KEGG   Ralstonia eutropha H16: H16_A2981Help
Entry
H16_A2981         CDS       T00416                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
reh  Ralstonia eutropha H16
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:reh00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:reh00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3225600..3227057)
Genome map
AA seq 485 aa AA seqDB search
MNSFDTGDQKISAPLGESEPAGSKFLSRLGRWWGRKGEGDTKAPATPVDGEAPLAARAVR
RQREQLRLCFDARLTDGAANAAAQAWQAEYEAAGEATRRGMLAVLAEVASSGGKGSEEAG
ADGDKGARAARAQAASSGLAQALSNARIRFFKRLAALHGQRGNSACGLHFLIQLRADMLR
WQRRMPGLRPLDDDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEIASWTDL
RNRLDSDRRCFAFFHPRIPREPLIFVEVAFAPEMAANVHTLLDEAAPLEDLRRVKWAIFY
SISNTQAGLRGVSFGNFLLKRVIEEVQREFPKVNQFATLSPIPGFADWLRKQDGDAVARV
LGDKRLARWSERHGKAPADGAGWLEALVPDAADTVIRDTAMTLAAHFLVRERNQSMPADP
VARFHLGNGACVERLNWGADLSRKGRSQSCGMMVNYLYVPEALDDNLARLGAGNPRISRS
VGKLL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattccttcgacacgggtgaccagaagatcagtgcgccgctgggcgaaagcgagccg
gcaggttccaagttcctgtcgcggctgggccgctggtggggacgcaagggcgagggcgac
accaaggccccggcaacgccggtcgatggcgaggcgccgctggcggcgcgcgcggtgcgc
cgccagcgcgagcagctgcggctttgcttcgacgcgcgcctgaccgatggcgccgccaat
gccgccgcgcaggcatggcaggccgagtatgaggctgctggcgaggccacccggcgcggc
atgctggcggtgctggccgaagtcgccagcagcggcggcaagggcagcgaagaggccggg
gccgacggcgacaagggcgcgcgcgccgcccgcgcgcaggccgcgtcttcgggcctggcc
caggccctgtccaatgcgcgcatccgcttcttcaagcggctggccgcgctgcacggccag
cgcggcaacagcgcctgcggcctgcacttcctgatccagctgcgcgccgacatgctgcgc
tggcagcgccgcatgccagggctgcgcccgcttgacgacgatctcgaggcgctgttctcc
aactggttcgacgtgggcctgctggagctgcagccgatcacctgggattcgccggcatcg
ctgctggaaaagctgatccgctacgaggccgtgcatgaaatcgcctcatggaccgacctg
cgcaaccgcctcgattccgaccgccgctgctttgcgttcttccacccgcgcatcccgcgc
gagccgctgatctttgtcgaggtggcattcgcgccggagatggcggccaatgtccataca
ttgctggatgaagccgcgccgctggaagacctgcgccgcgtcaagtgggccatcttctat
tcgatcagcaatacgcaggcgggcctgcgcggcgtgagcttcggcaactttctgctcaag
cgcgtgatcgaggaggtccagcgtgaattcccaaaagtgaatcagttcgccacgctctca
ccaatccccggatttgccgactggctgcgcaagcaggacggcgatgccgttgcgcgcgtg
ctgggcgacaagcgcctggcgcgctggagcgagcgccacggcaaggcgccagcggacggc
gccgggtggctggaggcgctggtgccggacgccgccgataccgtgatccgcgataccgcg
atgaccctggccgcgcatttcctggtgcgcgagcgcaaccagtcgatgcccgccgacccg
gtcgcgcgcttccacctgggcaacggggcatgcgtggagcggctgaactggggcgccgac
ctgtcgcgcaaaggccgcagccagagctgcgggatgatggtcaattatctttacgtgccc
gaggcgctggatgacaatctggcacgcttgggcgccggcaacccgcgcatcagccgtagc
gtcgggaagctgctgtga

DBGET integrated database retrieval system