KEGG   Cupriavidus necator H16: H16_A3152Help
Entry
H16_A3152         CDS       T00416                                 

Gene name
h16_A3152
Definition
Guanyl-specific ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
reh  Cupriavidus necator H16
Brite
Enzymes [BR:reh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     H16_A3152 (h16_A3152)
Transfer RNA biogenesis [BR:reh03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    H16_A3152 (h16_A3152)
 Prokaryotic Type
    H16_A3152 (h16_A3152)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3410780..3411151)
Genome map
AA seq 123 aa AA seqDB search
MLARSMTGAALVLALAQPTLARQVQTEGMGTIAVQQLPNDARQTLERIEAGGPFLYDKDG
SRFGNYERILPQRERGYYREYTVKSARSRNRGAKRIVCGGEQRAANDCYYTEDHYNSFKR
ILK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggtccatgaccggcgcggcgctggtgctggccctggcgcagccgacgctg
gcgcggcaggtgcagaccgaagggatgggaaccattgcagtgcagcagttgcccaacgat
gcacggcagaccctggagcgcatcgaagccggcggcccgttcctgtatgacaaggacgga
tcgagattcggcaactacgaacgcatcctgcctcaacgtgaacgcgggtattaccgcgaa
tacacggtcaagagcgccaggagccggaaccggggagccaagcggatcgtctgcggcgga
gaacaacgcgctgccaacgattgttactacacggaagatcactacaacagcttcaaacgg
atactcaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system