KEGG   Cupriavidus necator H16: H16_A2981Help
Entry
H16_A2981         CDS       T00416                                 

Gene name
mcd
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
reh  Cupriavidus necator H16
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    H16_A2981 (mcd)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H16_A2981 (mcd)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     H16_A2981 (mcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3225600..3227057)
Genome map
AA seq 485 aa AA seqDB search
MNSFDTGDQKISAPLGESEPAGSKFLSRLGRWWGRKGEGDTKAPATPVDGEAPLAARAVR
RQREQLRLCFDARLTDGAANAAAQAWQAEYEAAGEATRRGMLAVLAEVASSGGKGSEEAG
ADGDKGARAARAQAASSGLAQALSNARIRFFKRLAALHGQRGNSACGLHFLIQLRADMLR
WQRRMPGLRPLDDDLEALFSNWFDVGLLELQPITWDSPASLLEKLIRYEAVHEIASWTDL
RNRLDSDRRCFAFFHPRIPREPLIFVEVAFAPEMAANVHTLLDEAAPLEDLRRVKWAIFY
SISNTQAGLRGVSFGNFLLKRVIEEVQREFPKVNQFATLSPIPGFADWLRKQDGDAVARV
LGDKRLARWSERHGKAPADGAGWLEALVPDAADTVIRDTAMTLAAHFLVRERNQSMPADP
VARFHLGNGACVERLNWGADLSRKGRSQSCGMMVNYLYVPEALDDNLARLGAGNPRISRS
VGKLL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaattccttcgacacgggtgaccagaagatcagtgcgccgctgggcgaaagcgagccg
gcaggttccaagttcctgtcgcggctgggccgctggtggggacgcaagggcgagggcgac
accaaggccccggcaacgccggtcgatggcgaggcgccgctggcggcgcgcgcggtgcgc
cgccagcgcgagcagctgcggctttgcttcgacgcgcgcctgaccgatggcgccgccaat
gccgccgcgcaggcatggcaggccgagtatgaggctgctggcgaggccacccggcgcggc
atgctggcggtgctggccgaagtcgccagcagcggcggcaagggcagcgaagaggccggg
gccgacggcgacaagggcgcgcgcgccgcccgcgcgcaggccgcgtcttcgggcctggcc
caggccctgtccaatgcgcgcatccgcttcttcaagcggctggccgcgctgcacggccag
cgcggcaacagcgcctgcggcctgcacttcctgatccagctgcgcgccgacatgctgcgc
tggcagcgccgcatgccagggctgcgcccgcttgacgacgatctcgaggcgctgttctcc
aactggttcgacgtgggcctgctggagctgcagccgatcacctgggattcgccggcatcg
ctgctggaaaagctgatccgctacgaggccgtgcatgaaatcgcctcatggaccgacctg
cgcaaccgcctcgattccgaccgccgctgctttgcgttcttccacccgcgcatcccgcgc
gagccgctgatctttgtcgaggtggcattcgcgccggagatggcggccaatgtccataca
ttgctggatgaagccgcgccgctggaagacctgcgccgcgtcaagtgggccatcttctat
tcgatcagcaatacgcaggcgggcctgcgcggcgtgagcttcggcaactttctgctcaag
cgcgtgatcgaggaggtccagcgtgaattcccaaaagtgaatcagttcgccacgctctca
ccaatccccggatttgccgactggctgcgcaagcaggacggcgatgccgttgcgcgcgtg
ctgggcgacaagcgcctggcgcgctggagcgagcgccacggcaaggcgccagcggacggc
gccgggtggctggaggcgctggtgccggacgccgccgataccgtgatccgcgataccgcg
atgaccctggccgcgcatttcctggtgcgcgagcgcaaccagtcgatgcccgccgacccg
gtcgcgcgcttccacctgggcaacggggcatgcgtggagcggctgaactggggcgccgac
ctgtcgcgcaaaggccgcagccagagctgcgggatgatggtcaattatctttacgtgccc
gaggcgctggatgacaatctggcacgcttgggcgccggcaacccgcgcatcagccgtagc
gtcgggaagctgctgtga

DBGET integrated database retrieval system