KEGG   Ralstonia eutropha H16: H16_A2919Help
Entry
H16_A2919         CDS       T00416                                 

Gene name
hemXD
Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
reh  Ralstonia eutropha H16
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:reh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3151302..3153425)
Genome map
AA seq 707 aa AA seqDB search
MPSPTVVVTRPAGQSRQLTEALQAAGLDVLSFPLLGIGPAVDDAPLRAALARLNTFALVV
FVSPNAIAYALDALAGVQGVAVAQWPAQVPVAVVGPASVAALAERGIAPPACRVIAPAGA
AANGQGPDDAAPEAEALRFDSEALWAQLDPAALAGKPVLIIRGNGGRDWLGDRLREAGAQ
VEAVEAYQRTLPEPSAMQWQAVRDNLRPGAAPHAWLLTSSEAVRNLDALARQHLSPEEDA
ALRQVQCIAPHARIAEQALALGFPHILRAAPGDAGLLAACLQWADAHAGPAPASMASASI
EAGPPSATAEAPPAPVPDAAVPATSTKVERVTQETTSSSATPPPTAASAASAQAASAPGP
ATPAAPSAASRRSAALWALVVVLVVATAGGFWWLQQRVDHLTGELARRQQSNDALVQESR
VLTRNAQDTVKELQAKVGALENQVGETRDKQVALEQVYQDLMRNRDDWEIAEIQQLLTSA
GQQLQLTGNVQVALAALQSADARLARADKPQYNLLRRAIARDVARMKAVPDTDLTGAAIK
LDEAINQVDSLPLLSSERMLERSEADARKGAAANGASAPAAAANGAGPGWFTRLWDYLRE
ELAQVVRIRKVDDAEALLLSGDQGWFLRENVKLRLLNARLALLSRNEPVFRNDLAAAQAM
ISRYFDTKSRRVQGVLTLLRQAQAGAVTVQLPTMSESLGALHALKKE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcccgaccgtcgttgtcacacgacccgccgggcagtcccggcaactgaccgag
gcgctgcaggccgcgggcctggacgtactcagctttcccttgctgggcatcggcccggcc
gttgacgacgcgccgctgcgcgcggcgctggcgcggctgaacacctttgcgctggtggtc
tttgtcagtcccaatgccattgcctacgcgctcgacgcactggccggcgtgcagggcgtg
gccgtggcccaatggccggcgcaggtgccggtggcggtggtcgggccggccagcgtcgcg
gccctggccgagcgcggcatcgcgccgcccgcgtgccgggtgatcgcgcccgcgggcgct
gccgcaaacgggcagggccccgatgacgccgcaccggaggccgaagcgctgcgcttcgac
tccgaggccctgtgggcccagctcgatcccgccgcgctggcgggcaagccggtcctgatc
atccgcggcaacggcgggcgcgactggctgggcgaccgcctgcgcgaggccggcgcccag
gtcgaggccgtcgaggcctaccagcgcacgctgcccgaacccagcgccatgcagtggcag
gccgtgcgcgacaacctgcgtcccggcgcggcgccgcatgcgtggctcctaaccagttct
gaagcggtgcgcaaccttgacgcgctggcacgccagcatctgtcgcctgaggaagacgct
gccctgcggcaggtgcagtgcatcgcgccgcatgcgagaatcgccgaacaggcgctggcg
ctgggcttcccccatatcctgcgcgccgccccgggcgatgccggcctgctggcggcgtgc
ctgcagtgggccgatgcccatgccggtcccgcgccggcaagcatggccagcgcgtcaatc
gaagccggcccgcccagcgccacagccgaagcgccgccggcccccgtgccggacgcagca
gttcccgcaacgtcaacgaaggtcgaacgcgtgacgcaagaaaccacgtcctcctccgct
acgccgccgcccacggcggcctccgcagcatcggcgcaagcagcgtccgcgccgggcccg
gctacccccgctgctcccagtgcagcctcacggcggtccgctgcgttgtgggcgctcgtc
gtcgtgctggtggtggcgacggctggcggcttctggtggctgcagcagcgcgttgaccac
ctgaccggcgagctggcgcgccgccagcaaagcaacgatgcgctggtgcaggagtcgcgc
gtgctgacccgcaacgcgcaggacacggtcaaggaactgcaggccaaggtcggcgcactg
gagaaccaggtcggagagacccgcgacaagcaggtggcgctggaacaggtctaccaggac
ctgatgcgcaaccgcgacgactgggaaatcgccgagatccagcagttgctgaccagtgcc
ggccagcaactgcagctgaccggcaacgtgcaggtggcgctggccgcgctgcaaagcgcc
gacgcgcgcctggcgcgcgccgacaagccgcaatacaacctgctgcgccgcgcgatcgcg
cgcgacgtcgcgcgcatgaaggcggtgcccgacaccgacctgaccggtgctgcaattaaa
ctggacgaggccatcaaccaggtcgactcactgccgctgctgtccagcgaacgcatgctg
gagcgcagcgaggccgacgcccgcaagggtgccgcggccaacggtgccagcgcgccggcc
gccgccgccaacggcgcgggcccgggctggttcacgcgcctgtgggattacctgcgcgaa
gaactggcgcaggtggtccgcatccgcaaggtcgacgacgccgaggcgctgctgctgtct
ggcgaccagggctggttcctgcgcgagaacgtcaagctgcgcctgctcaacgcgcgcctg
gcattgctgtcgcgcaacgaacccgtgttccgcaacgacctggccgccgcgcaagcgatg
atcagccgctatttcgataccaagtcgcgccgggtgcagggggtgctgacgctgctgcgg
caggcgcaggccggcgcggtcacggtgcagctgcccaccatgtccgaaagcctgggcgcg
ctgcatgccctgaagaaggagtaa

DBGET integrated database retrieval system