KEGG   Ralstonia eutropha H16: H16_A3453Help
Entry
H16_A3453         CDS       T00416                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00860  Porphyrin and chlorophyll metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
Module
reh_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H16_A3453 (hemB)
Enzymes [BR:reh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     H16_A3453 (hemB)
Exosome [BR:reh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H16_A3453 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAJ94521
UniProt: Q0K650
Position
1:3733879..3734871
Genome map
AA seq 330 aa AA seqDB search
MSTFPEYRPRRMRRDDFSRRMMREHRLSPDNLIYPVFILDGQNQRQAVASMPGVERVSVD
LLMPVAEDCVKLGIPVIALFPVIDPSLKTPDGIEATNPEGLVPRAVRALKDRFPELGVLC
DVALDPYTSHGQDGVLDDNGYVINDVTVEILVRQALAQAEAGVDIVAPSDMMDGRIGAVR
TALEDNGHIHTRIMAYSAKYASAFYGPFRDAVGSAANLGKGNKMTYQMDPANTDEALREV
AQDILEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAQNGWLDHDKV
MMESLLAFRRAGADGILTYFARDAARLLTA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccttccccgaataccgcccgcgccgcatgcgccgcgatgatttctcccgccgc
atgatgcgcgagcatcgcctgtcgccggacaacctgatctaccccgtcttcatccttgac
ggccagaaccagcgccaggcggtggcgtcgatgccgggcgtcgagcgcgtgtcggtcgac
ctgctgatgccggtggccgaagactgcgtcaagctgggcatcccggtgatcgcgctgttc
ccggtgatcgacccgtcgctgaagacgccggacggcatcgaggccaccaaccccgagggc
ctggtgccacgtgccgtgcgcgcgctcaaggaccgcttccccgagctcggcgtgctctgc
gacgtggcgctcgacccgtacaccagccacggccaggacggcgtgctggacgacaacggc
tacgtcatcaacgatgtgaccgtcgagatcctggtgcgccaggcattggcacaggccgaa
gccggtgtcgacatcgtggccccgtccgacatgatggatggccgcatcggcgcggtgcgc
accgcgctggaagacaacggccatatccatacgcgcatcatggcgtactcggccaagtat
gcgtcggcgttctacggccccttccgcgacgcggtgggctcggccgccaacctgggcaag
ggcaacaagatgacctaccagatggatccggccaataccgacgaggccctgcgcgaggtg
gcacaggacatcctggaaggcgccgacatggtgatggtcaagcccggcatgccgtacctg
gacatcgtgcgccgcgtgaaggacgagttccgcttccccacctacgtctaccaggtcagc
ggcgaatacgcgatgctcaaggccgccgcgcagaacggctggctggaccacgacaaggtg
atgatggaatcgctgctggccttccgccgcgccggcgccgacggcatcctgacctatttc
gcgcgcgacgccgcgcggctgctgacggcctga

DBGET integrated database retrieval system