KEGG   Cupriavidus necator H16: H16_A3330Help
Entry
H16_A3330         CDS       T00416                                 

Gene name
h16_A3330
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
reh  Cupriavidus necator H16
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H16_A3330 (h16_A3330)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_A3330 (h16_A3330)
  Lipid metabolism
   00071 Fatty acid degradation
    H16_A3330 (h16_A3330)
  Amino acid metabolism
   00350 Tyrosine metabolism
    H16_A3330 (h16_A3330)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H16_A3330 (h16_A3330)
   00626 Naphthalene degradation
    H16_A3330 (h16_A3330)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H16_A3330 (h16_A3330)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3604620..3605624)
Genome map
AA seq 334 aa AA seqDB search
MTFQALLLTQADGATQASIATLDDAQLPADGDVLVAVDYSTINFKDGLAITGRSPVVRKW
PMVAGIDGAGTVLESAHPRWKAGDKVVLNGYGVGETHWGCLAQRARLKGDWLVRLPDAFT
TRQAMAIGTAGYTAMLSVLALERGGVDGPVRPGDGEVLVTGASGGVGTVAISLLSKLGYK
VVASTGKTREADFLKALGADDVIDRAELGVPGKPLQKERWAAVVDSVGSHTLVNACAQVR
YGGVVTACGLAQGLDFPGSVAPFILRGITLHGIDSVMAAMPLREQAWQRLAGDLEPDRLN
ALTREIGLGDAIEAGRKIMEGGMRGRVVVDVNRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccaggcattgctgctgacccaggccgacggcgccacccaggccagtatcgcc
acgctcgacgacgcgcagctgcccgccgacggcgacgtgctggttgccgtcgactactcc
accatcaacttcaaggacgggctggcgatcacgggccgctcgccggtggtgcgcaagtgg
ccgatggtggcgggcatcgacggcgccggcacggtgctggaatccgcgcacccgcgctgg
aaggcaggcgacaaggtagtgctcaacggctacggcgtgggcgagacgcattggggctgc
cttgcgcagcgcgcgcgcctgaagggcgactggctggtgcgcctgcccgacgccttcacc
acgcgccaggccatggcgatcggcaccgcgggctataccgcgatgctgtcggtgctggcg
ctggagcgcggcggcgtcgacggcccggtgcgccccggcgatggcgaggtgctggtgacc
ggcgcctccggtggggtggggacggtggcgatctcgctgctgagcaagcttggctacaag
gtggtggcctcgaccggcaagacccgggaggcggatttcctgaaggcgctgggcgccgat
gacgtgatcgaccgtgctgagctgggcgtacccggcaagccgctgcaaaaggagcgctgg
gccgcggtggtcgactcggtcggctcgcacacgctggtcaatgcctgcgcccaggtgcgc
tacggcggcgtggtgacggcgtgcgggctggcgcagggccttgacttcccggggtcggtg
gcgccgttcatcctgcgcggcatcaccttgcacggcatcgacagtgtgatggcggcgatg
ccgctgcgcgagcaggcctggcagcgcctggccggcgacctggagccggaccggctcaat
gcgctgacgcgcgagatcggcctgggcgacgcgatcgaggcgggccgcaagatcatggaa
ggcggcatgcgcgggcgcgtggtggtggatgtgaatcgcggctga

DBGET integrated database retrieval system