KEGG   Cupriavidus necator H16: H16_A3666Help
Entry
H16_A3666         CDS       T00416                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
reh  Cupriavidus necator H16
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    H16_A3666 (pldB)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     H16_A3666 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3948525..3949457)
Genome map
AA seq 310 aa AA seqDB search
MEQPMTDDPAIAGVAGMPADTPAGTHAPVQSRQRMRDGTELLLRTWQPDPARFAEPLGSV
LLVHGLAEHAGRYQHVADVLCGLGLRVRAHDLRGHGASGGARMVADHQDAYLDDLAEIYD
AAVPGWNELPILLGHSMGGMIAARFATARVRPVRALVLSSPALALRLSGPMLALHRVLLA
LAPRLRVPNPIDARLLSHDPAVVAAYRSDPLVQTTITASVLESFIRGMAQAQADAALLEA
PMLMLVGGADRVVDPAGSRSFFDHAPPELREQVWFEHGYHEIFNEAQPLRGEVFAALTGW
LQRHLQQQGH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaccgatgacggacgatcctgctattgccggtgttgccggcatgcctgccgat
accccagccggcacgcacgcgccggtacagagccgccagcgcatgcgcgacggcaccgag
ctgctgctgcgcacctggcagcccgatccggcgcgctttgccgagccgctcggctcggtg
ctgctggtgcatgggcttgccgagcatgccggacgctaccagcatgtggccgatgtgctg
tgcgggctgggcctgcgcgtgcgcgcgcacgacctgcgcggccatggcgccagcggcggc
gcgcgcatggtggcggaccatcaggatgcctacctcgacgacctcgccgagatctatgat
gccgcggtgccgggctggaacgagttgccgatcctgctcggccacagcatgggcgggatg
atcgcggcgcgctttgccaccgcgcgcgtgcgcccggtgcgcgcgctggtgctgtcctcg
cctgcgctggcgctgcgcctgtcgggcccgatgctggcgctgcaccgcgtgctgctggcg
ctggcgccgcggctgcgcgtgcccaatccgatcgatgcgcggctcttgtcgcacgatccc
gccgtggtggccgcctaccgctcagacccgctggtgcagaccaccatcaccgccagcgta
ctggagagctttatccgcggcatggcgcaggcccaggccgatgccgcgctgctggaggcc
cccatgctgatgctggtcggtggcgccgaccgcgtggtggacccggccggcagccgcagc
ttcttcgaccacgcgccgccggagttgcgcgaacaggtctggttcgagcacggctaccac
gagatcttcaatgaagcgcagccgctgcgcggcgaagtgttcgcggcgctgaccggctgg
ctgcagcgtcacctgcagcagcagggacactaa

DBGET integrated database retrieval system