KEGG   Ralstonia eutropha H16: H16_A3330Help
Entry
H16_A3330         CDS       T00416                                 

Gene name
h16_A3330
Definition
(GenBank) alcohol dehydrogenase
  KO
K19745  acrylyl-CoA reductase (NADPH) [EC:1.3.1.-]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00640  Propanoate metabolism
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    H16_A3330 (h16_A3330)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.-  
     H16_A3330 (h16_A3330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2 adh_short Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: CAJ94399
UniProt: Q0K6H2
Position
1:complement(3604620..3605624)
Genome map
AA seq 334 aa AA seqDB search
MTFQALLLTQADGATQASIATLDDAQLPADGDVLVAVDYSTINFKDGLAITGRSPVVRKW
PMVAGIDGAGTVLESAHPRWKAGDKVVLNGYGVGETHWGCLAQRARLKGDWLVRLPDAFT
TRQAMAIGTAGYTAMLSVLALERGGVDGPVRPGDGEVLVTGASGGVGTVAISLLSKLGYK
VVASTGKTREADFLKALGADDVIDRAELGVPGKPLQKERWAAVVDSVGSHTLVNACAQVR
YGGVVTACGLAQGLDFPGSVAPFILRGITLHGIDSVMAAMPLREQAWQRLAGDLEPDRLN
ALTREIGLGDAIEAGRKIMEGGMRGRVVVDVNRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccaggcattgctgctgacccaggccgacggcgccacccaggccagtatcgcc
acgctcgacgacgcgcagctgcccgccgacggcgacgtgctggttgccgtcgactactcc
accatcaacttcaaggacgggctggcgatcacgggccgctcgccggtggtgcgcaagtgg
ccgatggtggcgggcatcgacggcgccggcacggtgctggaatccgcgcacccgcgctgg
aaggcaggcgacaaggtagtgctcaacggctacggcgtgggcgagacgcattggggctgc
cttgcgcagcgcgcgcgcctgaagggcgactggctggtgcgcctgcccgacgccttcacc
acgcgccaggccatggcgatcggcaccgcgggctataccgcgatgctgtcggtgctggcg
ctggagcgcggcggcgtcgacggcccggtgcgccccggcgatggcgaggtgctggtgacc
ggcgcctccggtggggtggggacggtggcgatctcgctgctgagcaagcttggctacaag
gtggtggcctcgaccggcaagacccgggaggcggatttcctgaaggcgctgggcgccgat
gacgtgatcgaccgtgctgagctgggcgtacccggcaagccgctgcaaaaggagcgctgg
gccgcggtggtcgactcggtcggctcgcacacgctggtcaatgcctgcgcccaggtgcgc
tacggcggcgtggtgacggcgtgcgggctggcgcagggccttgacttcccggggtcggtg
gcgccgttcatcctgcgcggcatcaccttgcacggcatcgacagtgtgatggcggcgatg
ccgctgcgcgagcaggcctggcagcgcctggccggcgacctggagccggaccggctcaat
gcgctgacgcgcgagatcggcctgggcgacgcgatcgaggcgggccgcaagatcatggaa
ggcggcatgcgcgggcgcgtggtggtggatgtgaatcgcggctga

DBGET integrated database retrieval system