KEGG   Ralstonia eutropha H16: H16_A3102Help
Entry
H16_A3102         CDS       T00416                                 

Gene name
h16_A3102
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
reh  Ralstonia eutropha H16
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:reh00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:reh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3356215..3356709)
Genome map
AA seq 164 aa AA seqDB search
MSNVYQFEANSLAGQPVPLSQFQGKVMLVVNTASECGFTPQYEGLQKLYDEYHERGLEVL
GFPCNQFGKQEPGDAQQIGQFCETRFAVRFPMFAKIDVNGADAHPLYQWLTTEKRGVLGT
QGIKWNFTKFLLRRDGTVFKRYAPTTKPDELRADIEMLLSDPAA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgtctaccagttcgaagccaactcgctggccggccagccggtaccgctgtcg
cagttccagggcaaggtgatgctggtcgtcaacaccgccagcgaatgcgggttcacgccg
cagtacgagggcctgcagaagctctacgacgaataccacgagcgcggcctggaggtgctg
ggcttcccgtgcaaccagttcggcaagcaggagccgggcgatgcgcagcagatcggccag
ttctgcgaaacgcgctttgcggtgcgcttcccgatgttcgccaagatcgacgtgaacggt
gccgacgcccatccgctgtaccagtggctgaccacggaaaagcgtggcgtgctcggtacc
cagggcatcaaatggaacttcaccaagttcctgctgcgccgcgacggcacggtgttcaag
cgctatgcgccgaccaccaagcccgacgagctgcgcgccgatatcgagatgctgctgtcc
gacccggctgcctga

DBGET integrated database retrieval system