccaaaagtacctcgaccgc
atcatcagcgacgtcaagctggcccgtccgatgaaggttgccctggatgccggcaacggc
gtggccggtgccttcgtgggtgacctgttccgtggcctgggctgtgaggtgactgaactg
ttctgcgacgtggacggcaacttcccgaaccatcaccctgatcccgcacatatcgagaat
ctgcaggatctgatgaaggccctgcgcgagacggactgcgagcttggcctggccttcgac
ggtgacggcgaccgccttggcgtggtgaccaaggacggtcaggtgattttcccggacagg
caactgatgctgttcgctgaagagatcctgtcgcgcaacccgggcgcccaggttatttac
gacgtgaaatgcaccggcaaactggccccctggatccgcgagcacggcggtgagccgctg
atgtggaagaccggccattcgctggtcaaggccaagctgaaggaaacgggcgcgccgatc
gcgggcgagatgagcggccacgtgttcttcaaggaccgctggtatggctttgacgatggc
ctgtacaccggggcgcgcctgttggagatcctgtcgcgccacgcggatccgagcgcggtg
ctgaacgcgctgccgaatgccaacaacacgccggaactgcagctcaagtgtgccgagggt
gagccgttcacgctgctggaccagatcaaggcgaacgcgaagttcgaaggggcgcgtgag
gtgatcaccatcgatggcgtgcgcgtggagtatgccgatggcttcggcctggcacgcccg
tccaacaccaccccggtggtggtgatgcgtttcgaggcggataacgacgccgcgctggcg
cgtatccaggcggagttcaagcgcgtgatcctggcagagaagccggatgctcagctcccg
ttctga

DBGET integrated database retrieval system