KEGG   Ralstonia eutropha H16: H16_A3039Help
Entry
H16_A3039         CDS       T00416                                 

Gene name
h16_A3039
Definition
Fatty-acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:reh01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:reh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3288903..3290093)
Genome map
AA seq 396 aa AA seqDB search
MFDTILDWAANGLANWTWWEIVIYTLVMTHITIASVTIFLHRCMAHRSLDLHPIAQHFFR
FWLWLTTGMVTREWTAIHRKHHAKCETEEDPHSPQTRGIRKVLLEGAELYRAESKNKETI
AKFGHGCPNDWIERNVYSRFGWQGVGLMLIIDLALFGVIGMTVWAVQMLWIPIHAAGIIN
GLGHWWGYRNYDCEDASTNVSPWGLIIGGEELHNNHHTYPTSAKFSIKWYEFDVGWGYIR
AMQAVGLAKVKKTPPKARLVEARPVDHNTLEAIIANRYDVMARYAKAVKGAFRQELEKLK
EGRVAEYRSFKPASKWFHREETKLAAPQREQLASIVEQNKALQTFVEMRRELAAIWGRSN
LTREQLLQQLQAWCHRAEASGIQALQDFSLRLRRYA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgacactattcttgactgggccgccaacggccttgccaactggacctggtgggag
atcgtcatctacacgctcgtgatgacgcatatcacgatcgccagtgtcaccattttcctg
caccgctgcatggcgcaccggtcgctggatctgcacccgatcgcccagcatttcttccgc
ttctggctctggctgaccacgggcatggtcacgcgcgagtggaccgccatccaccgcaag
caccacgccaagtgcgaaaccgaagaagatccgcacagcccgcagacccgcggcatccgc
aaggtgctgctggagggagcggagctgtatcgtgccgaatccaagaacaaggaaaccatc
gccaagtttggccatggctgccccaatgactggatcgagcgcaacgtgtactcgcgcttc
ggctggcagggtgtcggcctgatgctgatcatcgacctcgcgctgttcggcgtgatcggc
atgaccgtttgggccgtgcagatgctgtggatcccgatccatgccgccggcatcatcaat
ggcctgggccactggtggggctatcgcaactacgattgcgaggacgcctcgaccaacgtg
tcgccgtggggcctgatcattggtggcgaagagctgcacaacaaccaccacacgtacccg
acctcggccaagttctcgatcaagtggtatgagttcgatgtgggctggggctatatccgc
gcgatgcaggcagtcggcctggccaaggtcaagaagaccccgcccaaggcacgcctggtg
gaagcccgcccggttgaccacaacacgctggaagcgatcatcgccaaccgctatgacgtg
atggcgcgctacgccaaggccgtcaagggcgcgttccgccaggaactggaaaagctcaag
gaaggccgcgtggccgagtaccgcagcttcaagcccgccagcaagtggttccaccgcgag
gaaaccaagctggccgcgccgcagcgcgaacagctggcaagtatcgttgaacagaacaag
gcgctgcagaccttcgtcgaaatgcgccgtgaactggccgccatctggggccgttccaac
ctgacgcgcgagcagctgctgcagcagctgcaggcctggtgccatcgtgccgaggccagc
ggcatccaggcgctgcaagatttctcgctgcgcctgcgccgctacgcctga

DBGET integrated database retrieval system