KEGG   Ralstonia eutropha H16: H16_A3223Help
Entry
H16_A3223         CDS       T00416                                 

Gene name
h16_A3223
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
reh  Ralstonia eutropha H16
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H16_A3223 (h16_A3223)
Enzymes [BR:reh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     H16_A3223 (h16_A3223)
Peptidases [BR:reh01002]
 Cysteine Peptidases
  Family C44
   H16_A3223 (h16_A3223)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3476505..3478091)
Genome map
AA seq 528 aa AA seqDB search
MLKATINIDDLVRTPRIHSGGIQVEGSDITPFPNPCLRTVFVQGKDRWIYAVLERGAQKL
DDRLPTVHDARSFEDYASIHRTILSWPLDYVLIEAVSNGENAQLRITSGRLGVAPLYATV
GVGRVLLSWDCADLISRGSHSADFEVLAHALGLRTFYASRQVCTGIALLTERSSLSLDAN
SASFAYPSAAPALSPHALRDGVDALGTFESYLEGAIGARPLDASACIAELSGGMDSASVA
IAAARVLGGLKQSAGIVLAGTDHTIQNTRRRLIAREIGLRDASFDMSTHMPSLDLDPSAR
EPEHPLGEFYLEAFDEIWRHAATLGCHTLLTGIGGDELFPRYQTDKAAGDWKRPARLIAA
ERIARSILSRRAQVALDTEPLYCAPASVVPHTGLLAHASRSPYMLRRGLWPVNPLCDPAL
IGFCHRLPGEFRLDRQLLRQYLRTRLEHDLFPIGYKKETFDYVLPEVIGCHYARLSAQLR
ESALADFGLVDMTAVRKVLSGVADTRDVTATAPLAIFLFLERFMRQIA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaggcaactatcaacatcgatgatctggtgcggacgccccgtattcatagcggg
ggcattcaggtggagggaagcgacattactccatttcccaacccatgcctccgtactgta
tttgtacaagggaaggatcgttggatctacgccgtgctcgaacgcggtgcgcagaagttg
gacgatcgtcttccgactgtgcatgatgcccggtcatttgaagactatgccagcatccat
cggacaattctgagttggcctcttgattatgtgttgattgaagccgtttccaatggggaa
aatgcacagcttcgcatcacgtctgggaggcttggagtcgctcccctctatgcgactgtg
ggagtggggcgcgtgttgctgtcctgggactgcgctgacttgatctctcgggggagtcat
tctgccgattttgaggtgctggcccatgctctaggcctgcgcaccttctacgccagtcgc
caagtttgtacaggaatagcgctgctgaccgagcgctcgtcactcagtcttgacgcaaac
agcgcgtcattcgcttacccgtccgcggcgccagcgctatcgccgcacgctttgcgggat
ggagtggatgcgctgggtactttcgaatcatacttggagggcgccatcggtgctcgtcct
ctcgatgcgagtgcatgtatagcggaactaagcggaggcatggattctgcatcggtagcg
attgccgcagcgcgcgttctcggcggtctgaagcaatcggctggcatcgtgcttgctgga
acggaccataccattcagaacaccaggcggaggctgatcgcgcgggaaatcggccttcgc
gacgcgtcctttgacatgtcgacgcatatgcctagtttggatctggatccttccgcgaga
gaacctgagcatccccttggcgaattttatctcgaggcattcgatgagatatggcgtcac
gcggcaacgcttgggtgccatacacttctgacgggaatcggcggcgacgaactgtttcct
cgctatcagaccgacaaggcagccggcgactggaaaagacctgcgcggttgatcgcggca
gaacgtattgcccgatcaattctgagccgtcgtgcccaagtagccttggataccgagccg
ttgtattgcgcgcccgccagtgttgttccccatactgggctgctggctcatgcctcgcgc
tcgccgtacatgctgcgacgcggactttggccggtgaatccactgtgcgatccggcgctg
attggattctgtcatcggttaccgggggaatttcgccttgaccggcaactactccgccag
tatctccgtactcgtctggagcatgatctatttccaatcgggtacaaaaaggagacattc
gactacgtgcttccggaggtcatcgggtgccattacgctcgattgagtgcgcaactccgc
gaaagtgcactggctgactttgggttggttgatatgaccgcggtgaggaaggtgctaagt
ggcgtagccgatacacgcgacgttaccgcgacggcgccactcgcaatttttctttttctt
gagcgcttcatgagacagatcgcatag

DBGET integrated database retrieval system