KEGG   Ralstonia eutropha H16: H16_A3331Help
Entry
H16_A3331         CDS       T00416                                 

Gene name
h16_A3331
Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
reh  Ralstonia eutropha H16
Brite
Enzymes [BR:reh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     H16_A3331 (h16_A3331)
Secretion system [BR:reh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   H16_A3331 (h16_A3331)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3605737..3606495)
Genome map
AA seq 252 aa AA seqDB search
MFPFLRRRPAMSAAITAIAGGLAAAGFALHAMAAGEPGTDRIKESLQKMVGGRAEVKSVS
KTPVPGLFEANIGGQVVYTDASGRYILNGEMIDTRTGTNLTEERLAEINRIKWSDLPLAR
AIKWTKGDGSRQVAVFSDPNCGYCKRIEQTFQQMDNITVYTFLYPVLSPDSETKAKQVWC
ASDRTKAWRDWMLKQVALTGNGSCKTPLEENLALGHSMNVTGTPAVFFTDGTRIPGAADV
ATLERKLASIKK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttcccattcctgcgccgccgccccgccatgagcgccgcgatcaccgccatcgccggc
gggctggccgcggcgggcttcgcgctgcatgccatggccgcgggcgagcccggcaccgac
cgcatcaaggagtcgctgcagaagatggtgggcggccgtgctgaagtgaagagcgtgagc
aagaccccggtgccgggcctgttcgaggccaatataggcgggcaggtggtctacaccgac
gcctcgggccgctacatcctgaacggcgagatgatcgacacccgcaccggcaccaacctg
accgaggagcggctggccgagatcaaccgcatcaagtggtcggacctgccgctggcgcgc
gcgatcaagtggaccaagggcgatggcagccgccaggtggcggtgttctccgaccccaac
tgcggctattgcaagcgcatcgagcagaccttccagcagatggacaacatcaccgtgtac
accttcctgtacccggtgctgtcgccggattccgaaaccaaggccaagcaggtctggtgc
gcgtccgaccgcaccaaggcctggcgcgactggatgctcaagcaggtggcgctgaccggc
aacggcagctgcaagaccccgctggaagaaaacctggcattgggccacagcatgaacgtg
accggcactccggcggtgttcttcaccgacggcacccgcattcccggcgcggcggatgtc
gccacgctggaacgcaagctcgccagcatcaagaaataa

DBGET integrated database retrieval system