KEGG   Ralstonia eutropha H16: H16_A3666Help
Entry
H16_A3666         CDS       T00416                                 

Gene name
pldB
Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:reh00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3948525..3949457)
Genome map
AA seq 310 aa AA seqDB search
MEQPMTDDPAIAGVAGMPADTPAGTHAPVQSRQRMRDGTELLLRTWQPDPARFAEPLGSV
LLVHGLAEHAGRYQHVADVLCGLGLRVRAHDLRGHGASGGARMVADHQDAYLDDLAEIYD
AAVPGWNELPILLGHSMGGMIAARFATARVRPVRALVLSSPALALRLSGPMLALHRVLLA
LAPRLRVPNPIDARLLSHDPAVVAAYRSDPLVQTTITASVLESFIRGMAQAQADAALLEA
PMLMLVGGADRVVDPAGSRSFFDHAPPELREQVWFEHGYHEIFNEAQPLRGEVFAALTGW
LQRHLQQQGH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaccgatgacggacgatcctgctattgccggtgttgccggcatgcctgccgat
accccagccggcacgcacgcgccggtacagagccgccagcgcatgcgcgacggcaccgag
ctgctgctgcgcacctggcagcccgatccggcgcgctttgccgagccgctcggctcggtg
ctgctggtgcatgggcttgccgagcatgccggacgctaccagcatgtggccgatgtgctg
tgcgggctgggcctgcgcgtgcgcgcgcacgacctgcgcggccatggcgccagcggcggc
gcgcgcatggtggcggaccatcaggatgcctacctcgacgacctcgccgagatctatgat
gccgcggtgccgggctggaacgagttgccgatcctgctcggccacagcatgggcgggatg
atcgcggcgcgctttgccaccgcgcgcgtgcgcccggtgcgcgcgctggtgctgtcctcg
cctgcgctggcgctgcgcctgtcgggcccgatgctggcgctgcaccgcgtgctgctggcg
ctggcgccgcggctgcgcgtgcccaatccgatcgatgcgcggctcttgtcgcacgatccc
gccgtggtggccgcctaccgctcagacccgctggtgcagaccaccatcaccgccagcgta
ctggagagctttatccgcggcatggcgcaggcccaggccgatgccgcgctgctggaggcc
cccatgctgatgctggtcggtggcgccgaccgcgtggtggacccggccggcagccgcagc
ttcttcgaccacgcgccgccggagttgcgcgaacaggtctggttcgagcacggctaccac
gagatcttcaatgaagcgcagccgctgcgcggcgaagtgttcgcggcgctgaccggctgg
ctgcagcgtcacctgcagcagcagggacactaa

DBGET integrated database retrieval system