KEGG   Ralstonia eutropha H16: H16_A3322Help
Entry
H16_A3322         CDS       T00416                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01130  Biosynthesis of antibiotics
reh01230  Biosynthesis of amino acids
Module
reh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    H16_A3322 (trpC)
Enzymes [BR:reh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     H16_A3322 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: CAJ94391
UniProt: Q0K6I0
Position
1:3594324..3595127
Genome map
AA seq 267 aa AA seqDB search
MSDILQKILAVKADEVAAARKKRDLPSLRAEAESLRTEPGLAPRGFERALREKIAAGQAG
VIAEVKKASPSKGVLREHFVPEAIAESYASHGAACLSVLTDVNFFQGHADYLKRARGACP
LPALRKDFMVDLYQVYEARTWGADCILLIVAALDPGLMAELEACALELGMDVLVEVHGDD
ELDAALRLKTPLLGVNNRNLRTFEVSLDNTLDLLPHMPADKLVVTESGILGQADVKRMRD
ANVHAFLVGEAFMRAPDPGVELARLFA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgcaaaagatcctggccgtaaaggccgacgaggtcgccgccgcacgc
aagaagcgcgacctgcccagcctgcgcgcggaggccgaaagcctgcgcactgagccgggc
ctggcaccgcgcggctttgagcgcgcgctgcgcgagaagatcgccgccggccaggccggc
gtgatcgccgaggtcaagaaggcatcgccgtccaagggcgtgctgcgcgagcacttcgtg
cccgaggccattgccgaaagctacgccagccatggcgctgcctgtttatcggtgctgacc
gacgtgaacttcttccagggacacgccgactacctgaagcgcgcccgcggcgcctgccca
ttgccggccctgcgcaaggacttcatggtcgacctgtaccaggtgtatgaagcgcgcacc
tggggcgccgactgcatcctgctgatcgtcgccgcgctggacccgggcctgatggccgaa
ctggaagcctgtgcgcttgagctcggcatggatgtgctggtggaagtgcacggcgacgac
gagctcgacgcggcgctgcgcctgaaaacgccgctgctcggcgtgaacaaccgcaacctg
cgcaccttcgaggtgtcgctggacaacacgctggacctgctgccgcatatgccggccgac
aagctggtggtgaccgagtccggcatcctcggccaggccgatgtgaagcgcatgcgcgat
gccaacgtgcatgcgttcctggtgggcgaagcgtttatgcgggcgccggatccgggcgtg
gagctggcacggctgtttgcctga

DBGET integrated database retrieval system